Fibronectin

Overview
NameFibronectin
Smed IDSMED30014507
Length (bp)5287
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fibronectin (SMED30014507) t-SNE clustered cells

Violin plots show distribution of expression levels for Fibronectin (SMED30014507) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fibronectin (SMED30014507) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fibronectin (SMED30014507) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014507

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014507SMESG000029259.1 SmedASXL_015124SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30014507SMESG000029226.1 SMESG000029259.1 SmedASXL_015123SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30014507SMESG000029259.1 dd_Smed_v4_43824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014507SMESG000029259.1 dd_Smed_v4_43824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014507SMESG000029259.1 dd_Smed_v4_43824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30014507SMESG000029259.1 dd_Smed_v4_43824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014507SMESG000029259.1 dd_Smed_v4_43824_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014507SMESG000029226.1 SMESG000029259.1 dd_Smed_v4_16808_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014507SMESG000029226.1 SMESG000029259.1 dd_Smed_v4_16808_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014507SMESG000029226.1 SMESG000029259.1 dd_Smed_v4_16808_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014507SMESG000029226.1 SMESG000029259.1 dd_Smed_v4_16808_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30014507SMESG000029226.1 SMESG000029259.1 dd_Smed_v4_16808_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014507SMESG000029226.1 SMESG000029259.1 dd_Smed_v6_16808_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30014507SMESG000029226.1 SMESG000029259.1 dd_Smed_v6_16808_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30014507SMESG000029226.1 SMESG000029259.1 dd_Smed_v6_16808_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fibronectin vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 56.225 bits (134), Expect = 9.665e-7
Identity = 44/176 (25.00%), Postives = 73/176 (41.48%), Query Frame = 3
Query: 1962 LNFKTSAPPTPPKNLCVVSATGSSIALQWDSP-IEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEK 2486
            +N +    P PP++L V   T +S+ L WD P ++ GS+I     Y  E  E + K   TV       +  ++ L E   Y FR+ A   EY + LP     E+A  ++ +E                        PP  I + +   N + + W  P  +G +R+L  ++ +  K
Sbjct: 15572 VNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKI---KNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLA-ENEYGIGLP----AETAESVKASER---------------------PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTK 15718          
BLAST of Fibronectin vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 55.8398 bits (133), Expect = 9.746e-7
Identity = 44/176 (25.00%), Postives = 73/176 (41.48%), Query Frame = 3
Query: 1962 LNFKTSAPPTPPKNLCVVSATGSSIALQWDSP-IEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEK 2486
            +N +    P PP++L V   T +S+ L WD P ++ GS+I     Y  E  E + K   TV       +  ++ L E   Y FR+ A   EY + LP     E+A  ++ +E                        PP  I + +   N + + W  P  +G +R+L  ++ +  K
Sbjct: 15639 VNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKI---KNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLA-ENEYGIGLP----AETAESVKASER---------------------PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTK 15785          
BLAST of Fibronectin vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 55.8398 bits (133), Expect = 1.008e-6
Identity = 44/176 (25.00%), Postives = 73/176 (41.48%), Query Frame = 3
Query: 1962 LNFKTSAPPTPPKNLCVVSATGSSIALQWDSP-IEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEK 2486
            +N +    P PP++L V   T +S+ L WD P ++ GS+I     Y  E  E + K   TV       +  ++ L E   Y FR+ A   EY + LP     E+A  ++ +E                        PP  I + +   N + + W  P  +G +R+L  ++ +  K
Sbjct: 15447 VNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKI---KNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLA-ENEYGIGLP----AETAESVKASER---------------------PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTK 15593          
BLAST of Fibronectin vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 55.4546 bits (132), Expect = 1.277e-6
Identity = 44/176 (25.00%), Postives = 73/176 (41.48%), Query Frame = 3
Query: 1962 LNFKTSAPPTPPKNLCVVSATGSSIALQWDSP-IEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEK 2486
            +N +    P PP++L V   T +S+ L WD P ++ GS+I     Y  E  E + K   TV       +  ++ L E   Y FR+ A   EY + LP     E+A  ++ +E                        PP  I + +   N + + W  P  +G +R+L  ++ +  K
Sbjct: 21944 VNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKI---KNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLA-ENEYGIGLP----AETAESVKASER---------------------PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTK 22090          
BLAST of Fibronectin vs. Ensembl Human
Match: TTN (titin [Source:HGNC Symbol;Acc:HGNC:12403])

HSP 1 Score: 55.4546 bits (132), Expect = 1.400e-6
Identity = 44/176 (25.00%), Postives = 73/176 (41.48%), Query Frame = 3
Query: 1962 LNFKTSAPPTPPKNLCVVSATGSSIALQWDSP-IEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEK 2486
            +N +    P PP++L V   T +S+ L WD P ++ GS+I     Y  E  E + K   TV       +  ++ L E   Y FR+ A   EY + LP     E+A  ++ +E                        PP  I + +   N + + W  P  +G +R+L  ++ +  K
Sbjct: 22871 VNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKI---KNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLA-ENEYGIGLP----AETAESVKASER---------------------PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTK 23017          
BLAST of Fibronectin vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0081260)

HSP 1 Score: 56.225 bits (134), Expect = 3.481e-7
Identity = 67/297 (22.56%), Postives = 118/297 (39.73%), Query Frame = 3
Query: 1368 LHIESMNSKGILLNWDSPEETDNYHVIGYRILKNGFVYGSNVIPNSVNSLWIKDIMLGNRVELQ-----XXXXXXXXXXXXAPSSKIVI--HYTGLVSSPTKFEVESVNGFGAVLAWNKVTEKKHHFIPPDHFQVTWWNSTNPDNFDVRSISTKDSMVYITD-LTPNTNYTAVLEGRSVNNFKEIYEEKSRSCFNHKITLSSDPIKLNFKTSAPPTPPKNLCVVSATGSSIALQW-DSPIEY--GSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVT 2225
            + + +++S  +++ W+ PE T N  V GY++    +   SN    S NS  + +  L    EL       + +         P S  V      G+ S P+ F    +      L W K T    + +   H+++ +WN T  +    + IS  +S  Y  D L P+T Y   L  RS                      ++ PI +  K   P  PP+N+  ++ + ++I+L W   P+E   G  I + V +     E       T+ +T    +++++ L    EY   + A T
Sbjct:  423 VQVRTLSSSTMVITWEPPE-TPNGQVTGYKVY---YTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTKPTHSSENIV---HYEL-YWNDTYANQAHHKRIS--NSEAYTLDGLYPDTLYYIWLAARS----------------QRGEGATTPPIPVRTKQYVPGAPPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMT----SIVLDELKRWTEYKIWVLAGT 689          
BLAST of Fibronectin vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0112800)

HSP 1 Score: 56.225 bits (134), Expect = 3.506e-7
Identity = 67/297 (22.56%), Postives = 120/297 (40.40%), Query Frame = 3
Query: 1368 LHIESMNSKGILLNWDSPEETDNYHVIGYRILKNGFVYGSNVIPNSVNSLWIKDIMLGNRVELQ-----XXXXXXXXXXXXAPSSKIVI--HYTGLVSSPTKFEVESVNGFGAVLAWNKVTEKKHHFIPPDHFQVTWWNSTNPDNFDVRSISTKDSMVYITD-LTPNTNYTAVLEGRSVNNFKEIYEEKSRSCFNHKITLSSDPIKLNFKTSAPPTPPKNLCVVSATGSSIALQW-DSPIEY--GSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVT 2225
            + + +++S  +++ W+ PE T N  V GY++    +   SN    S NS  + +  L    EL       + +         P S  V      G+ S P+ F    +      L W K T    + +   H+++ +WN T  +    + IS  +S  Y  D L P+T Y   L  RS         ++           ++ PI +  K   P  PP+N+  ++ + ++I+L W   P+E   G  I + V +     E       T+ +T    +++++ L    EY   + A T
Sbjct:  405 VQVRTLSSSTMVITWEPPE-TPNGQVTGYKVY---YTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTKPTHSSENIV---HYEL-YWNDTYANQAHHKRIS--NSEAYTLDGLYPDTLYYIWLAARS---------QRGEGA-------TTPPIPVRTKQYVPGAPPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMT----SIVLDELKRWTEYKIWVLAGT 671          
BLAST of Fibronectin vs. Ensembl Zebrafish
Match: ttn.1 (titin, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030616-413])

HSP 1 Score: 53.1434 bits (126), Expect = 4.878e-6
Identity = 41/167 (24.55%), Postives = 67/167 (40.12%), Query Frame = 3
Query: 1986 PTPPKNLCVVSATGSSIALQWDSPIEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEK 2486
            P  P+NL +   T  S++L WD PI  G     +  Y  E  E + K   TV       N  ++ L E   Y FR+ A   EY + LP     E+   ++++E                        PP  I +Q+     + + W  P  +G +R+++ V+ +  K
Sbjct: 16201 PGAPQNLKISQVTKESVSLIWDPPINDGG--TKIKNYIVEKREATRKAYATVNSNCHKTNWTVDQLQEGCNYYFRVLA-ENEYGIGLP----IETGESVKVSEK---------------------PLPPGKITLQDVTKTTVTLSWEKPEHDGGSRVVAYVVEMQSK 16339          
BLAST of Fibronectin vs. Ensembl Zebrafish
Match: ttn.1 (titin, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030616-413])

HSP 1 Score: 53.1434 bits (126), Expect = 5.046e-6
Identity = 41/167 (24.55%), Postives = 67/167 (40.12%), Query Frame = 3
Query: 1986 PTPPKNLCVVSATGSSIALQWDSPIEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEK 2486
            P  P+NL +   T  S++L WD PI  G     +  Y  E  E + K   TV       N  ++ L E   Y FR+ A   EY + LP     E+   ++++E                        PP  I +Q+     + + W  P  +G +R+++ V+ +  K
Sbjct: 17894 PGAPQNLKISQVTKESVSLIWDPPINDGG--TKIKNYIVEKREATRKAYATVNSNCHKTNWTVDQLQEGCNYYFRVLA-ENEYGIGLP----IETGESVKVSEK---------------------PLPPGKITLQDVTKTTVTLSWEKPEHDGGSRVVAYVVEMQSK 18032          
BLAST of Fibronectin vs. Ensembl Xenopus
Match: xirp2 (xin actin binding repeat containing 2 [Source:Xenbase;Acc:XB-GENE-988805])

HSP 1 Score: 52.7582 bits (125), Expect = 6.923e-6
Identity = 46/176 (26.14%), Postives = 74/176 (42.05%), Query Frame = 3
Query: 1962 LNFKTSAPPTPPKNLCVVSATGSSIALQWDSP-IEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEK 2486
            +N K    P PP NL     T  SI LQWD P I+ GS I   V+   ES+ K+     T+       ++ + +L+E  EY FR+ A   E+ +  P     E+A  +  +E  S                     PP ++ + +   N + + W  P  +G +++   VI   +K
Sbjct:  228 VNVKVLDSPGPPLNLKARDVTKDSITLQWDMPLIDGGSRITNYVVEKRESTRKAY---STITTNCQKCSLRVPNLAEGCEYYFRVLA-ENEFGIGEPT----ETAEPIRASEAPS---------------------PPDSLNIMDITKNSVSLAWPKPEHDGGSKITGYVIEAQKK 374          
BLAST of Fibronectin vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 55.0694 bits (131), Expect = 1.376e-6
Identity = 43/176 (24.43%), Postives = 73/176 (41.48%), Query Frame = 3
Query: 1962 LNFKTSAPPTPPKNLCVVSATGSSIALQWDSP-IEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEK 2486
            +N +    P PP+NL +   T +S+ L W+ P ++ GS+I     Y  E  E + K   TV       +  ++ L E   Y FR+ A   EY + LP     E+A  ++ +E                        PP  I + +   N + + W  P  +G +R+L  ++ +  K
Sbjct: 15406 VNVRVLDTPGPPQNLKIKEVTKTSVTLTWEPPLLDGGSKI---KNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLA-ENEYGIGLP----AETAESVKASER---------------------PLPPGKITLTDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSK 15552          
BLAST of Fibronectin vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 54.6842 bits (130), Expect = 1.714e-6
Identity = 42/176 (23.86%), Postives = 75/176 (42.61%), Query Frame = 3
Query: 1962 LNFKTSAPPTPPKNLCVVSATGSSIALQWDSP-IEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEK 2486
            +N +    P PP+NL +   T +S+ L W+ P ++ GS+I   ++   ES+ K+     TV       +  ++ L E   Y FR+ A   EY + LP     E+A  ++ +E                        PP  I + +   N + + W  P  +G +R+L  ++ +  K
Sbjct: 21987 VNVRVLDTPGPPQNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAY---STVATNCHKTSWKVDQLQEGCSYYFRVLA-ENEYGIGLP----AETAESVKASER---------------------PLPPGKITLTDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSK 22133          
BLAST of Fibronectin vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 54.6842 bits (130), Expect = 1.743e-6
Identity = 42/176 (23.86%), Postives = 75/176 (42.61%), Query Frame = 3
Query: 1962 LNFKTSAPPTPPKNLCVVSATGSSIALQWDSP-IEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEK 2486
            +N +    P PP+NL +   T +S+ L W+ P ++ GS+I   ++   ES+ K+     TV       +  ++ L E   Y FR+ A   EY + LP     E+A  ++ +E                        PP  I + +   N + + W  P  +G +R+L  ++ +  K
Sbjct: 21987 VNVRVLDTPGPPQNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAY---STVATNCHKTSWKVDQLQEGCSYYFRVLA-ENEYGIGLP----AETAESVKASER---------------------PLPPGKITLTDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSK 22133          
BLAST of Fibronectin vs. Ensembl Mouse
Match: Ttn (titin [Source:MGI Symbol;Acc:MGI:98864])

