kcnka

Overview
Namekcnka (AIX99544.1)
Smed IDSMED30014505
Length (bp)1307
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of kcnka (SMED30014505) t-SNE clustered cells

Violin plots show distribution of expression levels for kcnka (SMED30014505) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of kcnka (SMED30014505) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for kcnka (SMED30014505) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014505

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014505h1SMcG0004125 SmedASXL_012437SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30014505h1SMcG0004125 Contig34223uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014505h1SMcG0004125 Contig34223newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30014505h1SMcG0004125 dd_Smed_v4_19825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014505h1SMcG0004125 dd_Smed_v4_19825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30014505h1SMcG0004125 dd_Smed_v4_19825_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014505h1SMcG0004125 dd_Smed_v6_19825_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
neuronSMED30014505h1SMcG0004125 dd_Smed_v6_19825_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of kcnka vs. Ensembl Human
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 83.1889 bits (204), Expect = 6.944e-18
Identity = 58/210 (27.62%), Postives = 90/210 (42.86%), Query Frame = 1
Query:  307 EVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGD 936
            E +  G +P  + T      N S W+  +S FF  T++TTIGYGN+ PST  G++ C+ YA +GIPL ++FL++ G  L                  +    +I  +E   +RS +                              L ++ +             L + +G L+I +F   ++F   E W      YF+FIT+STIGFGD
Sbjct:   10 EAWVKGVNPKGNST------NPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLGTGL------------------RAHLAAIERWEDRPRRSQV------------------------------LQVLGLA------------LFLTLGTLVILIFP-PMVFSHVEGWSFSEGFYFAFITLSTIGFGD 152          
BLAST of kcnka vs. Ensembl Human
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 83.5741 bits (205), Expect = 2.891e-17
Identity = 65/243 (26.75%), Postives = 106/243 (43.62%), Query Frame = 1
Query:  307 EVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLY----PAKNTIGSSVATLELIVGAVYCIIGLA 1023
            E +  G +P  + T      N S W+  +S FF  T++TTIGYGN+ PST  G++ C+ YA +GIPL ++FL++ G  L                  +    +I  +E   +RS +                              L ++ +             L + +G L+I +F   ++F   E W      YF+FIT+STIGFGD      P+K+ I     ++   + A++ ++GLA
Sbjct:   75 EAWVKGVNPKGNST------NPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLGTGL------------------RAHLAAIERWEDRPRRSQV------------------------------LQVLGLA------------LFLTLGTLVILIF-PPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYI-----SVYRSLAAIWILLGLA 245          
BLAST of kcnka vs. Ensembl Human
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 82.4185 bits (202), Expect = 3.424e-17
Identity = 58/210 (27.62%), Postives = 90/210 (42.86%), Query Frame = 1
Query:  307 EVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGD 936
            E +  G +P  + T      N S W+  +S FF  T++TTIGYGN+ PST  G++ C+ YA +GIPL ++FL++ G  L                  +    +I  +E   +RS +                              L ++ +             L + +G L+I +F   ++F   E W      YF+FIT+STIGFGD
Sbjct:   75 EAWVKGVNPKGNST------NPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLGTGL------------------RAHLAAIERWEDRPRRSQV------------------------------LQVLGLA------------LFLTLGTLVILIF-PPMVFSHVEGWSFSEGFYFAFITLSTIGFGD 217          
BLAST of kcnka vs. Ensembl Human
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 83.1889 bits (204), Expect = 3.574e-17
Identity = 65/243 (26.75%), Postives = 106/243 (43.62%), Query Frame = 1
Query:  307 EVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLY----PAKNTIGSSVATLELIVGAVYCIIGLA 1023
            E +  G +P  + T      N S W+  +S FF  T++TTIGYGN+ PST  G++ C+ YA +GIPL ++FL++ G  L                  +    +I  +E   +RS +                              L ++ +             L + +G L+I +F   ++F   E W      YF+FIT+STIGFGD      P+K+ I     ++   + A++ ++GLA
Sbjct:   75 EAWVKGVNPKGNST------NPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLGTGL------------------RAHLAAIERWEDRPRRSQV------------------------------LQVLGLA------------LFLTLGTLVILIF-PPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYI-----SVYRSLAAIWILLGLA 245          
BLAST of kcnka vs. Ensembl Human
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 83.1889 bits (204), Expect = 5.114e-17
Identity = 58/210 (27.62%), Postives = 90/210 (42.86%), Query Frame = 1
Query:  307 EVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGD 936
            E +  G +P  + T      N S W+  +S FF  T++TTIGYGN+ PST  G++ C+ YA +GIPL ++FL++ G  L                  +    +I  +E   +RS +                              L ++ +             L + +G L+I +F   ++F   E W      YF+FIT+STIGFGD
Sbjct:   75 EAWVKGVNPKGNST------NPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLGTGL------------------RAHLAAIERWEDRPRRSQV------------------------------LQVLGLA------------LFLTLGTLVILIF-PPMVFSHVEGWSFSEGFYFAFITLSTIGFGD 217          
BLAST of kcnka vs. Ensembl Celegans
Match: twk-48 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q7YWY7])

HSP 1 Score: 142.124 bits (357), Expect = 5.064e-38
Identity = 80/253 (31.62%), Postives = 137/253 (54.15%), Query Frame = 1
Query:  373 SAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFV-----KGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVX--------XXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNK 1092
            + W    +  +  T+ITTIGYGN    T  G+ + ++YA IGIPLMLLFL+N G+V+A  FRF+Y      +  +     K K   I    S+  R     +   ++   +++S  + A        EDL    V+            Q E + +P+++V+  ++ Y+ +G  IF++WE W  + + YF FI+++TIGFGD +P+ +   +  A  +L++ ++Y + G+A+L+MC NL +EE+  K  W+ +K
Sbjct:  118 AQWTFTGAFLYSLTVITTIGYGNTAAKTYIGKTLTMLYAIIGIPLMLLFLTNIGDVMAKIFRFLYAQSIRLKFRLILWHKKRKAAKIRRANSLVSRLT---RGHRVKADSSVDSFGLGAGADV----EDLLTARVEMEQLEVRETAAAQLESMTVPISLVVFTMLGYLGVGTTIFKVWEGWTFLESFYFCFISLTTIGFGDKFPSTSVSNTDEAQEKLVITSIYLLFGMALLAMCFNLAQEEVQNKTRWIADK 363          
BLAST of kcnka vs. Ensembl Celegans
Match: twk-28 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:Q22940])

HSP 1 Score: 127.102 bits (318), Expect = 8.990e-32
Identity = 84/294 (28.57%), Postives = 143/294 (48.64%), Query Frame = 1
Query:  232 SIGNSGYNA--TIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVK 1107
             I    +NA    Y++Q+   +F    + Y   F  +K      + D +  W   NS+FF AT+ITTIGYGN+VP TV GR+ CII+A +GIPL+L+ +++ G+ L+    ++Y +    +  ++ +   I+       +S         + A ++N + + +       DE                + IP+ +V+  L+ Y  +G  +FQ WE  +   A YF FIT++T+GFGD+ P +           +     Y I GL++ +MC++L   E + K  +LG K+   K
Sbjct:  120 RISREAFNAINQEYFEQLVKNMF----QAYRNQFITAKHLLNKTREDEV-LWTFPNSMFFAATVITTIGYGNLVPITVTGRVACIIFALLGIPLLLVTIADIGKFLSEFLSYLYRSYRGFKRKLRRQSKKITSQYRSQSQSRSSSVMGSSK-AGSMNLHDIDSDSEDSAGDE----------------LRIPVFMVLLVLLAYTAIGGFLFQSWEHLEYFEAFYFCFITMATVGFGDIVPNEQVY--------VFFTMAYIIFGLSLATMCIDLAGTEYIRKIHYLGTKMEDAK 383          
BLAST of kcnka vs. Ensembl Celegans
Match: twk-18 (TWiK family of potassium channels protein 18 [Source:UniProtKB/Swiss-Prot;Acc:Q18120])

HSP 1 Score: 114.005 bits (284), Expect = 1.915e-27
Identity = 92/337 (27.30%), Postives = 153/337 (45.40%), Query Frame = 1
Query:  148 EQENEKSSCFTSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATP-PPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNT-GSSEECEEVNDH 1152
            EQ+ E+          +++L     R +      YN T        +L  F +   TLG  P+         D    W    SIF+C T+ TTIGYGNIVP T WGR   I+YAFIGIPL +L L   G + A   + ++      R F+K            ++  + ++ N   E A+N+       TP   K  + D D++            + P++ ++   +I++   A++F   E WD   ++YF+ I+ +TIGFGD+ P+             IVG V  +IGL+++S  + L++++I    S + + +    +     + E  EV++H
Sbjct:   53 EQQKERDELIRRTVYKINQLQIKRQRRLMTAEEEYNRTA------KVLTTFQE---TLGIVPA-------DMDKDIHWTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKGCKMLW------RFFLKS-----------TRVVSKDLSNKISEAADNIEEGTTAITPSAEKTENNDDDLL------------SFPISGLLLITVIWVIFCAVLFTFLEEWDFGTSLYFTLISFTTIGFGDILPSDYDFMP-------IVG-VLLLIGLSLVSTVMTLIQQQIEALASGMKDNIDQEYARALNEAREDGEVDEH 336          
BLAST of kcnka vs. Ensembl Celegans
Match: twk-18 (TWiK family of potassium channels protein 18 [Source:UniProtKB/Swiss-Prot;Acc:Q18120])