HSP 1 Score: 54.6842 bits (130), Expect = 1.944e-6
Identity = 42/176 (23.86%), Postives = 75/176 (42.61%), Query Frame = 3
Query: 1962 LNFKTSAPPTPPKNLCVVSATGSSIALQWDSP-IEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEK 2486
            +N +    P PP+NL +   T +S+ L W+ P ++ GS+I   ++   ES+ K+     TV       +  ++ L E   Y FR+ A   EY + LP     E+A  ++ +E                        PP  I + +   N + + W  P  +G +R+L  ++ +  K
Sbjct: 23858 VNVRVLDTPGPPQNLKIKEVTKTSVTLTWEPPLLDGGSKIKNYIVEKRESTRKAY---STVATNCHKTSWKVDQLQEGCSYYFRVLA-ENEYGIGLP----AETAESVKASER---------------------PLPPGKITLTDVTRNSVSLSWEKPEHDGGSRILGYIVEMQSK 24004          
BLAST of Fibronectin vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 53.5286 bits (127), Expect = 3.049e-6
Identity = 46/175 (26.29%), Postives = 85/175 (48.57%), Query Frame = 2
Query: 3749 VLTVTESEMSGNCICLNATQNTDTTVALSWTIPQSLNEDIYSYQVIWKCIQGFEEQKISI-PNSKTFNYEVENLMPGLKYAFRLLAFDNGKQVIEKSKQLYLETNTVLEAPNLQLKATNFSYATICWNSTIPKGNVKLKCFHI-YVNGVMSIEVEASNHIYTYYDGQPCHQYSFL 4267
            +  +T++ + G  +   A   ++T++ LSWT P+S  + I SY+++++     EEQ+I+I P +   +Y ++ L P   Y FRL A  + + +   + ++   T   + A N  +KA   +   + W   IP+       F I Y +G M  EV+         + +P   YSF+
Sbjct:  497 IQVITQTGVPGQPLNFKAEPESETSILLSWTPPRS--DTIASYELVYRDGDQGEEQRITIEPGT---SYRLQGLKPNSLYYFRLSA-RSPQGLGASTAEISARTMQSMFAKNFHVKAVMKTSVLLSWE--IPENYNSAMPFKILYDDGKMVEEVDGRATQKLIVNLKPEKSYSFV 663          
BLAST of Fibronectin vs. UniProt/SwissProt
Match: sp|P16621|LAR_DROME (Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2)

HSP 1 Score: 56.225 bits (134), Expect = 3.489e-6
Identity = 67/297 (22.56%), Postives = 118/297 (39.73%), Query Frame = 3
Query: 1368 LHIESMNSKGILLNWDSPEETDNYHVIGYRILKNGFVYGSNVIPNSVNSLWIKDIMLGNRVELQ-----XXXXXXXXXXXXAPSSKIVI--HYTGLVSSPTKFEVESVNGFGAVLAWNKVTEKKHHFIPPDHFQVTWWNSTNPDNFDVRSISTKDSMVYITD-LTPNTNYTAVLEGRSVNNFKEIYEEKSRSCFNHKITLSSDPIKLNFKTSAPPTPPKNLCVVSATGSSIALQW-DSPIEY--GSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVT 2225
            + + +++S  +++ W+ PE T N  V GY++    +   SN    S NS  + +  L    EL       + +         P S  V      G+ S P+ F    +      L W K T    + +   H+++ +WN T  +    + IS  +S  Y  D L P+T Y   L  RS                      ++ PI +  K   P  PP+N+  ++ + ++I+L W   P+E   G  I + V +     E       T+ +T    +++++ L    EY   + A T
Sbjct:  423 VQVRTLSSSTMVITWEPPE-TPNGQVTGYKVY---YTTNSNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNFRATDIGETAVTLQWTKPTHSSENIV---HYEL-YWNDTYANQAHHKRIS--NSEAYTLDGLYPDTLYYIWLAARS----------------QRGEGATTPPIPVRTKQYVPGAPPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMT----SIVLDELKRWTEYKIWVLAGT 689          
BLAST of Fibronectin vs. UniProt/SwissProt
Match: sp|Q8WZ42|TITIN_HUMAN (Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4)

HSP 1 Score: 55.4546 bits (132), Expect = 6.724e-6
Identity = 44/176 (25.00%), Postives = 73/176 (41.48%), Query Frame = 3
Query: 1962 LNFKTSAPPTPPKNLCVVSATGSSIALQWDSP-IEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEK 2486
            +N +    P PP++L V   T +S+ L WD P ++ GS+I     Y  E  E + K   TV       +  ++ L E   Y FR+ A   EY + LP     E+A  ++ +E                        PP  I + +   N + + W  P  +G +R+L  ++ +  K
Sbjct: 22871 VNVRVLDTPGPPQDLKVKEVTKTSVTLTWDPPLLDGGSKI---KNYIVEKRESTRKAYSTVATNCHKTSWKVDQLQEGCSYYFRVLA-ENEYGIGLP----AETAESVKASER---------------------PLPPGKITLMDVTRNSVSLSWEKPEHDGGSRILGYIVEMQTK 23017          
BLAST of Fibronectin vs. TrEMBL
Match: A0A267EC23 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000421g3 PE=4 SV=1)

HSP 1 Score: 429.869 bits (1104), Expect = 6.249e-119
Identity = 254/895 (28.38%), Postives = 449/895 (50.17%), Query Frame = 3
Query:  390 MPIPLIEV--KQISISEILVKWSLDSEIPKHLKIPVYNLQISGLQFKNIVNSDLSY-FEKDLVTHVWNI-ANENKCFVSGLLPRINYTIHVSATFIMASKQNKQQLNELSTYSEKINYRLAGPPKAPILSVKSIDIYQVILQWE-VEEYDFSELKAFYIQFHNQSKEIKVPVEEKNIVIDNIVDGQFLEIFIFSENIYGKSDK----SNSISIKTSPKPVAPVVISEPTFNHGESIISWTHDSSMLPQNFKIIFFRIFMDDVWHTDITADSAAFSNNEKYNFVFQNLEYDISHEIKVVSVAG--SILNEENVVYCYSHSNLSSPIIISGFKPPDAALLHIESMNSKGILLNWDSPEETDNYHVIGYRILKNGFVYGSNVIPNSVNSLWIKDIMLGNRVELQXXXXXXXXXX----------------XXAPSSKIVIHYTGLVSSPTKFEVESVNGFGAVLAWNKVTEKKHHFIPPDHFQVTWWNSTNPDNFDVRSISTKDSMVYITDLTPNTNYTAVLEGRSVNNFKEIYEEKSRSCFNHKITLSSDPIKLNFKTSAPPTPPKNLCVVSATGSSIALQWDSPIEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKL--ELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEKTHSNKDDSQE------QSSICINVDKYCHVAELDRLLPATMYRIDVEAVVSIKTILNIDKXXXXXXXXXXXXXTTHYPCKVPLFARTKTSPSPPQFLTCSKIVTNTIYISWQQPLMYTTVVHDGNNQSTDFIRHRLEAYRVYVNNKLHATLKPNILSVKLTKCKFGR 2969
            +P+P++++         + V W     +    +  V  + ++G  F   VNSD+S+  E D V H WN    E  C   GL    +Y I V+A+F         Q  ELST S   ++  AGPP+ P L V+S+D+ QV + W     +   +L  + +    + +  ++P + +   ++ +  G+   + +    + G+S +    SN++ +    +P  P +  +PT   G  I++W  +++  PQ   +  +R+F+D+ WH ++ A          Y +   +L+  + ++++  ++AG  +I    + V+C   S LS+P+ +S   PP +  L +ESM  +G+ ++W  P++     + GY++L++G  YGS V+P    S  ++D+ LG R+ LQL+ LT                        P   +V++YTGLV +P +   + V G  A +AW + T  K HFI P H+Q+TWW  ++PD  +V S ST +    +  L P T YT V+E R          E+ +      + +SS P +L+ +T+ PP PP+NL V + T  S+ + WD P+E GSE++ + +  + ++  +  + + +EL PDA   +I +L E  +Y+ R+ AVT+E   SLP       A KL  +L+E   ++ D  W+ + ++LA T+GT  P  I +       +K+ W  PS  G+NRL  QV+R +E   S +  ++        ++  +++D       L+ L P T YRI VEAVVS+KT L+        + +  NRRT H     P F RT+   + P+ +  + +  +++ + W++P     VV         ++R  +E YR+ +N K + +L+P+  + +L KC+ G+
Sbjct:  481 LPVPIVQLLPDPEHPDRVRVTWDFSRPLEHQFRHEVSTVSVAGRAFSAKVNSDMSFDSEADGVVHTWNCTGGERDCLCRGLAIGCDYRISVTASFRQLDSSGIGQ-AELSTKSAVCDFTTAGPPEPPRLVVQSVDVKQVAVAWRPGRAFGGEDLVGYRLLIDGEPQGGQLPAQTQQTTLEPLQPGR--TVAVAVVAVAGRSQRTSQPSNTVRVSCPRRPEPPQLSEQPTSAEGAVIVAWQGEAAAGPQEEDVSKYRVFVDEKWHGELKASP----GRRTYTYYLSDLQAGVVYDVQAKAIAGHKNIDANADHVFCLCESELSAPLSVSCSAPPISPALRVESMTEEGLEISWSVPQQFGEAQISGYQMLRDGEPYGS-VLPADATSFRLRDLTLGQRLTLQLVALTAHPVGRGEERAGGGVEHGQFNRCTPGPALVVNYTGLVLAPARVWCDDVTGHSATVAWTRSTSGKLHFIQPTHYQITWWPGSSPDR-EVNSASTPEDFALLKGLAPATAYTVVVEARC---------EQRQEDGGGTVIVSSRPQRLSLRTAEPPLPPRNLGVTATTCCSLLVAWDPPVERGSEVIGIRVECAPAAGATAGELQVLELMPDATRALIENLRERTDYSVRVCAVTEEALQSLPPRHPARQARKLPADLSELAGLV-DSAWMPAAHLLATTSGTLAPGRIRLAGLTDQAVKLRWQPPSVTGSNRLRGQVVRWAEVPDSARPAARASDWDGPSAADYVSLDPKDSKVTLEGLRPGTKYRIVVEAVVSVKTALDPSADGATAEEELRNRRTAHVSSD-PAFVRTRCHVAQPRPMV-AAVKPDSVLLHWERPYAL-AVVRPEQASERRYVRCHIEGYRLEINGKPYVSLRPDAQTCRLVKCRPGK 1353          

HSP 2 Score: 339.732 bits (870), Expect = 2.214e-90
Identity = 184/607 (30.31%), Postives = 323/607 (53.21%), Query Frame = 2
Query: 3338 TLQVDSLFVSSSHESIGQKIQIFIPGLPKAPLLTCRKLDDENLTVEWTDINVGNDWKIKSFQIFINDSSIAKELENTERTAQITLKNNNHYKVSLCVRLQIHKEQIVTEFSNPIYVSTGPKRRLISQMEYDKFNNMRVLTVTESEMSGNC--ICLNATQNTDTTVALSWTIPQSLNEDIYSYQVIWKCIQGFEEQKISIPNSKTFNYEVENLMPGLKYAFRLLAFDNGKQVIEKSKQLYLETNTVLEAPNLQLKATNFSYATICWNSTIPKGNVKLKCFHIYVNGVMSIEVEASNHIYTYYDGQPCHQYSFLCQAISYEEKYNSKPSNTVKCIWPGCISPPLTSLTPMVANSIRVSWGNPTLSDGAKIKHFRVICSNSETGELIQAVNFIHPESRESEIFHVKFNQYVVRLETYLHGAPYPYLSEPLLIQPETGPDPPVIQLQLLNINDRIELLNKLRNCINEEDSIMRCIHYWGSQNRHTEEEKSLFFKASSLLPAIQENIDNYVYQMSRNDDYVIAELKWTQKQTENKVNVTGFKVLVDGKYYGRELDATCKSVLIKLNVDSKTHKIAMTSVSNKPRLLSGLSNVIEVLTNLYPRLRFFCKPDIH 5152
            T ++++L    + E I Q++Q+  PG P AP +    + D  + VEW++  +     +  +Q+ +N  +  + LE T R A I  + + HY+V L V L  H++   +  S P++VST P    +S+     F +          ++G+   I L  +  TD+T+ + W   Q   + I+S+ + W       E+  ++ + +  +  ++NL+PG  Y+ RL A D+ + V+EKS+ L  +T   ++ P L+L+A NFSY  + W      G+  +  + +++NGV+   + A    YTY  G+ C  YSF  QAIS + ++NSKPS+++   WPGC+   L  L   V+ + RV+W  P L++G K+K FR+IC  ++TG++I+ V  +HPE+RE+E+  ++   Y ++LE  LHG     LS  L +QP   PDPP + + ++ +  R +L   +   +N  D  +R IH        T EE  L  K +     I +++++    +      ++ ++ W   Q+  +V ++G++VLVDG+ YG  L     SV IKL+ D  +H ++M ++       S  SNV+EVLT+ +  + F+C  ++H
Sbjct: 1491 TARLEALLTRETREPIVQQVQLTTPGPPAAPQIFLDAMSDREIVVEWSEPALFGGVGVAGYQLLVNGKAAGEPLEPTHRRAVIPCRASRHYRVQL-VALSAHRDFPDSPPSAPLFVSTYPNMPAVSEAPPPDFADAEA---EGDALAGDLSEIPLTVSARTDSTLTVEWMACQP-PDGIHSFALQWSSPAQPAERTETLAHQER-SCLLQNLLPGTVYSLRLSALDSNRAVVEKSRALRAQTCAPIDTPLLRLRACNFSYIAVHWTEPRHYGDAAVAGYKVFINGVVEETLGAGETSYTYCKGRWCQDYSFQVQAISNDPRFNSKPSDSLLVTWPGCLPGELRPLAGSVSGAARVAWPAPFLTEGVKLKQFRLICKLADTGQVIRVVGPLHPETREAEVTGLRSGTYHLQLEVQLHGTQMAVLSAALTVQPTLTPDPPTVTVSVVGLEQRRQLEATVCRLVNRRDRHVRRIHNIHMLPTKTLEETQLLAKYTETYNQIMDSLEDCFKSLEAYTGELVLQVSWACPQSNQEVPLSGYRVLVDGRQYGSALHQGMSSVRIKLSTDRPSHAVSMVALCESQGTQSPESNVVEVLTDPFQPMAFYCIHEVH 2091          
BLAST of Fibronectin vs. TrEMBL
Match: A0A267H6A9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000421g1 PE=4 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 7.150e-118
Identity = 254/895 (28.38%), Postives = 452/895 (50.50%), Query Frame = 3
Query:  390 MPIPLIEV--KQISISEILVKWSLDSEIPKHLKIPVYNLQISGLQFKNIVNSDLSY-FEKDLVTHVWNI-ANENKCFVSGLLPRINYTIHVSATFIMASKQNKQQLNELSTYSEKINYRLAGPPKAPILSVKSIDIYQVILQWE-VEEYDFSELKAFYIQFHNQSKEIKVPVEEKNIVIDNIVDGQFLEIFIFSENIYGKSDK----SNSISIKTSPKPVAPVVISEPTFNHGESIISWTHDSSMLPQNFKIIFFRIFMDDVWHTDITADSAAFSNNEKYNFVFQNLEYDISHEIKVVSVAG--SILNEENVVYCYSHSNLSSPIIISGFKPPDAALLHIESMNSKGILLNWDSPEETDNYHVIGYRILKNGFVYGSNVIPNSVNSLWIKDIMLGNRVELQXXXXXXXXXXXXAPSSK----------------IVIHYTGLVSSPTKFEVESVNGFGAVLAWNKVTEKKHHFIPPDHFQVTWWNSTNPDNFDVRSISTKDSMVYITDLTPNTNYTAVLEGRSVNNFKEIYEEKSRSCFNHKITLSSDPIKLNFKTSAPPTPPKNLCVVSATGSSIALQWDSPIEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKL--ELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEKTHSNKDDSQE------QSSICINVDKYCHVAELDRLLPATMYRIDVEAVVSIKTILNIDKXXXXXXXXXXXXXTTHYPCKVPLFARTKTSPSPPQFLTCSKIVTNTIYISWQQPLMYTTVVHDGNNQSTDFIRHRLEAYRVYVNNKLHATLKPNILSVKLTKCKFGR 2969
            +P+P++++         + V W     +    +  V  + ++G  F   VNSD+S+  E D V H WN    E  C   GL    +Y I V+A+F         Q  ELST S   ++  AGPP+ P L V+S+D+ QV + W     +   +L  + +    + +  ++PV+ +   ++ +  G+   + +    + G+S +    SN++ +    +P  P +  +PT   G  I++W  +++  PQ   +  +R+F+D+ WH ++ A          Y +   +L+  + ++++V ++AG  +I    + V+C   S LS+P+ +S   PP +  L +ESM  +G+ ++W  P++     + GY++L++G  YG+ V+P    S  ++D+ LG R+ LQL+ LT          ++                +V++YTGLV +P +   + V G  A +AW + T  K HFI P H+Q+TWW  ++PD  +V S ST +    +  L P T YT V+E R          E+ +      + +SS P +L+ +T+ PP PP+NL V + T  S+ + WD P+E GSE++ + +  + ++  +  + + +EL PDA   +I +L E  +Y+ R+ AVT+E   SLP       A KL  +L+E   ++ D  W+ + ++LA T+GT  P  I +       +K+ W  PS  G+NRL  QV+R +E   S +  ++        ++  +++D       L+ L P T YRI VEAVVS+KT L+        + +  NRRT H     P F RT+   + P+ +  + +  +++ + W++P     VV         ++R  +E YR+ +N K + +L+P+  + +L KC+ G+
Sbjct: 1429 LPVPIVQLLPDPEHPDRVRVTWDFSRPLEHQFRHEVSTVSVAGRAFSAKVNSDMSFDSEADGVVHTWNCTGGERDCLCRGLAIGCDYRISVTASFFQLDSSGVGQA-ELSTKSAVCDFTTAGPPEPPRLVVQSVDVNQVAVAWRPGRAFGGEDLVGYRLLIDGEPQGGQLPVQTQQTTLEPLQPGR--TVAVAVVAVAGRSQRTSQPSNTVRVSCPRRPEPPQLSKQPTSAEGAVIVAWQGEAAAGPQEEDVSKYRVFVDEKWHGELKASP----GRRTYTYYLSDLQAGVVYDVQVKAIAGHKNIDANADHVFCLCESELSAPLSVSCSAPPISPALRVESMTEEGLEVSWSVPQQFGEAQISGYQMLRDGEPYGA-VLPADTTSFRLRDLTLGQRLTLQLVALTAHPVGRGEERAEGGVEHGQFNRCTTGPALVVNYTGLVLAPARVWCDDVTGHSATVAWTRSTSGKLHFIQPTHYQITWWPGSSPDR-EVNSASTPEDFALLEGLAPATAYTVVVEARC---------EQRQEDGGGTVIVSSRPQRLSLRTAEPPLPPRNLGVTATTCCSLLVAWDPPVERGSEVIGIRVECAPAAGATAGELQVLELMPDATRALIENLRERTDYSVRVCAVTEEALQSLPPRHPARLARKLPADLSELAGLV-DSAWMPAAHLLATTSGTLAPGRIRLAGLTDQAVKLRWQPPSVTGSNRLRGQVVRWAEVPDSARPAARASDWDGPSAADYVSLDPKDSKVTLEGLRPGTKYRIVVEAVVSVKTALDPSADGATAEEELRNRRTAHVSSD-PAFVRTRCHVAQPRPMVAA-VKPDSVLLHWERPYAL-AVVRPEQASERRYVRCHIEGYRLEINGKPYVSLRPDAQTCRLVKCRPGK 2301          

HSP 2 Score: 331.643 bits (849), Expect = 1.122e-87
Identity = 183/610 (30.00%), Postives = 325/610 (53.28%), Query Frame = 2
Query: 3338 TLQVDSLFVSSSHESIGQKIQIFIPGLPKAPLLTCRKLDDENLTVEWTDINVGNDWKIKSFQIFINDSSIAKELENTERTAQITLKNNNHYKVSLCVRLQIHKEQIVTEFSNPIYVSTGPKRRLISQMEYDKFNNMRVLTVTESE---MSGNC--ICLNATQNTDTTVALSWTIPQSLNEDIYSYQVIWKCIQGFEEQKISIPNSKTFNYEVENLMPGLKYAFRLLAFDNGKQVIEKSKQLYLETNTVLEAPNLQLKATNFSYATICWNSTIPKGNVKLKCFHIYVNGVMSIEVEASNHIYTYYDGQPCHQYSFLCQAISYEEKYNSKPSNTVKCIWPGCISPPLTSLTPMVANSIRVSWGNPTLSDGAKIKHFRVICSNSETGELIQAVNFIHPESRESEIFHVKFNQYVVRLETYLHGAPYPYLSEPLLIQPETGPDPPVIQLQLLNINDRIELLNKLRNCINEEDSIMRCIHYWGSQNRHTEEEKSLFFKASSLLPAIQENIDNYVYQMSRNDDYVIAELKWTQKQTENKVNVTGFKVLVDGKYYGRELDATCKSVLIKLNVDSKTHKIAMTSVSNKPRLLSGLSNVIEVLTNLYPRLRFFCKPDIH 5152
            T ++++L    + E I Q++Q+  PG P AP +    + D  + VEW++  +     +  +Q+ +N  +  + LE T R A I  + + HY+V L V L  H++   +  S P+++ST P    +S+     F +       E+E   ++G+   I L  +  TD+T+ + W   Q   + ++S+ + W       E+  ++ + +  +  ++NL+PG  Y+ RL A D+ + V+EKS+ L  +T   ++ P L+L+A NFSY  + W      G+  +  + +++NGV+   + A    YTY  G+ C  YSF  QAIS + ++NSKPS+++   WPGC+   L  L   V+ + RV+W  P L++G K+K FR+IC  ++TG++I+ V  +HPE+RE+E+  ++   Y ++LE  LHG     LS  L +QP   PDPP + + ++ +  R +L   +   +N  D  +R IH        T EE  L  K +     I +++++    +       + ++ W   Q+  +V ++G++VLVDG+ YG  L     SV IKL+ D  +H ++M ++       S  SN++EVLT+ +  + F+C  ++H
Sbjct: 2439 TARLEALLTRETREPIVQQVQLTTPGPPAAPQIFLDAMSDREIVVEWSEPALFGGVGVAGYQLLVNGKAAGEPLEPTHRRAVIPCRASRHYRVQL-VALSAHRDFPDSPPSAPLFISTYPNMPAVSEAPPPDFAD------AEAEGDALAGDLSEIPLTVSARTDSTLTVEWMAYQP-PDGVHSFALQWSSPAQPAERTETLAHQER-SCLLQNLLPGTVYSLRLSALDSNRAVVEKSRALRAQTCAPIDTPLLRLRACNFSYIAVHWTEPRHYGDAAVAGYKVFINGVVEETLGAGETSYTYCKGRWCQDYSFQVQAISNDPRFNSKPSDSLLVTWPGCLPGELRPLAGSVSGAARVAWPAPFLTEGVKLKQFRLICKLADTGQVIRVVGPLHPETREAEVTGLRSGTYHLQLEVQLHGTQMAVLSAALTVQPTLTPDPPTVTVSVVGLEQRRQLEAAVCRLVNRRDRHVRRIHNIHMLPTKTLEETQLLAKYTETYNQIMDSLEDCFKSLEAYTGEFVLQVSWACPQSNQEVPLSGYRVLVDGRQYGSALHQGMSSVRIKLSTDRPSHAVSMVALCESQGTQSPESNMVEVLTDPFQPMAFYCIHEVH 3039          
BLAST of Fibronectin vs. TrEMBL
Match: V3ZJI7 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_153880 PE=4 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 1.353e-116
Identity = 299/993 (30.11%), Postives = 490/993 (49.35%), Query Frame = 3
Query:  390 MPIPLIEVKQISISEILVKWSLDSEIPKHLKIPVYNLQISGLQFKNIVNSDLSYFEKDLV---------THVWNIANENKCFVSGLLPRINYTIHVSATFIMASKQNKQQLNELSTYSEKINYRLAGPPKAPILSVKSIDIYQVILQWEVEE--YDFSELKAFYIQFHNQSKEIKVPVEEKNIVIDNIVDGQFLEIFIFS--ENIYGKSDKSNSISIKTSPKPVAPVVISEPTFNHGESIISWTHDSSMLPQNF-KIIFFRIFMDDVWHTDITADSAAFSNNEKYNFVFQNLEYDISHEIKVVSVAGS--ILNEENVVYCYSHSNLSSPIIISGFKPPDAALLHIESMNSKGILLNWDSPEETDNYHVIGYRILKNGFVYGSNVIPNSVNSLWIKDIMLGNRVELQXXXXXX---------------------------------XXXXXXAPSSKIVIHYTGLVSSPTKFEVESVNGFGAVLAWNKVTEKKHHFIPPDHFQVTWWNSTNPDNFDVRSISTKDSMVYITDLTPNTNYTAVLEGRSVNNFKEI----YEEKSRSCFNHKITLSSDPIKLNFKTSAPPTPPKNLCVVSATGSSIALQWDSPIEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEKTHSNKDDSQEQSSICINVDKYCHVA--------ELDRLLPATMYRIDVEAVVSIKTILNIDKXXXXXXXXXXXXXTTHYPCKVPLFARTKTSPSPPQFLTCSKIVTNTIYISWQQPLMYTTVVHDGNNQSTDFIRHRLEAYRVYVNNKLHATLKPNILSVKLTKCKFGRNS----VKISSLINPDYIPKAEIASLFSNLDES-------MPKALGLDESCSDELLVTINQPVQGAIKNLTS 3152
            +P P I V+      + V W L      + K+ +Y + + G +F   +NSD+S FE +LV          H WN+  E KC + GLLP + Y I+V A +   +  +  +  E+ T S  + Y   GPPK P   VKS+D YQ  ++W+     +   ++K + +   N+        + + +VI+N++ G+ + + + +       +SD S +I +    +P +P +  +P+F  G  +I+W         N  +I  + +++D +WH ++ A+    S+ + Y F   +L  +  +++ V SV G   +  E   VYC S S +S+ + +     P +  L +E ++  GI + W  P++  +  + GY++LK+  +YG+ VIP  VNSL IKD+ LG +V LQLI LT                                     +   P  K+ IHYTGLV +PT+   E V G  A++ WNK    K HF+  +++QVTWW  + P + D+ S ST D  + IT+L P+T YT V+E R +  + +I    Y+ ++    N  I L++    ++  T++PP PP+NL V + T +S+ + WD P E+G+E++ + +    + E+  +   TV+L PD K   IN L E  +YN R+ AVT EYF  LP+    + +  L  +   S   D +W+ S +ILA TAGT  P N+ + E+    + + W+ P   G+N+LL Q+IR S+     K +  E   I  N     HV+        +LD L P   Y+I VEAVVSIKT L  +K   +    +  RRT H   K PL ART+    PP+ L  S    N  Y+ W++P + + +  D   +   ++R  LE Y++ +N KL   L P+  +  LTKCK G+      V ++         K ++   F N+D         +     LDES S+ L + + +  +G + +L +
Sbjct: 1815 LPAPSIMVESRGKRGVRVVWELPESPDPNYKLILYCVNVVGYKFSKDINSDIS-FECNLVEKGEQVRGVQHCWNVQGEEKCNIKGLLPSLTYRIYVIANY---THLHGDEACEIQTTSSVLYYTTMGPPKPPTTLVKSVDFYQATMEWDPPSIVHPGVKIKGYQLYVDNKPLGDVRNSDVRQMVINNMIPGKTISVHVIAVTSRASQESDPSKTIYLSCPRRPPSPTITQQPSFKQGCVLIAWDKPKESTSSNIEQISAYCVYIDGIWHGEVKANK--ISDKQGYQFFLTDLSPEQCYDVSVKSVCGQRDVDKETQHVYCLSDSPMSNIVTVRAPAAPKSPTLRLEGLHPDGIDVTWQVPQQFGDASISGYQMLKDNKLYGA-VIPPDVNSLKIKDMSLGEKVNLQLIALTEHPVGKTDGSLAGDKDSGLGGSTIPDDKRDIFMGERYSGCKPGPKLSIHYTGLVQAPTEVRCEKVTGHSALIVWNKENGSKPHFVGAENYQVTWWPGSKPQD-DINSDSTSDDHLIITNLKPSTCYTIVVEARKMEKYTDIDESLYDRETSDGLNSFI-LTAKSKHISLTTASPPNPPRNLGVKATTCNSLQVIWDPPEEHGAEVIGIRIECVAADEQD-QHFVTVDLMPDTKCTDINTLHEKKDYNVRVIAVTDEYFDRLPDKHPLKKSRTLPRDVLVS-TEDSVWLPSSSILAKTAGTEAPANLKITESSRTSLTLTWTPPIIYGSNKLLGQIIRWSDV----KRNKGEHGMIIAN-----HVSVLPTEDRIKLDDLCPGAQYKIVVEAVVSIKTSLEREK---SGSGIEQYRRTAHVMSK-PLLARTRAPIEPPRLLLTS-FDKNQGYLYWEKPPLLSVIGKDDEGKPK-YLRRYLEGYKLEINGKLQCYLGPSAQTCTLTKCKPGKAYSVVLVAVTCTEESKKTRKQKLKGFFKNVDPQDIDYAAILNDDENLDESPSEPLEICLPRDQEGFLSSLQA 2781          