HSP 1 Score: 114.005 bits (284), Expect = 1.915e-27
Identity = 92/337 (27.30%), Postives = 153/337 (45.40%), Query Frame = 1
Query:  148 EQENEKSSCFTSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATP-PPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNT-GSSEECEEVNDH 1152
            EQ+ E+          +++L     R +      YN T        +L  F +   TLG  P+         D    W    SIF+C T+ TTIGYGNIVP T WGR   I+YAFIGIPL +L L   G + A   + ++      R F+K            ++  + ++ N   E A+N+       TP   K  + D D++            + P++ ++   +I++   A++F   E WD   ++YF+ I+ +TIGFGD+ P+             IVG V  +IGL+++S  + L++++I    S + + +    +     + E  EV++H
Sbjct:   53 EQQKERDELIRRTVYKINQLQIKRQRRLMTAEEEYNRTA------KVLTTFQE---TLGIVPA-------DMDKDIHWTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKGCKMLW------RFFLKS-----------TRVVSKDLSNKISEAADNIEEGTTAITPSAEKTENNDDDLL------------SFPISGLLLITVIWVIFCAVLFTFLEEWDFGTSLYFTLISFTTIGFGDILPSDYDFMP-------IVG-VLLLIGLSLVSTVMTLIQQQIEALASGMKDNIDQEYARALNEAREDGEVDEH 336          
BLAST of kcnka vs. Ensembl Celegans
Match: twk-2 (TWiK family of potassium channels [Source:UniProtKB/TrEMBL;Acc:A0A2X0SX30])

HSP 1 Score: 115.161 bits (287), Expect = 3.858e-27
Identity = 64/239 (26.78%), Postives = 123/239 (51.46%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKL 1095
            W  ++++FF AT + TIGYGNIVP T  GR+ C+++A  G P+ ++ + + G+ L+    ++Y ++       KG     +  +S  KR     +  E   +++L S           +D D+D +         +   +P+ +V   +++Y+  G ++F I E W  + A Y+SFI+++TIGFGD+ P  +          + +  +Y  +GL++ +MC++L   + ++K  + G K 
Sbjct:  164 WTTSSALFFAATTMATIGYGNIVPVTPLGRLACVLFALFGAPIAIITIGDLGKFLSECTIWLYKHM------RKGS----ARLDSAWKR----FRGLEDSISDDLES--ASKNQDSSILDMDMDEI---------DKSEVPVLMVFTIILLYIAFGGILFSILEDWSYMDAFYYSFISLTTIGFGDIVPENHDY--------IAIMLIYLGVGLSVTTMCIDLAGIQYIQKIHYFGRKF 369          
BLAST of kcnka vs. Ensembl Fly
Match: sand (gene:FBgn0033257 transcript:FBtr0088780)

HSP 1 Score: 140.584 bits (353), Expect = 3.131e-37
Identity = 82/259 (31.66%), Postives = 141/259 (54.44%), Query Frame = 1
Query:  361 PDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNS---------------------NPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLEL--IVGAVYCIIGLAILSMCLNLVKEEIVE 1068
            PD +  W+ + +  +  T+ITTIGYGNI P +  G++V I+YA IG+PL LL+LSN G+VLA +F+++Y+ +C CR         I       ++ A  ++  ++ENA   +S                         +    ++ + D DI    +     + I +P+TV +  ++ Y+  GAL+F  WE W+ +   YF  I++S+IGFGDL P    I +    +E+  I+ A+Y ++G+A+++MC NL++E++V 
Sbjct:  122 PD-VEQWSFSGAFLYSLTVITTIGYGNITPHSECGKLVTILYAIIGMPLFLLYLSNIGDVLAKSFKWIYSKVCLCRICPGVAKRRIIRERRKMRQLARALQMHDMENARGSSSYTSTSSTTSSNSSSSEYTRSSRQSSSLVDIQYTESDSDIE--REIRGSTDEITVPVTVCVFVMVGYILWGALLFGRWEDWNYLDGSYFCLISLSSIGFGDLVPGDRVITADRDKVEVSFILCAIYLLLGMAVIAMCFNLMQEQVVH 377          
BLAST of kcnka vs. Ensembl Fly
Match: CG42594 (gene:FBgn0260971 transcript:FBtr0345704)

HSP 1 Score: 124.02 bits (310), Expect = 4.793e-30
Identity = 83/258 (32.17%), Postives = 126/258 (48.84%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTN-LCCCRCFVKG------KYTSISEFESMSKRSAIEIKNFELENAEN------LNSNPVK----ATPPPKFIDE--------DLDIVYVXXXXXXXXXXX--XPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEK 1071
            WN A +  +  T++TTIGYGN+ P T  GRIV + YAF GIPL L++LS+ G +LA   R V++  LCCC C   G      K  +  E     KR   E++  +    E        ++ P K      PPP             D+D +   +       ++   P+ +    +IIY+  GA +    E W ++  +YF F+++STIGFGD+ P       S AT      +VY + G+ + +MC N++ EEIV +
Sbjct:  600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPILDGIYFCFMSLSTIGFGDMLPGLRR--ESNATTWFC--SVYIMSGMTLTAMCFNVIHEEIVHR 853          
BLAST of kcnka vs. Ensembl Fly
Match: CG42594 (gene:FBgn0260971 transcript:FBtr0301749)

HSP 1 Score: 124.02 bits (310), Expect = 4.793e-30
Identity = 83/258 (32.17%), Postives = 126/258 (48.84%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTN-LCCCRCFVKG------KYTSISEFESMSKRSAIEIKNFELENAEN------LNSNPVK----ATPPPKFIDE--------DLDIVYVXXXXXXXXXXX--XPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEK 1071
            WN A +  +  T++TTIGYGN+ P T  GRIV + YAF GIPL L++LS+ G +LA   R V++  LCCC C   G      K  +  E     KR   E++  +    E        ++ P K      PPP             D+D +   +       ++   P+ +    +IIY+  GA +    E W ++  +YF F+++STIGFGD+ P       S AT      +VY + G+ + +MC N++ EEIV +
Sbjct:  600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPILDGIYFCFMSLSTIGFGDMLPGLRR--ESNATTWFC--SVYIMSGMTLTAMCFNVIHEEIVHR 853          
BLAST of kcnka vs. Ensembl Fly
Match: CG42594 (gene:FBgn0260971 transcript:FBtr0345703)

HSP 1 Score: 124.02 bits (310), Expect = 4.832e-30
Identity = 83/259 (32.05%), Postives = 126/259 (48.65%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTN-LCCCRCFVKG------KYTSISEFESMSKRSAIEIKNFELENAEN------LNSNPVK----ATPPPKFIDE--------DLDIVYVXXXXXXXXXXX--XPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKF 1074
            WN A +  +  T++TTIGYGN+ P T  GRIV + YAF GIPL L++LS+ G +LA   R V++  LCCC C   G      K  +  E     KR   E++  +    E        ++ P K      PPP             D+D +   +       ++   P+ +    +IIY+  GA +    E W ++  +YF F+++STIGFGD+ P       S AT      +VY + G+ + +MC N++ EEIV + 
Sbjct:  600 WNFAKAFLYSLTVLTTIGYGNVAPRTTLGRIVTLAYAFFGIPLTLVYLSSTGSILARVAREVFSKALCCCLCSNCGYCCYDEKRMAEKERRMRRKRQQEELRKQQAVMQEPYYVRDVFHATPEKDAGAGAPPPNAGGPVGSVGGLGDIDSLSASESRGSMHGLSILAPILLCFSMMIIYIVFGAAVLYRLEKWPILDGIYFCFMSLSTIGFGDMLPGLRR--ESNATTWFC--SVYIMSGMTLTAMCFNVIHEEIVHRI 854          
BLAST of kcnka vs. Ensembl Fly
Match: CG34396 (gene:FBgn0085425 transcript:FBtr0112645)