HSP 2 Score: 325.479 bits (833), Expect = 9.176e-86
Identity = 180/603 (29.85%), Postives = 328/603 (54.39%), Query Frame = 2
Query: 3389 QKIQIFIPGLPKAPLLTCRKLDDENLTVEWTDINVGNDWKIKSFQIFINDSSIAKELENTERTAQITLKNNNHYKVSLCVRLQIHKEQIVTEFSNPIYVSTGPKRRLISQMEYDKFNNMRVLTVTE--SEMSGNCICLNATQNTDTTVALSWTIPQSLNEDIYSYQVIWKCIQGFEEQKISIPNSKTFNYEVENLMPGLKYAFRLLAFDNGKQVIEKSKQLYLETNTVLEAPNLQLKATNFSYATICWNSTIPKGNVKLKCFHIYVNGVMSIEVEASNHIYTYYDGQPCHQYSFLCQAISYEEKYNSKPSNTVKCIWPGCISPPLTSLTPMVANSIRVSWGNPTLSDGAKIKHFRVICSNSETGELIQAVNFIHPESRESEIFHVKFNQYVVRLETYLHGAPYPYLSEPLLIQPETGPDPPVIQLQLLNINDRIELLNKLRNCINEEDSIMRCIHY------WGSQNRHTEEEKSLFFKASSLLPAIQENIDNYVYQMSRNDDYVIAELKWTQKQTENKVNVTGFKVLVDGKYYGRELDATCKSVLIKLNVDSKTHKIAMTSVSNKPRLLSGLSNVIEVLTNLYPRLRFFCKPDIHQKILHLP 5173
            Q +QI IPG P AP +  R +D E   +EW +  V    K+K +Q+++ND  +  EL N+ R A I  + N  Y+++L           V   +N  Y  +     L+     ++     V+T+ +  S    + I +  T+  DT + L W+     +E++  Y+V W  +    ++++ + ++K  N  +   +PG  +  RL+AFD+G Q+ EKS+Q+ ++T+   +AP L ++A+NF Y  I W      G+  +  + ++VNG++   + A    YT+ +G+ CH+YSF  QA++ +EK NS+ S+ +   WPG  SP +  +  + ++++RV W +P L+DG K+KHF++ C   +T +L+Q+V  IHP++RE+E  H+K   Y V LET+L+G      S+ + +QP   PD P I + ++ + +R +L     + +N+ D ++R + +        S     E+++ +   A +L   ++E ++     + +    +IA + W   Q+   + V+G+KVL+DGK YG  L A  K+V +KL++   ++K+ M ++++KP+  S  SN++E+LT+ +    F+C   IH K    P
Sbjct: 2866 QDVQIMIPGPPDAPDIYLRSVDTEEFIIEWGEPRVFGGVKVKGYQVYMNDKKVGAELSNSHRKAVIPCRPNRIYRINL-----------VALSANSQYSDSLKSNTLLINTSTNQHQTGDVVTIDDWASTTDDSDIPVKITKVLDTGIHLDWST-YYPSEEVAYYKVQWSSVAQPTQREVQL-SAKDTNCVINKCLPGTNHFVRLVAFDSGGQIWEKSRQMTIQTSAPPDAPILSIRASNFRYLAIQWEKPSEYGDAIIAGYKVFVNGIVEAHLAADQLSYTFTNGRWCHEYSFQVQAMTSDEKMNSRVSDQLIVTWPGAKSPAIHRIPSVSSSTLRVGWEDPHLTDGIKVKHFKLCCIEEDTEKLVQSVGPIHPKTREAEFNHLKKGSYSVYLETHLYGTGDVVRSDTIRMQPSLSPDAPQIAVTMVGLEERRQLEKLTCDLVNKRDRLIRAVGHKLKRIGALSHPVKAEKDEDIIIGAHTLT-RVEELLEECFLGLEQYIGQLIAYVSWQCPQSNPDMCVSGYKVLIDGKQYGNALHAGVKTVKVKLDLSEPSYKLTMVAMTDKPQGCSDESNMVELLTSPFKPFSFYCYHGIHNKTAKWP 3454          
BLAST of Fibronectin vs. TrEMBL
Match: A0A2C9LJA3 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055997 PE=4 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 2.617e-116
Identity = 285/912 (31.25%), Postives = 466/912 (51.10%), Query Frame = 3
Query:  390 MPIPLIEVKQISISEILVKWSLDSEIPKHLKIPVYNLQISGLQFKNIVNSDLSYFEKDLV---------THVWNIANENKCFVSGLLPRINYTIHVSATFIMASKQNKQQLNELSTYSEKINYRLAGPPKAPILSVKSIDIYQVILQWEVEEYDFS-ELKAFYIQFHNQSKEIKVPVEEKNIVIDNIVDGQFLEIFI--FSENIYGKSDKSNSISIKTSPKPVAPVVISEPTFNHGESIISWTHDSS--MLPQNFKIIFFRIFMDDVWHTDITADSAAFSNNEKYNFVFQNLEYDISHEIKVVSVAGSILNEENV--VYCYSHSNLSSPIIISGFKPPDAALLHIESMNSKGILLNWDSPEETDNYHVIGYRILKNGFVYGSNVIPNSVNSLWIKDIMLGNRVELQXXXXXXXXXXXX-----------------------------APSSKIVIHYTGLVSSPTKFEVESVNGFGAVLAWNKVTEKKHHFIPPDHFQVTWWNSTNPDNFDVRSISTKDSMVYITDLTPNTNYTAVLEGRSV---NNFKEIYEEKSRSCFNHKITLSSDPIKLNFKTSAPPTPPKNLCVVSATGSSIALQWDSPIEYGSEIVFL-VMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRIS--EKTHSNKDDSQEQSSICINVDKYCHVAELDRLLPATMYRIDVEAVVSIKTILNIDKXXXXXXXXXXXXXTTHYPCKVPLFARTKTSPSPPQFLTCSKIVTNTIYISWQQPLMYTTVVHDGNNQSTDFIRHRLEAYRVYVNNKLHATLKPNILSVKLTKCKFGRN 2972
            +P P I  + I    + V W L  ++    ++ +Y + + G +F + +NSD+SY E +LV          H WNI  +N+C V GLL    Y  +V   F M S+    +  E  T S  + Y + GPP  P +    +D YQV L+W  +  +   +++ F I    +S       + + + I+N+V G+ + I++  FSE    +S+ S ++ I   P+P APV+  +P++  G  +I WT   S  +  +   I F+ I++D  WH ++ ++     + + Y F   +L  + S+++ V +VAG  + ++    +YC S S +S+ I +     P +  L +E ++ +GI + W  P++  +  + GY++LKNG +YGS +IP  VNSL I+D++LG ++ELQLI LT      +                              P  K+V+HYTGLVS P++   E   G   ++ W K ++ K HF+ PD +QVTWW      + +++S ST D  + I  L P+T+YT V+E R      +F E +E+      N  I LSS   +L+ +T++PP PP N+ +V+ T  SI + WD P E+GSEI+ + V   S+  + +  Q  + +  PDA +  +  LSE  +Y  ++  VT++YF  LP   + +       N   S+  +  W+    IL  T+GT  P N+ V +  +  + + W+ P   GTN+L  Q++R S       NKD+    +S  + +        +D LLP T Y I VEAVVS+KT L  +K   + +N + NRRT H   K PL ART+    PPQ +  S    N+  ++W++P + T V  D +  +   +R  L+ Y++ +N KL   + P+  S  LTKCK GRN
Sbjct: 1193 LPTPSIMARSIDRQTMEVGWRLTRQVEPPHELQLYVVNVMGTKFSSHINSDISY-ECNLVENGRQVRGVQHCWNIDKKNECIVQGLLTGNTYRTYVVCNFCMTSEG---ETCETQTSSPVLYYTIVGPPSPPTIQTTKVDTYQVCLEWAEQANEKGLQVRGFQIYVDEKSLGKGRSADVRKMTINNLVPGKTMSIYVTAFSEFGQDESEPSRTVHITCPPRPTAPVISQQPSYKRGSVLIGWTKPESQGLNSREEAISFYVIYLDGKWHGEVKSNQ--LYDKQGYRFYLTDLSPEQSYDVSVKAVAGERIIDQKAQHIYCLSVSPMSNIIPVMAPAAPRSPKLRLEGLHPEGIDVTWQIPQQLGDAFISGYQMLKNGKLYGS-IIPPDVNSLSIRDVILGEKIELQLIALTEHPVGKSEGSKDSGRGTSSQEEKTPDIFTGDHYAGCKPGPKLVVHYTGLVSPPSEVWCEKATGHSLLIVWTKNSDTKAHFVRPDSYQVTWWPGDRAKD-EIQSDSTTDDHLLINGLRPSTSYTVVVEARKTEKYTDFDEAFEDDKSEGLNSFI-LSSKSEQLHIRTASPPDPPSNVGIVAMTCHSIKVGWDPPREHGSEIIGIRVECISQDPDNA--QVVSADTLPDATSADLTGLSEKTDYLLKVITVTEDYFDQLPEKNRLKQMRNFPPN-ISSVQEESQWLPFTCILFKTSGTEAPCNVKVIKATMTALTLNWTPPLVYGTNKLTGQIVRWSAVRSAQQNKDNDLHIASH-VKLLPTEDTLTIDDLLPGTQYNIVVEAVVSVKTSLEPEK--WDGNNIEKNRRTAHVLSK-PLLARTRAPIDPPQLMVTS-YTQNSATLTWEKPKLVTVVGKDSDG-NPKCLRRYLQGYKLEINGKLQTCIGPDSTSCTLTKCKPGRN 2086          

HSP 2 Score: 288.886 bits (738), Expect = 1.857e-74
Identity = 174/621 (28.02%), Postives = 317/621 (51.05%), Query Frame = 2
Query: 3335 YTLQVDSLFVSSSHESIGQKIQIFIPGLPKAPLLTCRKLDDENLTVEWTDINVGNDWKIKSFQIFINDSSIAKELENTERTAQITLKNNNHYKVSLCVRLQIHKEQIVTEFSNPIYVSTGPKRRLISQMEYDKFNNMRVLTVTESEMSGNCICLNATQNTDTTVALSWT--IPQSLNEDIYSYQVIWKCIQGFEEQKISIPNSKTFNYEVENLMPGLKYAFRLLAFDNGKQVIEKSKQLYLETNTVLEAPNLQLKATNFSYATICWNSTIPKGNVKLKCFHIYVNGVMSIEVEASNHIYTYYDGQPCHQYSFLCQAISYEEKYNSKPSNTVKCIWPGCISPPLTSLTPMVANSIRVSWGNPTLSDGAKIKHFRVICSNSETGELIQAVNFIHPESRESEIFHVKFNQYVVRLETYLHGAPYPYLSEPLLIQPETGPDPPVIQLQLLNINDRIELLNKLRNCINEEDSIMRCIHY----WGSQN--RHTEEEKSLFFKASSLLPAIQENIDNYVYQMSRNDDYVIAELKWTQKQTENKVNVTGFKVLVDGKYYGRELDATCKSVLIKLNVDSKTHKIAMTSVSNKPRLLSGLSNVIEVLTNLYPRLRFFCKPDIHQKILHLP 5173
            YT++V+  + S       Q+IQ+ +PG P AP +  R LD +  ++EW + ++    K+K +Q+ +ND     EL   +  A I  K    Y+V+           ++    N +Y  +     L+         +  +   T+S+  G  I +   +  + ++ L W+  I +   E++  Y + W  +   +++++ +    T N  +   +PG  +  R++A     Q++EKSKQ+ ++T+   + P L ++A NF Y TI WN     G+  +  + +YVNG++   + A    YT+  G+ C++Y+F  QA++  E  NSKPS  +   WPG   P L  L  + +++IRV+W  P L+DG K+KH+++ C  S + +++Q+V  IHP+S+E EI ++K   Y V LE +L+G      +EP  +QP   PDPP I + L+ + +R ++     + +N+ D ++R + +     G+       E+ + +   A SL   I+E +++    +      + A + W   Q+   + V+ +K+LVDGK YG  + +  KS+ I+L ++  ++KI M + S+KP+  S  SN +EVL   +    ++C   IH K    P
Sbjct: 2224 YTMKVEPSYYSDVLSQQCQEIQLMVPGPPDAPQIFLRSLDLDEFSIEWGEPSLYGGVKVKGYQVLLNDIKAGSELTPRQTKATIPCKPKKTYRVN-----------VIALSDNSLYGDSPKSNTLVINSSGQAGTSFEM---TQSDDYG--IPVKVVKVLENSIQLDWSNFIEK---EEVAYYTIQWSSVAQPDQREVKLSKHDT-NCVINKCLPGTTHFMRVIAVSTDGQLLEKSKQMTIQTSAPPDVPKLSVRACNFHYITIQWNKPTTYGDALITGYKVYVNGIVEAILNADQLSYTFTQGKWCNEYAFQVQALTAGETLNSKPSEPLIVTWPGSKPPELRRLPSVSSSTIRVAWSEPYLTDGIKVKHYKLCCVESGSDQIVQSVGPIHPDSKEGEIKNIKKGNYSVYLEIHLYGTDTVIKTEPFPMQPALSPDPPNISVALVGLEERRQIEKFTCDLVNKRDRLIREVGHKLKKIGALTFPMRAEKNEEVVMGAHSLT-HIEELLESCFSSLDSYTGQLTAIVSWQCPQSNPDMQVSEYKLLVDGKQYGSSIPSGAKSIRIQLGLEQSSYKITMVACSDKPQGTSDESNAVEVLALTFKPFTYYCYHGIHIKDTKYP 2823          
BLAST of Fibronectin vs. TrEMBL
Match: A0A267EE53 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022718g2 PE=4 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 4.665e-113
Identity = 239/839 (28.49%), Postives = 419/839 (49.94%), Query Frame = 3
Query:  390 MPIPLIEV--KQISISEILVKWSLDSEIPKHLKIPVYNLQISGLQFKNIVNSDLSY-FEKDLVTHVWNI-ANENKCFVSGLLPRINYTIHVSATFIMASKQNKQQLNELSTYSEKINYRLAGPPKAPILSVKSIDIYQVILQWEV-EEYDFSELKAFYIQFHNQSKEIKVPVEEKNIVIDNIVDGQFLEIFIFSENIYGKSDK----SNSISIKTSPKPVAPVVISEPTFNHGESIISWTHDSSMLPQNFKIIFFRIFMDDVWHTDITADSAAFSNNEKYNFVFQNLEYDISHEIKVVSVAG--SILNEENVVYCYSHSNLSSPIIISGFKPPDAALLHIESMNSKGILLNWDSPEETDNYHVIGYRILKNGFVYGSNVIPNSVNSLWIKDIMLGNRVELQXXXXXXXXXXXX----------------APSSKIVIHYTGLVSSPTKFEVESVNGFGAVLAWNKVTEKKHHFIPPDHFQVTWWNSTNPDNFDVRSISTKDSMVYITDLTPNTNYTAVLEGRSVNNFKEIYEEKSRSCFNHKITLSSDPIKLNFKTSAPPTPPKNLCVVSATGSSIALQWDSPIEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKL--ELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEKTHSNKDDSQE------QSSICINVDKYCHVAELDRLLPATMYRIDVEAVVSIKTILNIDKXXXXXXXXXXXXXTTHYPCKVPLFARTKTSPSPPQFLTCSKIVTNTIYISW 2801
            +P+P++++         + V W     +    +  V  + ++G  F   VNSD+S+  E D V H WN    E  C   GL    +Y I V+A+F         Q  ELST S   ++  AGPP+ P L V+S+D+ QV + W     +   +L  + +    + +  ++P + +   ++ +  G+   + +    + G+S +    SN++ +    +P  P +  +PT   G  I++W  +++  PQ   +  +R+F+D+ WH ++ A          Y +   +L+  + ++++  ++AG  +I    + V+C   S LS+P+ +S   PP +  L +ESM  +G+ ++W  P++     + GY++L++G  YGS V+P    S  ++D+ LG R+ LQL+ LT                        P   +V++YTGLV +P +   + V G  A +AW + T  K HFI P H+Q+TWW  ++PD  +V S ST +    +  L P T YT V+E R          E+ +      + +SS P +L+ +T+ PP PP+NL V + T  S+ + WD P+E GSE++ + +  + ++  +  + + +EL PDA   +I +L E  +Y+ R+ AVT+E   SLP       A KL  +L+E   ++ D  W+ + ++LA T+GT  P  I +       +K+ W  PS  G+NRL  QV+R +E   S +  ++        ++  +++D       L+ L P T YRI VEAVVS+KT L+        + +  NRRT H     P F RT+   + P+ +  + +  +++ + W
Sbjct:  295 LPVPIVQLLPDPEHPDRVRVTWDFSRPLEHQFRHEVSTVSVAGRAFSAKVNSDMSFDSEADGVVHTWNCTGGERDCLCRGLAIGCDYRISVTASFCQLDSSGVGQA-ELSTKSAVCDFTTAGPPEPPRLVVQSVDVNQVAVAWRPGRAFGGEDLVGYRLLIEGEPQGGQLPAQTQQTTLEPLQPGRT--VAVAVVAVAGRSQRTSQPSNTVRVSCPRRPEPPQLSEQPTSAEGAVIVAWQGEAAAGPQEEDVSKYRVFVDEKWHGELKASP----GRRTYTYYLSDLQAGVVYDVQAKAIAGHKNIDANADHVFCLCESELSAPLSVSCSAPPISPALRVESMTEEGLEVSWSVPQQFGEAQISGYQMLRDGEPYGS-VLPADATSFRLRDLTLGQRLTLQLVALTAHPVGRGEERAEGGVEHGQFNRCTPGPALVVNYTGLVLAPARVWCDDVTGHSATVAWTRSTSGKLHFIQPTHYQITWWPGSSPDR-EVNSASTPEDFALLEGLAPATAYTVVVEARC---------EQRQEDGGGTVIVSSRPQRLSLRTAEPPLPPRNLGVTATTCCSLLVAWDPPVERGSEVIGIRVECAPAAGATAGELQVLELMPDATRALIENLRERTDYSVRVCAVTEEALQSLPPRHPARLARKLPADLSELAGLV-DSAWMPAAHLLATTSGTLAPGRIRLAGLTDQAVKLRWQPPSVTGSNRLRGQVVRWAEVPDSARPAARASDWDGPSAADYVSLDPKDSKVTLEGLRPGTKYRIVVEAVVSVKTALDPSADGATAEEELRNRRTAHVSSD-PAFVRTRCHVAQPRPMVAA-VKPDSVLLHW 1112          
BLAST of Fibronectin vs. Ensembl Nematostella
Match: EDO43307 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYY4])

HSP 1 Score: 123.635 bits (309), Expect = 4.701e-28
Identity = 134/606 (22.11%), Postives = 248/606 (40.92%), Query Frame = 2
Query: 3407 IPGLPKAPLLTCRKLDDENLTVEWTDINVGNDWKIKSFQIFINDSSIAKELENTERTAQITLKNNNHYKVSLCVRLQIHKEQIVTEFSNPIYVSTGPKRRLISQMEYDKFNNMR---VLTVT------ESEMSGNCICLNATQNTDTTVALSWTIPQSLNEDIYSYQVIWKCIQGFEEQKISIPNSKTFNYEVENLMPGLKYAFRLLAFDNGKQVIEKSKQLYLETNTVLEAPNLQLKATNFSYATICWNSTIPKGNVKLKCFHIYVNGVMSIEVEASNHIYTYYDGQPCHQYSFLCQAISYEEKYNSKPSNTVKCIWPGCISPPLTSLTPMVANSIRVSWGNPTLSDGAKIKHFRV----ICSNSE--TGELIQAVNFI-----HPESRESEIFHVKFNQYVVRLETYLHGAPYPYLSEPLLIQPETGPDPPVIQLQLLNINDRIELLNKLRNCINEEDSIMRCIHYWGSQNRHTEEEKSLFFKASSLLPAIQENIDNYVYQMSRNDDYVIAELKWTQKQTENKVNVTGFKV--LVDGKYYGRELDATCKSVLIKLNVDSKTHKIAMTSVSNKPRLLSGLSNVIEVLTNLYPRLRFFCKPDIHQK 5158
            IPG P  P + CR + +  + VEW +  +     I  +Q+ +N   +   L    R   +  + +     +  +   I  E+++T     +Y     + R+++        N     +LT+       +S +    I L +    +  +A+ W    S+ +++  Y V W  +   + Q+ ++P +KT +  +E  + G ++   + A D+ +++I KS QL ++T+  L+ P L+ +    S   I W+     G+     + I V+ V    ++ S   Y      PC QYSF  +A+S +E  +S  S  +    PG  +P L+ +     + I V W  P L  GA ++ ++V    + S  E   G +I + + I     +  S E  ++ V    +VV   T      +   SEP+ + P   PDPPVI +++  + +R  L   + + I   D + R +                            E ++N V     N  ++   L    +   N V V G K+  + D   + REL+       + L+    TH I   S++  P   S  SN + +    +     FC   +H+K
Sbjct:  708 IPGRPDPPWIWCRGVSEYRILVEWNEPRIYGLAAITGYQVNLNGRQLGGILSPLSRKVTVHCQPSRFTHAACNLVQGIKLERLITSICLSVY-----RVRILALTADPTIGNSEPSNLLTICTPGSPEKSLVPKQQIRLRSLWTGNERIAVQW---DSVEDEVDRYVVKWSSVLSPQPQEETLPATKT-SMVIEECIAGTRHFIAVAAIDSHRKLIAKSTQLIVQTSAPLQKPVLRKRCALPSGLIIEWSQPPSIGDATPDQYEIKVDDVSRDILDKSQLSYELASCHPCRQYSFQVRALSSKEGCDSDWSPALLITCPGARAPMLSRVRSSRIDCIHVGWEMPELCGGAVVECYKVYYLEVDSRVEINAGGVIDSPHVITHGPLNGASTEDVLYDVTSAYWVVLEVTLQPKGCHSVFSEPIRMLPARPPDPPVIDVRVHGLAERKALEGVVCHMILTRDRLCRKL----------------------------ELLNNSVTVCESNPSFLCIRLCRKLELLNNSVTVMGAKLKEVEDKIAFHRELNC------LSLSSSPVTHVITARSLTCHPIGPSAPSNPVPLCAKDFAPFVVFCYFGVHKK 1270          

HSP 2 Score: 80.8777 bits (198), Expect = 5.084e-15
Identity = 104/445 (23.37%), Postives = 174/445 (39.10%), Query Frame = 3
Query: 1734 PDHFQVTWWNSTNPDNFDVRSISTKDSMVYITDLTPNTNYTAVLEGRSVNNFKEIYEEKSRSCFNHKITLSSDPIKLNFKTSAPPTPPKNLCVVSATGSSIALQWDSPIEYGSEIVFLVMYYSESSE-----KSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEKTHS---------NKDDSQ---EQSSICINVDKYCHVAELDRLLPATMYRIDVEAVVSIKTILNIDKXXXXXXXXXXXXXTTHYPCKV-------------PLFARTKTSPSPPQFLTCSKIVTNTIYISWQQP-LMYTTVVHDGNNQSTDFIRHRLEAYRVY---VNNKLHATLKPNILSVKLTKCKFG 2966
            P+ ++VTWW S       + S  T D  + +T L P+  Y  ++E  S ++  +       + FN   T S    K+ F   +PP PP N  V S+T S+I L WD+P         + +   E  E     ++       +L P      + +L+   +Y   LF++      S+P               DG     +    +  + A+T+G   P  + V E     + + W      G   +   +I  SEKT            KD  +    QSS+   +    H++ L+   P  +YR+ VEAVV I+  ++  +  ++ + D +   ++     +             PL ART   P  P  L  + I    I ++W  P  ++         +  D+ R R+ + R Y   VN +    L PN  S  L +CK G
Sbjct:  104 PEGYRVTWWRSNEEKTDLIGSTETTDCNLQLTCLQPSCRYAVLVEAFS-SHPNDPNAVDPLAGFNK--TRSE---KVWFDMESPPEPPTNFRVASSTSSAITLTWDAPPPSRPPTTAICLKVRERRESADDTRTTNSLMKFKLMPSTTTYTVKNLAARTQY---LFSIQ-----SVPG--------------DGCSCAQQPCGEARTLFAWTSGVVGPSRLSVTERTPFSLHLSWQPAITYGDLCIKHYLIHFSEKTRRLSSYGISQLPKDGKRIDVPQSSV---LGLKGHISGLE---PGLVYRVIVEAVVGIREDMSSGESGESCEEDGERAASSLASSDIDRLAAVSADCLSGPLMARTSAPPGKPTLLL-AGITATQIQLAWDPPAALHLDYAVRQTAERHDY-RGRIRSIRGYVLDVNVREVTRLAPNKRSYTLKRCKPG 512          
BLAST of Fibronectin vs. Ensembl Medaka
Match: neo1b (neogenin 1 [Source:NCBI gene;Acc:101164964])