HSP 1 Score: 114.775 bits (286), Expect = 5.904e-27
Identity = 82/268 (30.60%), Postives = 133/268 (49.63%), Query Frame = 1
Query:  376 AWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRF--VYTNLC----CCRCFVKGK--YTSISEFESMS----KRSAIEIKNFELENAENLN-----------SNPVKATPP-PKF--IDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWE-TWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLG 1098
            +WN  N   FC T+ITTIGYG+I P T  GR + I+YA IGIP+ L+ L++ G++     +F  VY         CR   K +   ++++ F +M     +R ++   N   EN E              S+P   T P P+   +D++ ++               P++V    LI Y+ LG+  F + E +W  + A Y+ FI++STIGFGDL P+            ++V  +Y + GLA+ SM +N+V+ ++ + F     K+G
Sbjct:  613 SWNFVNCFIFCWTVITTIGYGHITPKTGMGRSLTIVYAIIGIPMFLIVLADLGKLFTRCVKFLWVYVRRMYYTRSCRRIRKQQQIRSAMTGFNTMYDMAIRRPSMFFSNSAPENDEESQADAEAARSVGTSHPETPTSPYPETFEVDDEFNL---------------PVSVASLLLITYILLGSFGFLMMEPSWTPLDAFYYVFISMSTIGFGDLVPSN--------PFYVMVSMIYLMFGLALTSMFINVVQIKLSDHFKMASAKVG 857          
BLAST of kcnka vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 103.605 bits (257), Expect = 7.917e-24
Identity = 83/292 (28.42%), Postives = 126/292 (43.15%), Query Frame = 1
Query:  376 AWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNL----------CCCRCFVKGKYTSISEFES-----------------------MSKRSAIEIKNFELENAENL-------NSNPVKAT-------------PPPK---FID-----EDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWE-TWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIV 1065
             W    S+FFC T+ TT+GYG I P T  G++ C++YA +GIPLMLL +S+ G++LA      YT L             R     K +++ + ++                       +  RS+I   +F+L N + +        S  +K T             P PK   F D     E LD+               PL V++  +  YM + + I + WE   D   A YF+FIT++TIGFGD+ P              +V  ++ I G+AI+SM   L + +IV
Sbjct:   99 GWTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRLNLFFRRWIGHQSWRLQSHEKTSALPQVQADTDGTYKFNQDVVVLETTNNQQVIQTRSSIRRGSFQLRNNKEIFDRIIVRESFRIKGTLSKSCSCPELDRVPTPKDELFNDIGQEMEQLDV---------------PLLVILLMVFAYMVICSQILKCWEKQMDHSDAFYFTFITLTTIGFGDIVPEHPKF--------FMVTFLFIITGMAIMSMAFKLGQSQIV 367          
BLAST of kcnka vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 103.219 bits (256), Expect = 8.040e-24
Identity = 83/292 (28.42%), Postives = 126/292 (43.15%), Query Frame = 1
Query:  376 AWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNL----------CCCRCFVKGKYTSISEFES-----------------------MSKRSAIEIKNFELENAENL-------NSNPVKAT-------------PPPK---FID-----EDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWE-TWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIV 1065
             W    S+FFC T+ TT+GYG I P T  G++ C++YA +GIPLMLL +S+ G++LA      YT L             R     K +++ + ++                       +  RS+I   +F+L N + +        S  +K T             P PK   F D     E LD+               PL V++  +  YM + + I + WE   D   A YF+FIT++TIGFGD+ P              +V  ++ I G+AI+SM   L + +IV
Sbjct:   99 GWTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRLNLFFRRWIGHQSWRLQSHEKTSALPQVQADTDGTYKFNQDVVVLETTNNQQVIQTRSSIRRGSFQLRNNKEIFDRIIVRESFRIKGTLSKSCSCPELDRVPTPKDELFNDIGQEMEQLDV---------------PLLVILLMVFAYMVICSQILKCWEKQMDHSDAFYFTFITLTTIGFGDIVPEHPKF--------FMVTFLFIITGMAIMSMAFKLGQSQIV 367          
BLAST of kcnka vs. Ensembl Zebrafish
Match: kcnk18 (potassium channel, subfamily K, member 18 [Source:ZFIN;Acc:ZDB-GENE-100405-2])

HSP 1 Score: 103.219 bits (256), Expect = 9.322e-24
Identity = 83/292 (28.42%), Postives = 126/292 (43.15%), Query Frame = 1
Query:  376 AWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNL----------CCCRCFVKGKYTSISEFES-----------------------MSKRSAIEIKNFELENAENL-------NSNPVKAT-------------PPPK---FID-----EDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWE-TWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIV 1065
             W    S+FFC T+ TT+GYG I P T  G++ C++YA +GIPLMLL +S+ G++LA      YT L             R     K +++ + ++                       +  RS+I   +F+L N + +        S  +K T             P PK   F D     E LD+               PL V++  +  YM + + I + WE   D   A YF+FIT++TIGFGD+ P              +V  ++ I G+AI+SM   L + +IV
Sbjct:   99 GWTFFASLFFCCTVFTTVGYGRIYPLTSKGKVACVLYAMVGIPLMLLVISDVGDLLAVLLSKAYTRLNLFFRRWIGHQSWRLQSHEKTSALPQVQADTDGTYKFNQDVVVLETTNNQQVIQTRSSIRRGSFQLRNNKEIFDRIIVRESFRIKGTLSKSCSCPELDRVPTPKDELFNDIGQEMEQLDV---------------PLLVILLMVFAYMVICSQILKCWEKQMDHSDAFYFTFITLTTIGFGDIVPEHPKF--------FMVTFLFIITGMAIMSMAFKLGQSQIV 367          
BLAST of kcnka vs. Ensembl Zebrafish
Match: kcnk10a (potassium channel, subfamily K, member 10a [Source:ZFIN;Acc:ZDB-GENE-041210-291])

HSP 1 Score: 91.6633 bits (226), Expect = 2.159e-19
Identity = 82/327 (25.08%), Postives = 140/327 (42.81%), Query Frame = 1
Query:  289 LFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKE--EIVEKFSWLGNKLGIVKSNTGSSEECEEVNDHQSNSRIIIENSDFQNSVMHVNEAYEKDEILFKTKIKS 1263
            L   S +    G SP  D +      N S W+L +S FF  T+ITTIGYGNI PST  G+I CI+YA  GIPL    L+  G+ L + F               GK  SI++ E M +R   +I   ++  A  L                                    L ++ G  I+++ + A+IF+  E W  + A+YF  IT++T+G GD     N           +V   + ++GLA  +  L+++ +   ++ K + +  ++G +K++    +        ++  R+ +E  D       +  + E+ ++ F  +  S
Sbjct:  144 LIKHSVDAVNAGVSPIGDTSY-----NSSHWDLGSSFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGVGDQLGTIF---------------GK--SIAKVEKMFRRKHNQISQTKIRVASTL------------------------------------LFILAG-CILFVTIPAIIFKHIEGWTGLEAIYFVVITLTTVGIGDYVAGGNRRIEYRKWYRPLVW-FWILVGLAYFAAVLSMIGDWLRVLSKKTKM--EVGEIKAHAAEWKANVRAELRETRRRLSVEVHDKLQRAATI-RSMERRQLGFDQRAHS 407          
BLAST of kcnka vs. Ensembl Zebrafish
Match: kcnk2a (potassium channel, subfamily K, member 2a [Source:ZFIN;Acc:ZDB-GENE-061226-2])

HSP 1 Score: 88.9669 bits (219), Expect = 8.759e-19
Identity = 82/280 (29.29%), Postives = 122/280 (43.57%), Query Frame = 1
Query:  322 GFSPSKDCTTIGQPDNLSA-WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAV--YCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNTGSSEECEEVNDH 1152
            G +PS      G P N S+ W+L++S FF  T+ITTIG+GN+ P T  GRI CIIYA +GIPL    L+  G+ L + F               GK   I++ E M  +              N++   ++ T    FI                         + G L+ ++ L ALIFQ  E W  + ++YF  IT++TIGFGD        GS +  L+     V  + ++GLA  +  L+++           G+ L ++   T   EE  E   H
Sbjct:  126 GVNPS------GHPSNESSMWDLSSSFFFAGTVITTIGFGNVSPHTEGGRIFCIIYALLGIPLFGFLLAGVGDQLGTIF---------------GK--GIAKVEKMFVKW-------------NVSQTKIRVTSTVLFI-------------------------LFGCLL-FVALPALIFQHIEGWSALESIYFVVITLTTIGFGDFVAG----GSEIEYLDYYKPIVWFWILVGLAYFAAVLSMI-----------GDWLRVISKKT--KEEVGEFRAH 326          
BLAST of kcnka vs. Ensembl Xenopus
Match: KCNK18 (potassium two pore domain channel subfamily K member 18 [Source:HGNC Symbol;Acc:HGNC:19439])

HSP 1 Score: 88.5817 bits (218), Expect = 9.067e-19
Identity = 75/277 (27.08%), Postives = 132/277 (47.65%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTN--LCCCRCFVKGKYTSISEF---------------------------ESMSKRSAIEIKNFELEN---------AENLNSNPVKATPPPK-FIDEDLDIVYVXXXXXX--------XXXXXXPLTVVIGFLIIYMFLGALIFQIWE-TWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIV 1065
            W+  +S+FFC T+ TT+GYG+I P T++G++ C++YA +GIPLMLL L++ G++LA      Y    L C +   K K   +S                             E +  +++++ K  ++ N          EN    P+K++   K F   DLD+    D   Q         + +++P+ +++  ++ Y+  GA I  +WE  W  + A YF F+T++TIGFGD+ P              ++ + Y ++G+ I+ M   L +  +V
Sbjct:   66 WSFKSSLFFCCTVFTTVGYGHICPVTMYGKLACMVYATLGIPLMLLLLADLGDILARLLSRTYKRAVLACNKLCHKPKPIKLSSLHKEHSGKSSLLKTMDSRVSMKEPLNITEVIKTQASVKRKYLQMRNIDIFELIIVKENQKVLPLKSSLQQKSFSCPDLDLWPPSDSAMQNFDKIGEELDHLDVPIVLIVLVMVAYIMCGACILPLWEDDWTTIDAFYFCFVTLTTIGFGDIIPKHPNY--------FLLLSAYTVVGMVIVCMAFKLGQNRLV 334          
BLAST of kcnka vs. Ensembl Xenopus
Match: stk26 (serine/threonine kinase 26 [Source:Xenbase;Acc:XB-GENE-982067])