HSP 1 Score: 54.299 bits (129), Expect = 1.473e-6
Identity = 48/188 (25.53%), Postives = 80/188 (42.55%), Query Frame = 2
Query: 3743 MRVLTVTESEMSGNCICLNATQNTDTTVALSWTIPQSLNEDIYSYQVIWKCIQGFEEQKISIPNSKTFNYEVENLMPGLKYAFRLLAFDNGKQVIEKSKQLYLETNTVLEAP--NLQLKATNFSYATICWNSTIPKG-NVKLKCFHI-YVNGVMSIE---VEASNHIYTYYDG-QPCHQYSFLCQAIS 4282
            ++V T  E ++ G    L A  NT T+V+LSW  P + N DI SY++ +       EQ + +       Y +  L    +Y+FR++A +     +     +    +    AP  N  L+  N     + W    P G N ++  + I Y  G    E   + A   +Y   +G  P  +YSF   A++
Sbjct:  519 LKVPTQAEVQVPGPAPNLQAVSNTPTSVSLSWDKPLTGNGDILSYKLYYTDRTIGNEQDVDVDGQA---YTMTGLKKNTEYSFRVVANNKHGSGVSTEDVIVRTLSDSPSAPPQNFTLEVQNSKSIMLRWQPPPPSGQNGEIISYKIRYRKGSRKSESAVITAGTELYKLIEGLDPGTEYSFRVSAMT 703          
BLAST of Fibronectin vs. Ensembl Medaka
Match: neo1b (neogenin 1 [Source:NCBI gene;Acc:101164964])

HSP 1 Score: 54.299 bits (129), Expect = 1.651e-6
Identity = 48/188 (25.53%), Postives = 80/188 (42.55%), Query Frame = 2
Query: 3743 MRVLTVTESEMSGNCICLNATQNTDTTVALSWTIPQSLNEDIYSYQVIWKCIQGFEEQKISIPNSKTFNYEVENLMPGLKYAFRLLAFDNGKQVIEKSKQLYLETNTVLEAP--NLQLKATNFSYATICWNSTIPKG-NVKLKCFHI-YVNGVMSIE---VEASNHIYTYYDG-QPCHQYSFLCQAIS 4282
            ++V T  E ++ G    L A  NT T+V+LSW  P + N DI SY++ +       EQ + +       Y +  L    +Y+FR++A +     +     +    +    AP  N  L+  N     + W    P G N ++  + I Y  G    E   + A   +Y   +G  P  +YSF   A++
Sbjct:  519 LKVPTQAEVQVPGPAPNLQAVSNTPTSVSLSWDKPLTGNGDILSYKLYYTDRTIGNEQDVDVDGQA---YTMTGLKKNTEYSFRVVANNKHGSGVSTEDVIVRTLSDSPSAPPQNFTLEVQNSKSIMLRWQPPPPSGQNGEIISYKIRYRKGSRKSESAVITAGTELYKLIEGLDPGTEYSFRVSAMT 703          
BLAST of Fibronectin vs. Ensembl Medaka
Match: neo1b (neogenin 1 [Source:NCBI gene;Acc:101164964])

HSP 1 Score: 54.299 bits (129), Expect = 1.661e-6
Identity = 48/188 (25.53%), Postives = 80/188 (42.55%), Query Frame = 2
Query: 3743 MRVLTVTESEMSGNCICLNATQNTDTTVALSWTIPQSLNEDIYSYQVIWKCIQGFEEQKISIPNSKTFNYEVENLMPGLKYAFRLLAFDNGKQVIEKSKQLYLETNTVLEAP--NLQLKATNFSYATICWNSTIPKG-NVKLKCFHI-YVNGVMSIE---VEASNHIYTYYDG-QPCHQYSFLCQAIS 4282
            ++V T  E ++ G    L A  NT T+V+LSW  P + N DI SY++ +       EQ + +       Y +  L    +Y+FR++A +     +     +    +    AP  N  L+  N     + W    P G N ++  + I Y  G    E   + A   +Y   +G  P  +YSF   A++
Sbjct:  542 LKVPTQAEVQVPGPAPNLQAVSNTPTSVSLSWDKPLTGNGDILSYKLYYTDRTIGNEQDVDVDGQA---YTMTGLKKNTEYSFRVVANNKHGSGVSTEDVIVRTLSDSPSAPPQNFTLEVQNSKSIMLRWQPPPPSGQNGEIISYKIRYRKGSRKSESAVITAGTELYKLIEGLDPGTEYSFRVSAMT 726          
BLAST of Fibronectin vs. Ensembl Medaka
Match: neo1b (neogenin 1 [Source:NCBI gene;Acc:101164964])

HSP 1 Score: 54.299 bits (129), Expect = 1.673e-6
Identity = 48/188 (25.53%), Postives = 80/188 (42.55%), Query Frame = 2
Query: 3743 MRVLTVTESEMSGNCICLNATQNTDTTVALSWTIPQSLNEDIYSYQVIWKCIQGFEEQKISIPNSKTFNYEVENLMPGLKYAFRLLAFDNGKQVIEKSKQLYLETNTVLEAP--NLQLKATNFSYATICWNSTIPKG-NVKLKCFHI-YVNGVMSIE---VEASNHIYTYYDG-QPCHQYSFLCQAIS 4282
            ++V T  E ++ G    L A  NT T+V+LSW  P + N DI SY++ +       EQ + +       Y +  L    +Y+FR++A +     +     +    +    AP  N  L+  N     + W    P G N ++  + I Y  G    E   + A   +Y   +G  P  +YSF   A++
Sbjct:  542 LKVPTQAEVQVPGPAPNLQAVSNTPTSVSLSWDKPLTGNGDILSYKLYYTDRTIGNEQDVDVDGQA---YTMTGLKKNTEYSFRVVANNKHGSGVSTEDVIVRTLSDSPSAPPQNFTLEVQNSKSIMLRWQPPPPSGQNGEIISYKIRYRKGSRKSESAVITAGTELYKLIEGLDPGTEYSFRVSAMT 726          
BLAST of Fibronectin vs. Ensembl Medaka
Match: neo1b (neogenin 1 [Source:NCBI gene;Acc:101164964])

HSP 1 Score: 53.9138 bits (128), Expect = 1.862e-6
Identity = 48/188 (25.53%), Postives = 80/188 (42.55%), Query Frame = 2
Query: 3743 MRVLTVTESEMSGNCICLNATQNTDTTVALSWTIPQSLNEDIYSYQVIWKCIQGFEEQKISIPNSKTFNYEVENLMPGLKYAFRLLAFDNGKQVIEKSKQLYLETNTVLEAP--NLQLKATNFSYATICWNSTIPKG-NVKLKCFHI-YVNGVMSIE---VEASNHIYTYYDG-QPCHQYSFLCQAIS 4282
            ++V T  E ++ G    L A  NT T+V+LSW  P + N DI SY++ +       EQ + +       Y +  L    +Y+FR++A +     +     +    +    AP  N  L+  N     + W    P G N ++  + I Y  G    E   + A   +Y   +G  P  +YSF   A++
Sbjct:  542 LKVPTQAEVQVPGPAPNLQAVSNTPTSVSLSWDKPLTGNGDILSYKLYYTDRTIGNEQDVDVDGQA---YTMTGLKKNTEYSFRVVANNKHGSGVSTEDVIVRTLSDSPSAPPQNFTLEVQNSKSIMLRWQPPPPSGQNGEIISYKIRYRKGSRKSESAVITAGTELYKLIEGLDPGTEYSFRVSAMT 726          
BLAST of Fibronectin vs. Planmine SMEST
Match: SMESG000029259.1 (SMESG000029259.1)

HSP 1 Score: 1570.44 bits (4065), Expect = 0.000e+0
Identity = 785/787 (99.75%), Postives = 786/787 (99.87%), Query Frame = 3
Query:    3 AIPSPTQFDIDIDATGKSWVNKFKLLSATQSAFIDLQKRVNKKPAHQLARLSISSKSEFEIEVKDDSKSDVSQLTTGIHKEASAAVSKVVMQPTISLSNFAYSKFENQDTDFNDEQGLNNQPAISIKNNMPIPLIEVKQISISEILVKWSLDSEIPKHLKIPVYNLQISGLQFKNIVNSDLSYFEKDLVTHVWNIANENKCFVSGLLPRINYTIHVSATFIMASKQNKQQLNELSTYSEKINYRLAGPPKAPILSVKSIDIYQVILQWEVEEYDFSELKAFYIQFHNQSKEIKVPVEEKNIVIDNIVDGQFLEIFIFSENIYGKSDKSNSISIKTSPKPVAPVVISEPTFNHGESIISWTHDSSMLPQNFKIIFFRIFMDDVWHTDITADSAAFSNNEKYNFVFQNLEYDISHEIKVVSVAGSILNEENVVYCYSHSNLSSPIIISGFKPPDAALLHIESMNSKGILLNWDSPEETDNYHVIGYRILKNGFVYGSNVIPNSVNSLWIKDIMLGNRVELQXXXXXXXXXXXXAPSSKIVIHYTGLVSSPTKFEVESVNGFGAVLAWNKVTEKKHHFIPPDHFQVTWWNSTNPDNFDVRSISTKDSMVYITDLTPNTNYTAVLEGRSVNNFKEIYEEKSRSCFNHKITLSSDPIKLNFKTSAPPTPPKNLCVVSATGSSIALQWDSPIEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGT 2363
            AIPSPTQFDIDIDATGKSWVNKFKLLSATQSAFIDLQKRVNKKPAHQLARLSISSKSEFEIEVKDDSKSDVSQLTTGIHKEASAAVSKVVMQPTISLSNFAYSKFENQDTDFNDEQGLNNQPAISIKNNMPIPLIEVKQISISEILVKWSLDSEIPKHLKIPVYNLQISGLQFKNIVNSDLSYFEKDLVTHVWNIANENKCFVSGLLPRINYTIHVSATFIMASKQNKQQLNELSTYSEKINYRLAGPPKAPILSVKSIDIYQVILQWEVEEYDFSELKAFYIQFHNQSKEIKVPVEEKNIVIDNIVDGQFLEIFIFSENIYGKSDKSNSISIKTSPKPVAPVVISEPTFNHGESIISWTHDSSMLPQNFKIIFFRIFMDDVWHTDITADSAAFSNNEKYNFVFQNLEYDISHEIKVVSVAGSILNEENVVYCYSHSNLSSPIIISGFKPPDAALLHIESMNSKGILLNWDSPEETDNYHVIGYRILKNGFVYGSNVIPNSVNSLWIKDIMLGNRVELQLITLTNINDNNNAPSSKIVIHYTGLVSSPTKFEVESVNGFGAVLAWNKVTEKKHHFIPPDHFQVTWWNSTNPDNFDVRSISTKDSMVYITDLTPNTNYTAVLEGRSVNNFKEIYEEKSRSCFNHKITLSSDPIKLNFKTSAPPTPPKNLCVVSATGSSIALQWDSPIEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTA +
Sbjct: 1363 AIPSPTQFDIDIDATGKSWVNKFKLLSATQSAFIDLQKRVNKKPAHQLARLSISSKSEFEIEVKDDSKSDVSQLTTGIHKEASAAVSKVVMQPTISLSNFAYSKFENQDTDFNDEQGLNNQPAISIKNNMPIPLIEVKQISISEILVKWSLDSEIPKHLKIPVYNLQISGLQFKNIVNSDLSYFEKDLVTHVWNIANENKCFVSGLLPRINYTIHVSATFIMASKQNKQQLNELSTYSEKINYRLAGPPKAPILSVKSIDIYQVILQWEVEEYDFSELKAFYIQFHNQSKEIKVPVEEKNIVIDNIVDGQFLEIFIFSENIYGKSDKSNSISIKTSPKPVAPVVISEPTFNHGESIISWTHDSSMLPQNFKIIFFRIFMDDVWHTDITADSAAFSNNEKYNFVFQNLEYDISHEIKVVSVAGSILNEENVVYCYSHSNLSSPIIISGFKPPDAALLHIESMNSKGILLNWDSPEETDNYHVIGYRILKNGFVYGSNVIPNSVNSLWIKDIMLGNRVELQLITLTNINDNNNAPSSKIVIHYTGLVSSPTKFEVESVNGFGAVLAWNKVTEKKHHFIPPDHFQVTWWNSTNPDNFDVRSISTKDSMVYITDLTPNTNYTAVLEGRSVNNFKEIYEEKSRSCFNHKITLSSDPIKLNFKTSAPPTPPKNLCVVSATGSSIALQWDSPIEYGSEIVFLVMYYSESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPNNFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAAS 2149          