HSP 1 Score: 74.3294 bits (181), Expect = 3.481e-14
Identity = 37/79 (46.84%), Postives = 49/79 (62.03%), Query Frame = 1
Query:  307 EVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVL 543
            E +  G +P  + T      N S W+ +NS FF  T+ITTIGYGN+ PSTV G++ C+ YA  GIPL L FL+  G+ L
Sbjct:   75 EAWEKGLNPKGNAT------NPSNWDFSNSFFFAGTVITTIGYGNLYPSTVAGQVFCVFYALFGIPLNLAFLNLIGKSL 147          
BLAST of kcnka vs. Ensembl Xenopus
Match: stk26 (serine/threonine kinase 26 [Source:Xenbase;Acc:XB-GENE-982067])

HSP 1 Score: 73.9442 bits (180), Expect = 4.034e-14
Identity = 37/79 (46.84%), Postives = 49/79 (62.03%), Query Frame = 1
Query:  307 EVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVL 543
            E +  G +P  + T      N S W+ +NS FF  T+ITTIGYGN+ PSTV G++ C+ YA  GIPL L FL+  G+ L
Sbjct:   74 EAWEKGLNPKGNAT------NPSNWDFSNSFFFAGTVITTIGYGNLYPSTVAGQVFCVFYALFGIPLNLAFLNLIGKSL 146          
BLAST of kcnka vs. Ensembl Xenopus
Match: KCNK4 (potassium channel, two pore domain subfamily K, member 4 [Source:NCBI gene;Acc:100488063])

HSP 1 Score: 72.0182 bits (175), Expect = 4.219e-13
Identity = 36/85 (42.35%), Postives = 48/85 (56.47%), Query Frame = 1
Query:  304 KEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFR 558
            KE    G  PS + T +      + W++ +  FF  TIITTIGYGN  P T  G+I CI YA +GIPL  + L+  G+ L S+ R
Sbjct:   66 KEAIGSGVDPSANATNV-----TTRWDIGSCFFFAGTIITTIGYGNNAPKTDGGQIFCIFYALVGIPLFGILLAGVGDHLGSSLR 145          
BLAST of kcnka vs. Ensembl Xenopus
Match: KCNK4 (potassium channel, two pore domain subfamily K, member 4 [Source:NCBI gene;Acc:100488063])

HSP 1 Score: 71.633 bits (174), Expect = 5.174e-13
Identity = 36/85 (42.35%), Postives = 48/85 (56.47%), Query Frame = 1
Query:  304 KEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFR 558
            KE    G  PS + T +      + W++ +  FF  TIITTIGYGN  P T  G+I CI YA +GIPL  + L+  G+ L S+ R
Sbjct:   65 KEAIGSGVDPSANATNV-----TTRWDIGSCFFFAGTIITTIGYGNNAPKTDGGQIFCIFYALVGIPLFGILLAGVGDHLGSSLR 144          
BLAST of kcnka vs. Ensembl Mouse
Match: Kcnk16 (potassium channel, subfamily K, member 16 [Source:MGI Symbol;Acc:MGI:1921821])

HSP 1 Score: 83.5741 bits (205), Expect = 1.471e-17
Identity = 67/260 (25.77%), Postives = 107/260 (41.15%), Query Frame = 1
Query:  253 NATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILS 1032
            N T   QQ          E +  G +P  + T      N S W+  +S FF  T++TTIGYGN+ PST  G++ C+ YA +GIPL ++FL++ G  L                  +   T++  +E   + S +                              L ++ +             L + +G L+I +F   + F   E W      YF+FIT+STIGFGD     +     +A    +  A++ ++GLA L+
Sbjct:   57 NYTCLDQQALEQFVQVILEAWVKGVNPKGNST------NPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALMGIPLNVVFLNHLGTGL------------------RAHLTTLDRWEDHPRHSQL------------------------------LQVLGLA------------LFLTLGTLVILIF-PPMFFSHVEGWSFREGFYFAFITLSTIGFGDYVVGTDPSKHYIAVYRSLA-AIWILLGLAWLA 248          
BLAST of kcnka vs. Ensembl Mouse
Match: Kcnk18 (potassium channel, subfamily K, member 18 [Source:MGI Symbol;Acc:MGI:2685627])

HSP 1 Score: 84.7297 bits (208), Expect = 2.219e-17
Identity = 68/278 (24.46%), Postives = 117/278 (42.09%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTN----LCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENA--ENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXP------------------------------------LTVVIGFLIIYMFLGALIFQIWET-WDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWL 1083
            W+  +++FFC T+ +T+GYG++ P T  G+ +C++YA  GIPLM L L++ G++LA+     Y+     LC      K +   +   +  SK     I    ++    E LN  P K  P P    E  + +   ++ ++ +    P                                    L V+   +  Y+   A I   WET      A YF F+T++TIGFGD+          V     +  ++Y I+G+ IL +   L++  ++  +  L
Sbjct:  112 WSFLSALFFCCTVFSTVGYGHMYPVTRLGKFLCMLYALFGIPLMFLVLTDIGDILATILSRAYSRFQALLCLPHDIFKWRSLPLCRKQPDSKPVEEAIPQIVIDAGVDELLNPQPSKDPPSPSCNVELFERLVAREKKNKLQPPTRPVERSNSCPELVLGRLSCSILSNLDEVGQQVERLDIPLPVIALVVFAYISCAAAILPFWETELGFEDAFYFCFVTLTTIGFGDIV--------LVHPHFFLFFSIYIIVGMEILFIAFKLMQNRLLHTYKTL 381          
BLAST of kcnka vs. Ensembl Mouse
Match: Kcnk4 (potassium channel, subfamily K, member 4 [Source:MGI Symbol;Acc:MGI:1298234])

HSP 1 Score: 75.0998 bits (183), Expect = 2.680e-14
Identity = 38/83 (45.78%), Postives = 51/83 (61.45%), Query Frame = 1
Query:  310 VYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFR 558
            V  LG   + + +     ++ SAWNL ++ FF  TIITTIGYGNIV  T  GR+ CI YA +GIPL  + L+  G+ L S+ R
Sbjct:   66 VEALGGGANPETSWTNSSNHSSAWNLGSAFFFSGTIITTIGYGNIVLHTDAGRLFCIFYALVGIPLFGMLLAGVGDRLGSSLR 148          
BLAST of kcnka vs. Ensembl Mouse
Match: Kcnk10 (potassium channel, subfamily K, member 10 [Source:MGI Symbol;Acc:MGI:1919508])

HSP 1 Score: 72.7886 bits (177), Expect = 4.008e-14
Identity = 45/125 (36.00%), Postives = 61/125 (48.80%), Query Frame = 1
Query:  274 QMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSA-WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAF--------RFVYTNLC--CCRCFVKGKYTS 615
            Q    L   + +    G SP      +G   N S+ W+L ++ FF  T+ITTIGYGNI PST  G+I CI+YA  GIPL    L+  G+ L + F        +    + C  C   FV G + S
Sbjct:  122 QELETLIQHALDADNAGVSP------VGNSSNSSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRAHGCFVCTHIFVPGIHRS 240          
BLAST of kcnka vs. Ensembl Mouse
Match: Kcnk10 (potassium channel, subfamily K, member 10 [Source:MGI Symbol;Acc:MGI:1919508])

HSP 1 Score: 73.559 bits (179), Expect = 1.314e-13
Identity = 39/95 (41.05%), Postives = 52/95 (54.74%), Query Frame = 1
Query:  274 QMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSA-WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAF 555
            Q    L   + +    G SP      +G   N S+ W+L ++ FF  T+ITTIGYGNI PST  G+I CI+YA  GIPL    L+  G+ L + F
Sbjct:  105 QELETLIQHALDADNAGVSP------VGNSSNSSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGIGDQLGTIF 193          
BLAST of kcnka vs. UniProt/SwissProt
Match: sp|Q18120|TWK18_CAEEL (TWiK family of potassium channels protein 18 OS=Caenorhabditis elegans OX=6239 GN=twk-18 PE=1 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 2.436e-26
Identity = 92/337 (27.30%), Postives = 153/337 (45.40%), Query Frame = 1
Query:  148 EQENEKSSCFTSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATP-PPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNT-GSSEECEEVNDH 1152
            EQ+ E+          +++L     R +      YN T        +L  F +   TLG  P+         D    W    SIF+C T+ TTIGYGNIVP T WGR   I+YAFIGIPL +L L   G + A   + ++      R F+K            ++  + ++ N   E A+N+       TP   K  + D D++            + P++ ++   +I++   A++F   E WD   ++YF+ I+ +TIGFGD+ P+             IVG V  +IGL+++S  + L++++I    S + + +    +     + E  EV++H
Sbjct:   53 EQQKERDELIRRTVYKINQLQIKRQRRLMTAEEEYNRTA------KVLTTFQE---TLGIVPA-------DMDKDIHWTFLGSIFYCMTVYTTIGYGNIVPGTGWGRFATILYAFIGIPLTVLSLYCLGSLFAKGCKMLW------RFFLKS-----------TRVVSKDLSNKISEAADNIEEGTTAITPSAEKTENNDDDLL------------SFPISGLLLITVIWVIFCAVLFTFLEEWDFGTSLYFTLISFTTIGFGDILPSDYDFMP-------IVG-VLLLIGLSLVSTVMTLIQQQIEALASGMKDNIDQEYARALNEAREDGEVDEH 336          
BLAST of kcnka vs. UniProt/SwissProt
Match: sp|P34410|TWK7_CAEEL (TWiK family of potassium channels protein 7 OS=Caenorhabditis elegans OX=6239 GN=twk-7 PE=3 SV=3)

HSP 1 Score: 109.768 bits (273), Expect = 1.407e-24
Identity = 75/244 (30.74%), Postives = 126/244 (51.64%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKS 1110
            W  ++SIFF  T++TTIGYGN VP T  GRI CI+++ +GIPL L+ +++ G+ L+    ++Y N      ++K KY  +S      +R  +          E+ +S+          +  D++I          E   IP  +V+  LI+Y   G ++    E W    + Y+SFIT++T+GFGDL P ++          + +  +Y I+GLAI +MC++LV  + + K  + G K+   +S
Sbjct:  265 WTFSSSIFFAVTVVTTIGYGNPVPVTNIGRIWCILFSLLGIPLTLVTIADLGKFLSEHLVWLYGN------YLKLKYLILSRHRK-ERREHV---------CEHCHSHG---------MGHDMNI----------EEKRIPAFLVLAILIVYTAFGGVLMSKLEPWSFFTSFYWSFITMTTVGFGDLMPRRDGY--------MYIILLYIILGLAITTMCIDLVGVQYIRKIHYFGRKIQDARS 465          
BLAST of kcnka vs. UniProt/SwissProt
Match: sp|Q23435|TWK9_CAEEL (TWiK family of potassium channels protein 9 OS=Caenorhabditis elegans OX=6239 GN=twk-9 PE=2 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 1.871e-17
Identity = 75/271 (27.68%), Postives = 121/271 (44.65%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFV---------------KGKYTSI--------------SEFESMSKRSAIEI-KNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLII-YMFLGALIFQIWET-WDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKL 1095
            W++ NS+ F  T+ITTIGYG++ P T  GR+  I Y  IG+P  LL +++ G  L    RF+   L   R F                K + TS                E + MS R+A E  +  E+E  EN N    K                 ++E + +E      ++ +G     Y+  GA I  ++E   D   A+YF+F+T++TIG GD  P             L++  +Y  IGLA+ +M + +   ++++K  ++G K+
Sbjct:  161 WSIGNSVIFAFTVITTIGYGHVAPETFEGRLFLIFYGVIGVPFTLLTIADLGMFLT---RFLKNLLTMARRFAHYLVKLYQKAKKQRNKSQKTSPVMPDSERSEVWNTGKEMKEMSMRTAREPGEGDEIEVIENGNDENGKEE--------------DEEEPENNEPRKTEESIALGITFTCYLVAGAKILSVYEPEMDFFKALYFNFVTLTTIGLGDFVPKSFDY--------LLITLIYIGIGLALTTMAIEIAA-DLLKKLHYIGRKM 405          
BLAST of kcnka vs. UniProt/SwissProt
Match: sp|Q22271|UNC58_CAEEL (Uncoordinated protein 58 OS=Caenorhabditis elegans OX=6239 GN=unc-58 PE=1 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 4.813e-17
Identity = 68/269 (25.28%), Postives = 130/269 (48.33%), Query Frame = 1
Query:  352 IGQPDNLS----AWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWE-TWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNTGSSEECEEV 1143
            + +PD+LS     W    +I +  T++TT GYG +   T  G++  + +A +GIPLM +  ++ G+ L+                      ++ +F S   RS  ++K + +    +     +++T  P   ++ LDI+ V   +  +E +  P+   +  + IY  +G+ +F  WE TW  + A +F F  + T+G GD+      + +    L LIV   + I+GL++++MC++L    +   F+ + +  G  K   G SEE +E+
Sbjct:  275 LNRPDDLSNMHNKWTFPTAILYVLTVLTTCGYGEVSVDTDVGKVFSVAFALVGIPLMFITAADIGKFLSE---------------------TLLQFVSFWNRSVRKVKQW-MSRIRHGRRKSLQSTGGP---NDTLDILGV---DGTEEKLWFPIGAYVSCICIYCSIGSAMFITWERTWSFIHAFHFGFNLIVTVGLGDI------VVTDYIFLSLIVA--FVIVGLSVVTMCVDLASTHLKAYFTRI-HYFGRAKRFLGMSEELKEI 506          
BLAST of kcnka vs. UniProt/SwissProt
Match: sp|Q96T55|KCNKG_HUMAN (Potassium channel subfamily K member 16 OS=Homo sapiens OX=9606 GN=KCNK16 PE=1 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.389e-16
Identity = 65/243 (26.75%), Postives = 106/243 (43.62%), Query Frame = 1
Query:  307 EVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLY----PAKNTIGSSVATLELIVGAVYCIIGLA 1023
            E +  G +P  + T      N S W+  +S FF  T++TTIGYGN+ PST  G++ C+ YA +GIPL ++FL++ G  L                  +    +I  +E   +RS +                              L ++ +             L + +G L+I +F   ++F   E W      YF+FIT+STIGFGD      P+K+ I     ++   + A++ ++GLA
Sbjct:   75 EAWVKGVNPKGNST------NPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEAGQVFCVFYALLGIPLNVIFLNHLGTGL------------------RAHLAAIERWEDRPRRSQV------------------------------LQVLGLA------------LFLTLGTLVILIF-PPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYI-----SVYRSLAAIWILLGLA 245          
BLAST of kcnka vs. TrEMBL
Match: A0A0A1CVW0 (Kcnka (Fragment) OS=Schmidtea mediterranea OX=79327 GN=kcnka PE=2 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 8.246e-122
Identity = 200/200 (100.00%), Postives = 200/200 (100.00%), Query Frame = 1
Query:   58 YILLGLLSHXXXXXXXXXXXXXXXXXXXXXEQENEKSSCFTSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIE 657
            YILLGLLSHFGTLFIIILYLIGGGFLFALLEQENEKSSCFTSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIE
Sbjct:    1 YILLGLLSHFGTLFIIILYLIGGGFLFALLEQENEKSSCFTSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIE 200          
BLAST of kcnka vs. TrEMBL
Match: A0A1I8IZX5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 1.784e-82
Identity = 149/320 (46.56%), Postives = 208/320 (65.00%), Query Frame = 1
Query:  148 EQENEKSSCFTSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWET-WDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVAT-LELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGI 1101
            E+ NEKS+C  +Y     K N+ T R  +I   G N+++    + S L  F+K++YTL   P+K+C+TIG  DN + W LAN+I+FC TI+TTIGYG+I P+T WG+I+C+IYA +GIPLMLLFL+  GE  A  FR  Y N+CCC+CFVK ++ +         +SA E +  E  N E+      K  PPPK     +     +D++  DE++NIP+TV I  LI+Y+ +GA +F  WE  W LV   YFSFIT+STIGFGD  P +N     V+  +EL+VGA+YC+ GLA+LSMC+NL+++EI  K  W+GNK+GI
Sbjct:  349 EETNEKSACSIAYSKYEAKRNEATDRVYNIAQ-GANSSLSKSAILSQLEVFAKDIYTLSVDPTKNCSTIGTVDNPANWVLANAIYFCTTIVTTIGYGHISPTTQWGQIICMIYAILGIPLMLLFLTKIGEPTAMLFRSFYLNICCCKCFVKRRHPA---------QSAGEQQQTEWRNVEDGGDGQAK-QPPPKVGTVLVVEEDDNDDDFDDEVVNIPITVTIMLLILYILVGAAVFTAWEKDWTLVEGTYFSFITLSTIGFGDYVPGRNGPFDDVSVIMELLVGAIYCLFGLAMLSMCMNLIQDEITAKLRWIGNKMGI 657          