HSP 2 Score: 1273.07 bits (3293), Expect = 0.000e+0
Identity = 611/620 (98.55%), Postives = 615/620 (99.19%), Query Frame = 2
Query: 3317 LINRFYYTLQVDSLFVSSSHESIGQKIQIFIPGLPKAPLLTCRKLDDENLTVEWTDINVGNDWKIKSFQIFINDSSIAKELENTERTAQITLKNNNHYKVSLCVRLQIHKEQIVTEFSNPIYVSTGPKRRLISQMEYDKFNNMRVLTVTESEMSGNCICLNATQNTDTTVALSWTIPQSLNEDIYSYQVIWKCIQGFEEQKISIPNSKTFNYEVENLMPGLKYAFRLLAFDNGKQVIEKSKQLYLETNTVLEAPNLQLKATNFSYATICWNSTIPKGNVKLKCFHIYVNGVMSIEVEASNHIYTYYDGQPCHQYSFLCQAISYEEKYNSKPSNTVKCIWPGCISPPLTSLTPMVANSIRVSWGNPTLSDGAKIKHFRVICSNSETGELIQAVNFIHPESRESEIFHVKFNQYVVRLETYLHGAPYPYLSEPLLIQPETGPDPPVIQLQLLNINDRIELLNKLRNCINEEDSIMRCIHYWGSQNRHTEEEKSLFFKASSLLPAIQENIDNYVYQMSRNDDYVIAELKWTQKQTENKVNVTGFKVLVDGKYYGRELDATCKSVLIKLNVDSKTHKIAMTSVSNKPRLLSGLSNVIEVLTNLYPRLRFFCKPDIHQKILHLPR 5176
            L++ FYYTLQVDSLFVSSSHESIGQKIQIFIPGLPKAPLLTCRKLDDENLTVEWTDINVGNDWKIKSFQIFINDSSIAKELENTERTAQITLKNNNHYKVSLCVRLQIHKEQIVTEFSNPIYVSTGPKRRLISQMEYDKFNNMRVLTVTESEMSGNCICLNATQNTDTTVALSWTIPQSLNEDIYSYQVIWKCIQGFEEQKISIPNSKTFNYEVENLMPGLKYAFRLLAFDNGKQVIEKSKQLYLETNTVLEAPNLQLKATNFSYATICWNSTIPKGNVKLKCFHIYVNGVMSIEVEASNHIYTYYDGQPCHQYSFLCQAISYEEKYNSKPSNTVKCIWPGCISPPLTSLTPMVANSIRVSWGNPTLSDGAKIKHFRVICSNSETGELIQAVNFIHPESRESEIFHVKFNQYVVRLETYLHGAPYPYLSEPLLIQPETGPDPPVIQLQLLNINDRIELLNKLRNCINEEDSIMRCIHYWGSQNRHTEEEKSLFFKASSLLPAIQENIDNYVYQMSRNDDYVIAELKWTQKQTENKVNVTGFKVLVDGKYYGRELDATCKSVLIKLNVDSKTHKIAMTSVSNKPRLLSGLSNVIEVLTNLYPRLRFFCKPDIHQK   + +
Sbjct: 3872 LLSGFYYTLQVDSLFVSSSHESIGQKIQIFIPGLPKAPLLTCRKLDDENLTVEWTDINVGNDWKIKSFQIFINDSSIAKELENTERTAQITLKNNNHYKVSLCVRLQIHKEQIVTEFSNPIYVSTGPKRRLISQMEYDKFNNMRVLTVTESEMSGNCICLNATQNTDTTVALSWTIPQSLNEDIYSYQVIWKCIQGFEEQKISIPNSKTFNYEVENLMPGLKYAFRLLAFDNGKQVIEKSKQLYLETNTVLEAPNLQLKATNFSYATICWNSTIPKGNVKLKCFHIYVNGVMSIEVEASNHIYTYYDGQPCHQYSFLCQAISYEEKYNSKPSNTVKCIWPGCISPPLTSLTPMVANSIRVSWGNPTLSDGAKIKHFRVICSNSETGELIQAVNFIHPESRESEIFHVKFNQYVVRLETYLHGAPYPYLSEPLLIQPETGPDPPVIQLQLLNINDRIELLNKLRNCINEEDSIMRCIHYWGSQNRHTEEEKSLFFKASSLLPAIQENIDNYVYQMSRNDDYVIAELKWTQKQTENKVNVTGFKVLVDGKYYGRELDATCKSVLIKLNVDSKTHKIAMTSVSNKPRLLSGLSNVIEVLTNLYPRLRFFCKPDIHQKSFEVSK 4491          

HSP 3 Score: 545.814 bits (1405), Expect = 4.561e-160
Identity = 304/339 (89.68%), Postives = 306/339 (90.27%), Query Frame = 3
Query: 2322 WVVSVNILAYTAGTFPPKNICVQETFLNKIKIEWSLPSANGTNRLLSQVIRISEKTHSNKDDSQEQSSICINVDKYCHVAELDRLLPATMYRIDVEAVVSIKTILNIDKXXXXXXXXXXXXXTTHYPCKVPLFARTKTSPSPPQFLTCSKIVTNTIYISWQQPLMYTTVVHDGNNQSTDFIRHRLEAYRVYVNNKLHATLKPNILSVKLTKCKFGRNSVKISSLINPDYIPKAEIASLFSNLDESMPKALGLDESCSDELLVTINQPVQGAIKNLTSXXXXXXXXXXXXXXWDIYEFTNENFLKQF---------------DRNARMTKFTNLLSGLNY 3293
            W+    +L      F      VQETFLNKIKIEWSLPSANGTNRLLSQVIRISEKTHSNKDDSQEQSSICINVDKYCHVAELDRLLPATMYRIDVEAVVSIKTILNIDKFRDNFDNDDDNRRTTHYPCKVPLFARTKTSPSPPQFLTCSKIVTNTIYISWQQPLMYTTVVHDGNNQSTDFIRHRLEAYRVYVNNKLHATLKPNILSVKLTKCKFGRNSVKISSLINPDYIPKAEIASLFSNLDESMPKALGLDESCSDELLVTINQPVQGAIKNLTSNIINNKDKYDINLNWDIYEFTNENFLKQF               DRNARMTKFTNLLSG  Y
Sbjct: 3545 WITRFQLLTDDISIFQ-----VQETFLNKIKIEWSLPSANGTNRLLSQVIRISEKTHSNKDDSQEQSSICINVDKYCHVAELDRLLPATMYRIDVEAVVSIKTILNIDKFRDNFDNDDDNRRTTHYPCKVPLFARTKTSPSPPQFLTCSKIVTNTIYISWQQPLMYTTVVHDGNNQSTDFIRHRLEAYRVYVNNKLHATLKPNILSVKLTKCKFGRNSVKISSLINPDYIPKAEIASLFSNLDESMPKALGLDESCSDELLVTINQPVQGAIKNLTSNIINNKDKYDINLNWDIYEFTNENFLKQFGVSCFHENSIIKQVLDRNARMTKFTNLLSGFYY 3878          

HSP 4 Score: 99.3673 bits (246), Expect = 2.538e-20
Identity = 48/70 (68.57%), Postives = 53/70 (75.71%), Query Frame = 1
Query: 5077 WFVKCNRGFNKFISAFAIFL*TGYPPENFTFATIACINFPTEAPSGAFSVNNFLQNLHQQDNIAHYYCFD 5286
            W   C    + F++ F  F  +    +NFTFATIACINFPTEAPSGAFSVNNFLQNLHQQDNIAHYYCFD
Sbjct: 4548 WMPNCENSIH-FLNNFLTFA-SEEVNKNFTFATIACINFPTEAPSGAFSVNNFLQNLHQQDNIAHYYCFD 4615          
The following BLAST results are available for this feature:
BLAST of Fibronectin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TTN9.665e-725.00titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN9.746e-725.00titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN1.008e-625.00titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN1.277e-625.00titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
TTN1.400e-625.00titin [Source:HGNC Symbol;Acc:HGNC:12403][more]
back to top
BLAST of Fibronectin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fibronectin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Lar3.481e-722.56gene:FBgn0000464 transcript:FBtr0081260[more]
Lar3.506e-722.56gene:FBgn0000464 transcript:FBtr0112800[more]
back to top
BLAST of Fibronectin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ttn.14.878e-624.55titin, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
ttn.15.046e-624.55titin, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Fibronectin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
xirp26.923e-626.14xin actin binding repeat containing 2 [Source:Xenb... [more]
back to top
BLAST of Fibronectin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ttn1.376e-624.43titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn1.714e-623.86titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn1.743e-623.86titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ttn1.944e-623.86titin [Source:MGI Symbol;Acc:MGI:98864][more]
Ptprd3.049e-626.29protein tyrosine phosphatase, receptor type, D [So... [more]
back to top
BLAST of Fibronectin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P16621|LAR_DROME3.489e-622.56Tyrosine-protein phosphatase Lar OS=Drosophila mel... [more]
sp|Q8WZ42|TITIN_HUMAN6.724e-625.00Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4[more]
back to top
BLAST of Fibronectin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EC236.249e-11928.38Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267H6A97.150e-11828.38Uncharacterized protein OS=Macrostomum lignano OX=... [more]
V3ZJI71.353e-11630.11Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2C9LJA32.617e-11631.25Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A267EE534.665e-11328.49Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Fibronectin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fibronectin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fibronectin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fibronectin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO433074.701e-2822.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fibronectin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
neo1b1.473e-625.53neogenin 1 [Source:NCBI gene;Acc:101164964][more]
neo1b1.651e-625.53neogenin 1 [Source:NCBI gene;Acc:101164964][more]
neo1b1.661e-625.53neogenin 1 [Source:NCBI gene;Acc:101164964][more]
neo1b1.673e-625.53neogenin 1 [Source:NCBI gene;Acc:101164964][more]
neo1b1.862e-625.53neogenin 1 [Source:NCBI gene;Acc:101164964][more]
back to top
BLAST of Fibronectin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000029259.14.561e-16099.75SMESG000029259.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014507 ID=SMED30014507|Name=Fibronectin|organism=Schmidtea mediterranea sexual|type=transcript|length=5287bp
AAGCCATTCCATCCCCAACTCAATTTGACATCGACATAGATGCGACTGGA
AAGTCATGGGTTAATAAGTTTAAACTTCTCTCGGCAACCCAAAGCGCTTT
TATTGACCTACAAAAACGTGTAAATAAAAAACCAGCACATCAGCTGGCCA
GATTATCTATAAGTTCAAAGTCTGAGTTTGAAATTGAAGTGAAAGATGAT
TCAAAAAGTGACGTTTCTCAATTGACCACAGGTATCCATAAGGAAGCCTC
AGCAGCCGTATCAAAAGTTGTTATGCAACCAACTATCTCTTTGAGCAATT
TTGCTTATTCGAAGTTTGAAAATCAAGACACTGATTTTAATGACGAACAA
GGCCTCAACAATCAGCCAGCCATTTCTATTAAAAATAATATGCCAATTCC
TTTAATTGAAGTTAAACAAATCTCAATCAGTGAAATTCTCGTCAAATGGT
CTCTTGATTCGGAAATTCCAAAACATTTAAAAATTCCTGTTTACAACTTG
CAAATTTCAGGCCTGCAATTCAAGAATATTGTCAACTCAGACCTCAGTTA
CTTTGAAAAGGATTTGGTAACTCACGTTTGGAATATTGCAAATGAAAATA
AATGCTTCGTATCTGGATTGCTTCCAAGGATCAATTACACTATTCATGTT
TCTGCGACTTTTATAATGGCCTCGAAGCAAAATAAACAACAGTTAAATGA
ACTTTCAACATATTCCGAAAAGATAAATTATCGGTTAGCTGGACCACCGA
AAGCTCCAATTTTAAGTGTGAAATCTATTGATATATATCAAGTCATACTT
CAATGGGAAGTCGAAGAATATGACTTTAGTGAATTAAAGGCTTTTTATAT
TCAATTTCATAATCAAAGTAAAGAAATTAAAGTTCCTGTTGAAGAAAAAA
ATATCGTCATTGATAATATTGTTGACGGACAGTTTTTGGAAATATTCATT
TTTTCGGAAAACATTTATGGGAAAAGTGATAAATCCAATAGCATTTCAAT
CAAGACTTCTCCTAAACCTGTAGCACCTGTTGTCATTTCTGAACCGACAT
TTAATCACGGAGAAAGTATTATATCTTGGACGCATGATTCCTCAATGTTA
CCGCAAAACTTTAAAATAATATTCTTCAGAATTTTCATGGATGACGTCTG
GCACACTGATATCACTGCTGATTCGGCTGCCTTTTCTAATAATGAGAAAT
ATAATTTCGTCTTTCAAAACCTCGAATATGATATTAGCCACGAAATAAAA
GTCGTTTCAGTTGCCGGTTCTATACTTAATGAAGAAAATGTAGTTTATTG
TTACTCCCATTCCAATTTATCTTCTCCAATTATCATTTCTGGTTTTAAAC
CACCAGATGCCGCTCTTTTGCACATCGAATCCATGAATTCCAAGGGGATT
TTGCTGAATTGGGATTCTCCAGAAGAAACTGACAACTATCATGTCATCGG
ATATAGAATTTTGAAAAACGGATTCGTTTATGGAAGCAATGTGATCCCAA
ATAGTGTCAACAGTTTGTGGATAAAAGATATAATGCTGGGCAACCGAGTT
GAACTACAATTGATAACACTAACAAATATAAATGATAATAACAATGCACC
GAGCTCAAAAATAGTTATTCACTACACTGGATTAGTGAGTTCACCAACTA
AATTTGAAGTGGAATCAGTAAATGGTTTTGGGGCTGTCTTGGCTTGGAAT
AAAGTAACAGAAAAGAAACATCATTTTATACCGCCTGATCATTTTCAAGT
GACATGGTGGAACTCAACAAACCCTGACAACTTTGATGTACGTAGCATTT
CCACAAAGGATTCTATGGTCTATATAACTGACCTTACTCCGAATACTAAC
TATACAGCTGTGCTAGAAGGTCGAAGTGTCAATAATTTTAAAGAAATATA
TGAAGAAAAATCTAGATCGTGTTTTAATCACAAAATTACATTAAGTAGCG
ATCCAATAAAATTGAATTTTAAGACTTCCGCCCCTCCAACACCTCCGAAA
AACCTATGCGTTGTGTCAGCGACAGGTTCCTCTATAGCCTTACAGTGGGA
TAGCCCAATTGAATACGGAAGTGAAATAGTCTTCTTAGTAATGTATTACA
GTGAAAGCTCTGAAAAATCTTTGAAACAATGCAAAACCGTCGAATTAACA
CCAGACGCCAAGAATGTCATTATCAATCATTTATCAGAAAATGTCGAATA
CAATTTTAGATTATTTGCAGTTACACAAGAATATTTTTTATCCCTTCCCA
ATAATTTCAAGAAAGAGTCAGCTAGTAAGTTGGAATTGAATGAGGACGGC
TCTATTATTGGAGATAAATTATGGGTTGTAAGCGTGAATATACTGGCTTA
CACTGCCGGTACGTTTCCACCAAAAAACATTTGTGTACAAGAAACATTTC
TGAATAAAATCAAAATTGAGTGGAGTCTTCCATCAGCGAATGGAACAAAT
CGCCTTCTATCTCAAGTTATCCGAATTTCAGAGAAAACTCATTCTAACAA
AGATGACTCCCAAGAGCAATCATCAATCTGTATAAATGTAGACAAATACT
GCCATGTAGCAGAACTGGATAGATTGTTACCCGCCACGATGTATAGAATA
GATGTAGAAGCTGTTGTTAGTATTAAAACAATTCTGAATATTGATAAATT
TCGTGACAATTTTGATAATGATGATGATAATCGTCGAACAACTCATTATC
CGTGTAAAGTTCCATTGTTTGCAAGAACCAAAACGAGTCCTTCGCCTCCT
CAATTTTTGACATGTTCAAAGATTGTTACTAACACAATTTACATTAGTTG
GCAGCAACCTTTGATGTATACAACTGTCGTCCATGACGGCAATAATCAGT
CAACGGATTTCATCCGGCACCGATTGGAAGCGTATCGTGTCTATGTGAAT
AATAAACTACATGCCACATTGAAGCCCAATATTTTATCTGTAAAATTAAC
TAAATGTAAATTTGGAAGAAATTCCGTTAAAATTTCTTCGTTAATAAACC
CTGATTACATTCCAAAAGCAGAAATTGCTTCTTTATTTTCCAACTTGGAT
GAAAGTATGCCAAAAGCTCTTGGATTAGACGAGTCTTGTTCAGACGAATT
GCTTGTTACCATTAACCAACCGGTTCAAGGAGCAATAAAAAATCTCACTT
CTAATATCATAAATAACAAAGATAAATATGACATTAACCTGAACTGGGAT
ATTTACGAATTCACCAATGAGAACTTTTTGAAACAATTTGATCGGAATGC
GCGAATGACAAAGTTCACAAATTTATTATCCGGGTTAAATTATAAATATA
TTTTTTTGTTTCTTTATTAATAAATAGATTTTACTATACGCTGCAAGTTG
ATTCGTTGTTTGTAAGTTCAAGTCACGAGTCTATTGGTCAAAAAATACAA
ATATTCATTCCGGGATTACCTAAAGCACCATTATTAACTTGTAGGAAACT
GGATGATGAAAACCTTACCGTTGAATGGACAGATATCAATGTTGGCAATG
ATTGGAAAATAAAATCTTTTCAAATATTCATTAATGACTCTTCGATCGCA
AAAGAATTAGAAAATACAGAAAGAACTGCACAAATTACTTTAAAGAATAA
CAATCATTATAAAGTTTCACTTTGTGTAAGACTTCAAATTCATAAAGAGC
AAATAGTCACCGAATTCTCCAACCCCATTTACGTGTCTACGGGACCGAAG
AGAAGATTAATAAGTCAAATGGAATATGACAAATTCAACAATATGCGAGT
ATTAACTGTAACCGAATCGGAAATGTCTGGAAACTGCATTTGTTTGAATG
CAACACAAAATACTGACACCACTGTGGCATTATCATGGACCATTCCTCAG
TCTTTAAATGAAGATATATATTCCTATCAGGTTATTTGGAAATGCATTCA
GGGATTTGAAGAGCAAAAGATTTCTATACCGAATTCAAAAACTTTTAATT
ACGAAGTAGAAAATTTGATGCCCGGTCTAAAATATGCTTTTCGTCTTCTG
GCATTTGATAACGGCAAGCAGGTCATTGAAAAATCCAAGCAACTATATTT
GGAAACAAATACAGTTCTTGAAGCACCGAACTTACAATTAAAAGCAACTA
ATTTTTCATATGCCACCATATGCTGGAATTCTACAATCCCAAAAGGCAAT
GTGAAGTTAAAGTGTTTTCATATCTATGTAAATGGAGTTATGAGTATAGA
GGTAGAAGCAAGCAATCATATTTATACATATTATGATGGGCAACCATGCC
ACCAATACTCATTCCTGTGTCAAGCTATCAGCTATGAAGAGAAATACAAT
AGCAAACCTTCAAATACTGTAAAATGTATTTGGCCCGGATGTATTTCACC
TCCTTTGACAAGCTTGACTCCAATGGTTGCCAATTCAATTCGAGTGTCGT
GGGGTAATCCTACATTATCGGATGGGGCAAAAATTAAACATTTTCGTGTA
ATCTGTAGCAATTCTGAGACTGGTGAGCTAATACAGGCTGTTAATTTTAT
TCATCCAGAAAGCAGAGAAAGTGAAATTTTTCATGTCAAGTTTAATCAGT
ACGTTGTACGATTGGAAACATATCTACATGGAGCTCCATATCCATATTTG
TCCGAGCCGTTGCTGATACAACCGGAAACAGGTCCAGATCCCCCGGTTAT
TCAATTACAATTATTGAATATAAACGACAGGATAGAGTTGCTTAATAAAT
TAAGAAATTGTATTAACGAAGAAGATTCTATTATGAGATGTATTCATTAT
TGGGGAAGTCAGAATCGGCATACGGAAGAAGAAAAAAGTTTATTCTTTAA
AGCCTCCTCCCTTCTACCTGCTATTCAAGAAAATATTGACAATTATGTTT
ACCAAATGTCACGAAATGATGATTATGTAATAGCCGAGTTGAAATGGACC
CAAAAACAAACAGAAAATAAAGTAAATGTAACTGGATTTAAGGTGCTTGT
AGACGGAAAGTATTATGGGAGAGAATTGGATGCTACCTGCAAGTCAGTGC
TAATCAAGCTTAATGTGGATTCTAAAACTCATAAAATAGCGATGACTTCA
GTTTCTAATAAGCCCAGGCTTCTCAGTGGTTTGTCAAATGTAATCGAGGT
TTTAACAAATTTATATCCGCGTTTGCGATTTTTCTGTAAACCGGATATCC
ACCAGAAAATTTTACATTTGCCACGATCGCTTGTATAAATTTTCCTACTG
AAGCGCCAAGTGGAGCATTCAGTGTGAATAATTTCCTGCAGAATCTTCAT
CAGCAAGACAATATTGCCCATTATTATTGCTTTGATG
back to top