HSP 2 Score: 137.887 bits (346), Expect = 2.264e-31
Identity = 95/267 (35.58%), Postives = 148/267 (55.43%), Query Frame = 1
Query:  322 GFSPSKDCTTI----GQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATL-ELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVK 1107
            GF    D   +    G PD+ +    A S   C        +G+I+ S +   ++ I Y  +G   +  +L   GE  A  F+  Y N+CCC+CF+K K       E         I+  + + +    ++     PP K  D  +     ++++++++I+NIP++V I  LI+Y+ LGA +F+IWE W L+   YFSFIT+STIGFGD  P K+   +S+  + EL+VGA+YC  GL +LSMC+NL+++EI  KF W+G KLG+VK
Sbjct:   49 GFDVETDTAAVVKHNGAPDSSAKAQDAASQSKCRKCCKR--FGSIMLSQLGTFVIVIFYVVMG-GFLFQYL-EIGEPTAMLFKAFYLNICCCKCFIKRKCPEEKAVEE-------SIREQQRQQSSWTTADESGKMPPAKVKDLVVVEEDDEEDDEEEDIVNIPISVTILLLILYILLGAAVFRIWEKWTLIEGTYFSFITLSTIGFGDYVPGKDGPFNSMTVITELLVGALYCFFGLTVLSMCINLIQDEISAKFHWIGLKLGMVK 304          
BLAST of kcnka vs. TrEMBL
Match: A0A1I8HPD6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 1.883e-82
Identity = 149/320 (46.56%), Postives = 208/320 (65.00%), Query Frame = 1
Query:  148 EQENEKSSCFTSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWET-WDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVAT-LELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGI 1101
            E+ NEKS+C  +Y     K N+ T R  +I   G N+++    + S L  F+K++YTL   P+K+C+TIG  DN + W LAN+I+FC TI+TTIGYG+I P+T WG+I+C+IYA +GIPLMLLFL+  GE  A  FR  Y N+CCC+CFVK ++ +         +SA E +  E  N E+      K  PPPK     +     +D++  DE++NIP+TV I  LI+Y+ +GA +F  WE  W LV   YFSFIT+STIGFGD  P +N     V+  +EL+VGA+YC+ GLA+LSMC+NL+++EI  K  W+GNK+GI
Sbjct:  383 EETNEKSACSIAYSKYEAKRNEATDRVYNIAQ-GANSSLSKSAILSQLEVFAKDIYTLSVDPTKNCSTIGTVDNPANWVLANAIYFCTTIVTTIGYGHISPTTQWGQIICMIYAILGIPLMLLFLTKIGEPTAMLFRSFYLNICCCKCFVKRRHPA---------QSAGEQQQTEWRNVEDGGDGQAK-QPPPKVGTVLVVEEDDNDDDFDDEVVNIPITVTIMLLILYILVGAAVFTAWEKDWTLVEGTYFSFITLSTIGFGDYVPGRNGPFDDVSVIMELLVGAIYCLFGLAMLSMCMNLIQDEITAKLRWIGNKMGI 691          

HSP 2 Score: 134.806 bits (338), Expect = 2.863e-30
Identity = 82/205 (40.00%), Postives = 125/205 (60.98%), Query Frame = 1
Query:  532 GEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATL-ELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKS-NTGSSEECEE 1140
            GE  A  F+  Y N+CCC+CF+K K       E         I+  + + +    ++     PP K  D  +     ++++++++I+NIP++V I  LI+Y+ LGA +F+IWE W L+   YFSFIT+STIGFGD  P K+   +S+  + EL+VGA+YC  GL +LSMC+NL+++EI  KF W+G KLG+VK     S +E E+
Sbjct:  155 GEPTAMLFKAFYLNICCCKCFIKRKCPEEKAVEE-------SIREQQRQQSSWTTADESGKMPPAKVKDLVVVEEDDEEDDEEEDIVNIPISVTILLLILYILLGAAVFRIWEKWTLIEGTYFSFITLSTIGFGDYVPGKDGPFNSMTVITELLVGALYCFFGLTVLSMCINLIQDEISAKFHWIGLKLGMVKRVEQPSDDESED 352          
BLAST of kcnka vs. TrEMBL
Match: A0A5K3FSV1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 4.094e-81
Identity = 133/338 (39.35%), Postives = 198/338 (58.58%), Query Frame = 1
Query:  148 EQENEKSSCFTSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKR--SAIEIKNFELENAENLNSNPVKATPPPKFI--------DEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWET-WDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNTGSSE 1128
            EQ NE  +C+ +Y   +D+LN +  R   I  SG +      Q+ + +  F++ ++ L F PSK+C+ I    + S WNL N+++FCAT++TTIGYG+I P+T WGR+VC+ Y  +GIPL+L++L + G++LA  FRF Y N+CCCRCF   + T I +      R     E     +E    L+  P+   PPP F         DED +I  +  E  + E   IP+TVV+  +  Y+ +GA  F+IWE  W  + + YF+ IT+STIGFGDL+P K  +       EL+  A+YC+ GLA+LSMC  L+K+E + K  W+G  L I+ SN G+ +
Sbjct:    6 EQGNEVHACYLTYNKYLDQLNTSVLRATGIAASGLSKDEVATQLQNAMIEFAEALFALDFQPSKNCSLIHSTSHGSQWNLVNALYFCATVVTTIGYGHIAPTTQWGRLVCVFYCLLGIPLLLIYLGSIGQLLAYLFRFTYRNICCCRCF---RDTLIRQRNRRHMRLIRLQEDLRRHMEVQAKLSGEPI---PPPSFAPIALIEDSDEDDEIREIYLEFQETEEAGIPITVVMLVITAYVTMGAFTFRIWEKDWSPIDSAYFAVITISTIGFGDLFPGKGRLDQPDTIYELLTSALYCVFGLALLSMCFELMKDEFIAKIRWIGQSLRILGSNRGNQD 337          
BLAST of kcnka vs. TrEMBL
Match: A0A0R3U9N2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS3631 PE=3 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 3.751e-80
Identity = 133/338 (39.35%), Postives = 198/338 (58.58%), Query Frame = 1
Query:  148 EQENEKSSCFTSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKR--SAIEIKNFELENAENLNSNPVKATPPPKFI--------DEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWET-WDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNTGSSE 1128
            EQ NE  +C+ +Y   +D+LN +  R   I  SG +      Q+ + +  F++ ++ L F PSK+C+ I    + S WNL N+++FCAT++TTIGYG+I P+T WGR+VC+ Y  +GIPL+L++L + G++LA  FRF Y N+CCCRCF   + T I +      R     E     +E    L+  P+   PPP F         DED +I  +  E  + E   IP+TVV+  +  Y+ +GA  F+IWE  W  + + YF+ IT+STIGFGDL+P K  +       EL+  A+YC+ GLA+LSMC  L+K+E + K  W+G  L I+ SN G+ +
Sbjct:   76 EQGNEVHACYLTYNKYLDQLNTSVLRATGIAASGLSKDEVATQLQNAMIEFAEALFALDFQPSKNCSLIHSTSHGSQWNLVNALYFCATVVTTIGYGHIAPTTQWGRLVCVFYCLLGIPLLLIYLGSIGQLLAYLFRFTYRNICCCRCF---RDTLIRQRNRRHMRLIRLQEDLRRHMEVQAKLSGEPI---PPPSFAPIALIEDSDEDDEIREIYLEFQETEEAGIPITVVMLVITAYVTMGAFTFRIWEKDWSPIDSAYFAVITISTIGFGDLFPGKGRLDQPDTIYELLTSALYCVFGLALLSMCFELMKDEFIAKIRWIGQSLRILGSNRGNQD 407          
BLAST of kcnka vs. Ensembl Cavefish
Match: ENSAMXT00000047723.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:15897283:15919205:1 gene:ENSAMXG00000033807.1 transcript:ENSAMXT00000047723.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 4.404e-21
Identity = 82/274 (29.93%), Postives = 123/274 (44.89%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNL--CCCRCFVK----------------GKY----TSISEFESMSKR-------SAIEIKNFELENAENL-----------NSNPVKAT---------PPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDL--VAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNL 1047
            W+   S+FFC T+ TT+GYG I P T  GR+ CI+YA +GIPLMLL +++ G++LA  F   Y  L   C R   +                G Y      + +  S+  R       S IE K   L   +N+              P+  +         PPP    +  D + +  E ++  +   P  V++  +  Y+ + ALI  IWE  DL    A YF FIT++TIGFGD+ P              ++  ++ I+G+AI+SM   L
Sbjct:  223 WHFYGSLFFCCTVFTTVGYGEIYPVTKAGRVACILYATVGIPLMLLVITDVGDILAVLFSNSYRRLHSSCRRLLYRVWNPHQKPRDPVTIRDGTYIFNRDVVVQEVSVDHRIGTAIDSSVIEQKPDHLLKNKNIFNHIIAKEKFRRKRPLTRSCSCPELNQMPPPPVGFKIKDFLSIGHEMERFNV---PFLVILLVVFAYILIWALILPIWED-DLGKFDAFYFCFITLTTIGFGDIVPKHPKF--------FMLTFLFIIMGMAIMSMAFKL 484          
BLAST of kcnka vs. Ensembl Cavefish
Match: kcnk10a (potassium channel subfamily K member 10-like [Source:NCBI gene;Acc:103032675])

HSP 1 Score: 93.2041 bits (230), Expect = 5.217e-20
Identity = 67/216 (31.02%), Postives = 99/216 (45.83%), Query Frame = 1
Query:  289 LFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGD 936
            L   S + ++ G SP  D T      N S W+L ++ FF  T+ITTIGYGNI PST  G+I CI+YA  GIPL    L+  G+ L +              FVK    +I++ E + +R   +I   ++  A  L                                    L +++G  I+++ + ALIFQ  E W  + A+YF  IT++T+G GD
Sbjct:  145 LIQHSIDAFSAGVSPIGDTTY-----NFSYWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYAIFGIPLFGFLLAGVGDQLGT-------------IFVK----TIAKVEKIFRRKHNQISQTKIRVASTL------------------------------------LFILVG-CIVFVTIPALIFQHIEGWTGLDAIYFVVITLTTVGIGD 301          
BLAST of kcnka vs. Ensembl Cavefish
Match: kcnk4a (potassium channel subfamily K member 4 [Source:NCBI gene;Acc:103042783])