protein sequence of SMED30014507-orf-1

>SMED30014507-orf-1 ID=SMED30014507-orf-1|Name=SMED30014507-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1106bp
AIPSPTQFDIDIDATGKSWVNKFKLLSATQSAFIDLQKRVNKKPAHQLAR
LSISSKSEFEIEVKDDSKSDVSQLTTGIHKEASAAVSKVVMQPTISLSNF
AYSKFENQDTDFNDEQGLNNQPAISIKNNMPIPLIEVKQISISEILVKWS
LDSEIPKHLKIPVYNLQISGLQFKNIVNSDLSYFEKDLVTHVWNIANENK
CFVSGLLPRINYTIHVSATFIMASKQNKQQLNELSTYSEKINYRLAGPPK
APILSVKSIDIYQVILQWEVEEYDFSELKAFYIQFHNQSKEIKVPVEEKN
IVIDNIVDGQFLEIFIFSENIYGKSDKSNSISIKTSPKPVAPVVISEPTF
NHGESIISWTHDSSMLPQNFKIIFFRIFMDDVWHTDITADSAAFSNNEKY
NFVFQNLEYDISHEIKVVSVAGSILNEENVVYCYSHSNLSSPIIISGFKP
PDAALLHIESMNSKGILLNWDSPEETDNYHVIGYRILKNGFVYGSNVIPN
SVNSLWIKDIMLGNRVELQLITLTNINDNNNAPSSKIVIHYTGLVSSPTK
FEVESVNGFGAVLAWNKVTEKKHHFIPPDHFQVTWWNSTNPDNFDVRSIS
TKDSMVYITDLTPNTNYTAVLEGRSVNNFKEIYEEKSRSCFNHKITLSSD
PIKLNFKTSAPPTPPKNLCVVSATGSSIALQWDSPIEYGSEIVFLVMYYS
ESSEKSLKQCKTVELTPDAKNVIINHLSENVEYNFRLFAVTQEYFLSLPN
NFKKESASKLELNEDGSIIGDKLWVVSVNILAYTAGTFPPKNICVQETFL
NKIKIEWSLPSANGTNRLLSQVIRISEKTHSNKDDSQEQSSICINVDKYC
HVAELDRLLPATMYRIDVEAVVSIKTILNIDKFRDNFDNDDDNRRTTHYP
CKVPLFARTKTSPSPPQFLTCSKIVTNTIYISWQQPLMYTTVVHDGNNQS
TDFIRHRLEAYRVYVNNKLHATLKPNILSVKLTKCKFGRNSVKISSLINP
DYIPKAEIASLFSNLDESMPKALGLDESCSDELLVTINQPVQGAIKNLTS
NIINNKDKYDINLNWDIYEFTNENFLKQFDRNARMTKFTNLLSGLNYKYI
FLFLY*
back to top

protein sequence of SMED30014507-orf-2

>SMED30014507-orf-2 ID=SMED30014507-orf-2|Name=SMED30014507-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=490bp
MEYDKFNNMRVLTVTESEMSGNCICLNATQNTDTTVALSWTIPQSLNEDI
YSYQVIWKCIQGFEEQKISIPNSKTFNYEVENLMPGLKYAFRLLAFDNGK
QVIEKSKQLYLETNTVLEAPNLQLKATNFSYATICWNSTIPKGNVKLKCF
HIYVNGVMSIEVEASNHIYTYYDGQPCHQYSFLCQAISYEEKYNSKPSNT
VKCIWPGCISPPLTSLTPMVANSIRVSWGNPTLSDGAKIKHFRVICSNSE
TGELIQAVNFIHPESRESEIFHVKFNQYVVRLETYLHGAPYPYLSEPLLI
QPETGPDPPVIQLQLLNINDRIELLNKLRNCINEEDSIMRCIHYWGSQNR
HTEEEKSLFFKASSLLPAIQENIDNYVYQMSRNDDYVIAELKWTQKQTEN
KVNVTGFKVLVDGKYYGRELDATCKSVLIKLNVDSKTHKIAMTSVSNKPR
LLSGLSNVIEVLTNLYPRLRFFCKPDIHQKILHLPRSLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR003961FN3_dom
IPR013783Ig-like_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004721phosphoprotein phosphatase activity
GO:0004725protein tyrosine phosphatase activity
GO:0005001transmembrane receptor protein tyrosine phosphatase activity
GO:0008201heparin binding
GO:0016787hydrolase activity
GO:0016791phosphatase activity
GO:0032093SAM domain binding
Vocabulary: biological process
TermDefinition
GO:0001700embryonic development via the syncytial blastoderm
GO:0006470protein dephosphorylation
GO:0007155cell adhesion
GO:0007283spermatogenesis
GO:0007399nervous system development
GO:0007411axon guidance
GO:0007412axon target recognition
GO:0008045motor neuron axon guidance
GO:0008360regulation of cell shape
GO:0008594photoreceptor cell morphogenesis
GO:0016311dephosphorylation
GO:0031290retinal ganglion cell axon guidance
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0045467R7 cell development
GO:0048477oogenesis
GO:0048675axon extension
GO:0048841regulation of axon extension involved in axon guidance
GO:0051124synaptic growth at neuromuscular junction
GO:1903386negative regulation of homophilic cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0005875microtubule associated complex
GO:0005886plasma membrane
GO:0005925focal adhesion
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030424axon
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 450..529
e-value: 36.0
score: 6.7
coord: 337..424
e-value: 54.0
score: 5.2
coord: 545..630
e-value: 3.6
score: 15.3
coord: 129..226
e-value: 51.0
score: 5.3
coord: 248..325
e-value: 29.0
score: 7.5
coord: 662..747
e-value: 9.6E-9
score: 45.0
coord: 787..875
e-value: 14.0
score: 10.3
coord: 913..972
e-value: 27.0
score: 7.8
IPR003961Fibronectin type IIIPFAMPF00041fn3coord: 664..743
e-value: 4.5E-9
score: 36.5
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 547..649
score: 11.156
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 664..761
score: 15.235
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 248..338
score: 9.823
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 450..545
score: 7.685
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 789..892
score: 6.833
IPR003961Fibronectin type IIICDDcd00063FN3coord: 662..743
e-value: 7.27143E-11
score: 57.8915
IPR003961Fibronectin type IIICDDcd00063FN3coord: 546..618
e-value: 3.64305E-4
score: 38.6315
IPR003961Fibronectin type IIICDDcd00063FN3coord: 248..335
e-value: 0.00187843
score: 36.7055
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 544..636
e-value: 7.7E-7
score: 31.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 782..877
e-value: 1.3E-5
score: 27.2
coord: 650..751
e-value: 5.4E-13
score: 51.1
NoneNo IPR availablePANTHERPTHR46708FAMILY NOT NAMEDcoord: 197..743
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 789..940
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 546..742
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 248..420