HSP 1 Score: 87.8113 bits (216), Expect = 2.771e-18
Identity = 80/288 (27.78%), Postives = 128/288 (44.44%), Query Frame = 1
Query:  373 SAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNTGSSEECEEVNDHQSNSRIIIEN--SDFQNSV-MHVNEAYE 1227
            S W+L+N+ FFC TIITTIG+GN+ P T  G++ CI YA +GIP+       FG +LA     + T L                     +R+  +I+   L+     +   + A                              +++IG LI ++ L  L+FQ  E W L+ A YF  IT++T+GFGD Y A N    S     L+   ++ + GLA  +  L ++           GN L ++   T +  E EE+  H ++    I+N   DF+  V + +N+ ++
Sbjct:   83 SRWDLSNAFFFCGTIITTIGFGNLSPKTQGGQLFCIFYALVGIPM-------FGILLAGVGDHLGTIL---------------------RRAVAKIEGLFLKRVSATSVRVISAV----------------------------FSILIGCLI-FIALPTLVFQEVEKWTLLEAGYFVVITLTTVGFGD-YVADNRRNGSPLYKPLVW--LWIVFGLAYFASILTMI-----------GNWLRVLSKKTRA--EMEELRAHATDWTQNIQNMSMDFRIPVPLDLNDPFQ 297          
BLAST of kcnka vs. Ensembl Cavefish
Match: kcnk15 (potassium channel subfamily K member 15-like [Source:NCBI gene;Acc:103042097])

HSP 1 Score: 86.2705 bits (212), Expect = 5.587e-18
Identity = 60/226 (26.55%), Postives = 92/226 (40.71%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFL--IIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLV 1050
            W  A S +F  T+ITTIGYG+  P T  G++ C+ YA +GIPL L+   + GE + +  RF+      C  F               +R+ + ++N  L                                              IGFL  +  + +GA  F  +E W    A Y+ FIT++TIGFGD    +        T  ++   +Y ++GL ++   LNLV
Sbjct:   78 WKFAGSFYFAITVITTIGYGHAAPGTDAGKVFCMFYAVLGIPLTLVMFQSLGERMNTFVRFLLHRTKQCLGF---------------RRTEVSMENMVL----------------------------------------------IGFLSCLGTLCVGAAAFSHFEGWTFFHAYYYCFITLTTIGFGDFVALQKNEDLQEKTPYVVFSFMYILVGLTVIGAFLNLV 242          
BLAST of kcnka vs. Ensembl Cavefish
Match: KCNK16 (potassium channel subfamily K member 16 [Source:NCBI gene;Acc:103040539])

HSP 1 Score: 78.9518 bits (193), Expect = 5.396e-16
Identity = 78/273 (28.57%), Postives = 113/273 (41.39%), Query Frame = 1
Query:  322 GFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFL---IIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNTGSSEE 1131
            G +PS + T      N S W+  +S FF  T++TTIGYGN+ P+T  G++ C+ YA  GIPL L FL+                L  C  F  G+                            L  N V    P K I + +++                L VV+  L   ++++    +IF   E W      Y++FIT+STIGFGD          +V+    +  AV+ I  LA L++ LN+    IVE F      LG+ K    + EE
Sbjct:   80 GVNPSGNST------NPSNWDFGSSFFFAGTVVTTIGYGNLSPATFQGQVFCVFYALCGIPLNLAFLN---------------QLSKCLAFHLGR----------------------------LEHNMVSMV-PRKSIHQCMEV----------------LAVVVFLLMGSVLFLIFPPIIFSYVEGWSYGEGFYYAFITLSTIGFGDFVVGNGQDRQNVSVYRSLT-AVWIIFALAWLALLLNM-GARIVEHF------LGLRKPPVSTDEE 278          
BLAST of kcnka vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003416.1 (pep scaffold:Pmarinus_7.0:GL476517:78247:80718:1 gene:ENSPMAG00000003129.1 transcript:ENSPMAT00000003416.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 6.684e-29
Identity = 68/205 (33.17%), Postives = 108/205 (52.68%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTN-----LCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSN-PVKAT----------PPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYP 945
            WN   S+FFC TI TTIGYG+I PST  G+I+C++YA  GIP+MLL L++ G++LA     +YT+     L   RC  +       E   + +RS  +I +      E+   + P+K+           P    I E  D   V + + + + +++P T++   + +Y+  G  +   WE W  + A YF F+T++TIG GD+ P
Sbjct:    2 WNFLGSLFFCCTIFTTIGYGHIAPSTDGGKIMCMVYATFGIPIMLLVLADVGDLLARTLTTIYTSFRHRLLPGARCGRQHPPGDGPEGNDL-QRSRTKIDDSHRHEGEDDAVDVPLKSPGSDVEGGRELPATVSIAEGAD---VPEADREVKELDVPFTLIFLIVFVYLMFGTFLLPCWEEWSYLDAFYFVFVTMTTIGLGDIVP 202          
BLAST of kcnka vs. Ensembl Sea Lamprey
Match: KCNK10 (potassium two pore domain channel subfamily K member 10 [Source:HGNC Symbol;Acc:HGNC:6273])

HSP 1 Score: 72.7886 bits (177), Expect = 1.577e-14
Identity = 37/95 (38.95%), Postives = 53/95 (55.79%), Query Frame = 1
Query:  271 QQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAF 555
             +M S L    K+  + G  P  + T      + S W+L ++ FF  T++TTIGYGN+ PST WGRI C  YA +GIP+    L+  G+ L + F
Sbjct:   71 HEMMS-LIQHVKDAISAGVDPLANNTN----HSSSLWDLGSAFFFAGTVLTTIGYGNVSPSTDWGRIFCTAYALVGIPIFGFLLAGVGDQLGTIF 160          
BLAST of kcnka vs. Ensembl Sea Lamprey
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 65.0846 bits (157), Expect = 2.913e-12
Identity = 27/65 (41.54%), Postives = 40/65 (61.54%), Query Frame = 1
Query:  355 GQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLAS 549
            GQ  + S W+ ++++ F  T++TTIGYG+  P + WGR  C  YA +GIPL L  LS     +A+
Sbjct:   87 GQASSPSNWDFSSALLFTVTVVTTIGYGSTAPGSTWGRASCAFYALLGIPLNLQLLSRGAPTVAA 151          
BLAST of kcnka vs. Ensembl Sea Lamprey
Match: KCNK16 (potassium two pore domain channel subfamily K member 16 [Source:HGNC Symbol;Acc:HGNC:14464])

HSP 1 Score: 65.4698 bits (158), Expect = 3.381e-12
Identity = 27/65 (41.54%), Postives = 40/65 (61.54%), Query Frame = 1
Query:  355 GQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLAS 549
            GQ  + S W+ ++++ F  T++TTIGYG+  P + WGR  C  YA +GIPL L  LS     +A+
Sbjct:   77 GQASSPSNWDFSSALLFTVTVVTTIGYGSTAPGSTWGRASCAFYALLGIPLNLQLLSRGAPTVAA 141          
BLAST of kcnka vs. Ensembl Sea Lamprey
Match: kcnk7 (potassium channel, subfamily K, member 7 [Source:ZFIN;Acc:ZDB-GENE-110304-2])

HSP 1 Score: 58.9214 bits (141), Expect = 4.999e-10
Identity = 23/55 (41.82%), Postives = 40/55 (72.73%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVL 543
            W+  +++FF +T++TT+GYG+ VP +  G+ +CI+YA +GIP  LL L++  + L
Sbjct:   88 WDFVSALFFASTVLTTVGYGHTVPLSDAGKALCILYAVLGIPFTLLLLTSIVQRL 142          
BLAST of kcnka vs. Ensembl Yeast
Match: TOK1 (Outward-rectifier potassium channel of the plasma membrane; has two pore domains in tandem, each of which forms a functional channel permeable to potassium; carboxy tail functions to prevent inner gate closures; target of K1 toxin [Source:SGD;Acc:S000003629])

HSP 1 Score: 63.5438 bits (153), Expect = 3.050e-11
Identity = 43/186 (23.12%), Postives = 83/186 (44.62%), Query Frame = 1
Query:  388 ANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYP 945
             N+++FC   + T+G G+I+P +V  +I+ +I++  G+ LM L +                     R  ++     I  F  + K  +   K++ +++++NL+              E  D++    +    +     L+V I   + +  LGAL+F+  E W     +YF F+ + TIG+GD  P
Sbjct:  275 GNALYFCTVSLLTVGLGDILPKSVGAKIMVLIFSLSGVVLMGLIV------------------FMTRSIIQKSSGPIFFFHRVEKGRSKSWKHY-MDSSKNLSER------------EAFDLMKCIRQTASRKQHWFSLSVTIAIFMAFWLLGALVFKFAENWSYFNCIYFCFLCLLTIGYGDYAP 429          

HSP 2 Score: 48.1358 bits (113), Expect = 2.046e-6
Identity = 23/55 (41.82%), Postives = 32/55 (58.18%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVL 543
            W+  N I+FC   + TIGYG+  P T  GR   +I+A   +PLM   LS  G++L
Sbjct:  406 WSYFNCIYFCFLCLLTIGYGDYAPRTGAGRAFFVIWALGAVPLMGAILSTVGDLL 460          
BLAST of kcnka vs. Ensembl Nematostella
Match: EDO33193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSX6])

HSP 1 Score: 87.0409 bits (214), Expect = 1.962e-19
Identity = 68/228 (29.82%), Postives = 99/228 (43.42%), Query Frame = 1
Query:  367 NLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFL--IIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLN 1044
            NL  W+ A S++F  T+ITTIGYG+ VP T  G+I C+IYA +GIPL L    + GE      RF  T L C                 M +R         L+    + +  V +T                            L VV G L  +I +  GA IF  +E WD   ++Y+ FITV+TIGFGD    +++     +   + +  ++   GL I+   +N
Sbjct:   75 NLYQWSFAGSVYFATTVITTIGYGHTVPRTPRGKIFCMIYAAVGIPLALTMFQSIGE------RF-NTFLAC-----------------MFRR---------LKRKLGMKATDVSSTTN--------------------------LVVVCGLLAMVITVSSGAFIFTHYEKWDYFHSLYYCFITVTTIGFGDYVALQDSKDERYSNKYVGISLLFIFFGLTIVGSVMN 243          
BLAST of kcnka vs. Ensembl Nematostella
Match: EDO43464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYH6])

HSP 1 Score: 86.6557 bits (213), Expect = 1.342e-18
Identity = 60/189 (31.75%), Postives = 88/189 (46.56%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYP 945
            WN+ NSI+FC T+ TTIGYG++ P TV GR++C+IYA +GIPL L  L+  G+++       Y N  C           +  F  +         ++E    EN+N N        +  D  +D                PL + +  L I+  + A +    E WD   + YF F+T  TIGFGD+ P
Sbjct:  150 WNILNSIYFCMTVTTTIGYGSLAPVTVPGRVICVIYALLGIPLTLALLAVVGKIVGD-----YINDTCALV--------LKWFRHL-------YPDYEY---ENMNQN-------QELGDGQID---------------APLWLGLLILFIFTTITAGLCCWMEGWDFGTSFYFQFVTYLTIGFGDVVP 293          
BLAST of kcnka vs. Ensembl Nematostella
Match: EDO48564 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIT3])

HSP 1 Score: 82.0333 bits (201), Expect = 2.211e-17
Identity = 69/247 (27.94%), Postives = 111/247 (44.94%), Query Frame = 1
Query:  205 LNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYP 945
            LN   +  +   ++ +N  + Y++ ++   N   + Y  G   S+      +PD +  W+LA+S  F  T+ TT+GYGNI P T+ GR+ C++Y  +GIPL       F  V  S   FV   +      +  +Y      ES    +A+  K+  +   E          P P+    ++ + +V               VV G+L I    GA++F I E W L  + Y+ FIT+ST+G GD  P
Sbjct:   73 LNREDFLQLIWQDNNHNDALTYEE-WAKQANEKLDEYEAGIRKSEQ----SEPDPVVNWSLADSWLFACTVFTTVGYGNIAPLTIKGRVFCMLYGAVGIPL-------FSVVAGSLASFVTEIIHA----LHKEYHRRKRHES----AAMHKKDDVIAPDE----------PVPEL---EIKLKHVA-------------VVVAGYLCI----GAVLFCICEGWSLFESFYYCFITLSTVGLGDYVP 269          
BLAST of kcnka vs. Ensembl Nematostella
Match: EDO35923 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SK42])

HSP 1 Score: 73.559 bits (179), Expect = 5.125e-15
Identity = 30/57 (52.63%), Postives = 39/57 (68.42%), Query Frame = 1
Query:  367 NLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGE 537
            N   W+ A S+FF  T++TTIGYG + P+TVWGR+ CI YA  GIP+  L L + GE
Sbjct:   63 NYDRWSFAGSLFFTGTVVTTIGYGQMAPATVWGRVFCIFYAIFGIPITGLMLKSIGE 119          
BLAST of kcnka vs. Ensembl Nematostella
Match: EDO30949 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZB8])

HSP 1 Score: 74.3294 bits (181), Expect = 9.241e-15
Identity = 69/270 (25.56%), Postives = 122/270 (45.19%), Query Frame = 1
Query:  271 QQMYSMLFNFSKEVYTLGFSPSKDCTTIGQ----PDNLSAWN-LANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAF-RFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAV--YCIIGLAILSMCLNLVKE 1056
            QQ  S LF+  +  Y +     ++ T+I      P+N + W+   N+I F   + TT+GYG++ P++   R + ++ A  GIPLML+ LS+FGE+  +A  +F+         F+          ++M  R+       E  + E    N   A P  +                        +T ++  L++++ +G LI +    W    + Y+ FIT +TIGFGD Y  +   G    T  ++  AV  Y ++GL+I++   ++  E
Sbjct:   41 QQNLSNLFDHMRAKYNMTSQEFENFTSIAHATLSPNNKAKWSYFRNAIRFMVALCTTVGYGDLTPTSTLSRALTMLIALFGIPLMLMTLSSFGELFTTAMDKFI--------IFLD---------KTMLPRATSPEGGGE-TSPEGGGENSKWAAPLKR------------------------MTGILLVLVMFIQIGILITKTLTPWSYEESFYYWFITFTTIGFGD-YIIERDQGDWDLTYRVMSIAVVIYMLVGLSIMTSAFSVAIE 267          
BLAST of kcnka vs. Ensembl Medaka
Match: kcnk5a (potassium two pore domain channel subfamily K member 5 [Source:NCBI gene;Acc:101161107])

HSP 1 Score: 85.8853 bits (211), Expect = 1.316e-17
Identity = 66/240 (27.50%), Postives = 99/240 (41.25%), Query Frame = 1
Query:  349 TIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVE 1068
            TI      + WN  N++ F AT+ITTIGYGNI P T  GR+ CI Y   G+PL L ++S  G+                  F  G+   + ++  ++KR       F L  A+                                      + ++ G L+ ++ L   +F   E W  +  +YFSF+T++TIGFGDL  A         TL      V+  +GLA LS+  N     ++E
Sbjct:   73 TITGSKTFNNWNWPNAVIFAATVITTIGYGNIAPKTSSGRVFCIFYGLFGVPLCLTWISELGK------------------FFGGRAKHLGQY--LTKRG------FSLRKAQ---------------------------------FTCTAIFLLWGVLV-HLVLPPFVFMSQEGWTYIEGLYFSFVTLTTIGFGDLV-AGVEPNKEYPTLYRYFVEVWIYLGLAWLSLFFNWKVRMVIE 251          
BLAST of kcnka vs. Ensembl Medaka
Match: kcnk10a (potassium channel subfamily K member 10 [Source:NCBI gene;Acc:101171299])

HSP 1 Score: 85.1149 bits (209), Expect = 2.435e-17
Identity = 64/222 (28.83%), Postives = 98/222 (44.14%), Query Frame = 1
Query:  271 QQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGD 936
            Q+    +   S E    G +P  D +      N S W+L ++ FF  T+ITTIGYGNI PST  G+I CI+Y+  GIPL    L+  G+ L +              FVK    SI++ E M + +  +I   ++  A  L                                    L +++G  I+++ + A+IF+  E W  + + YF  IT++TIG GD
Sbjct:  102 QEELEAIIKHSVEAVNAGVNPVGDTSY-----NSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYSIFGIPLFGFLLAGVGDQLGT-------------IFVK----SIAKVEKMFRNNHNQISQTKIRVASTL------------------------------------LFILVG-CILFVTIPAVIFKHIEGWTCLDSTYFVVITLTTIGIGD 264          
BLAST of kcnka vs. Ensembl Medaka
Match: kcnk10a (potassium channel subfamily K member 10 [Source:NCBI gene;Acc:101171299])

HSP 1 Score: 85.1149 bits (209), Expect = 2.508e-17
Identity = 64/222 (28.83%), Postives = 98/222 (44.14%), Query Frame = 1
Query:  271 QQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGD 936
            Q+    +   S E    G +P  D +      N S W+L ++ FF  T+ITTIGYGNI PST  G+I CI+Y+  GIPL    L+  G+ L +              FVK    SI++ E M + +  +I   ++  A  L                                    L +++G  I+++ + A+IF+  E W  + + YF  IT++TIG GD
Sbjct:  139 QEELEAIIKHSVEAVNAGVNPVGDTSY-----NSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILYSIFGIPLFGFLLAGVGDQLGT-------------IFVK----SIAKVEKMFRNNHNQISQTKIRVASTL------------------------------------LFILVG-CILFVTIPAVIFKHIEGWTCLDSTYFVVITLTTIGIGD 301          
BLAST of kcnka vs. Ensembl Medaka
Match: kcnk4a (uncharacterized LOC101171752 [Source:NCBI gene;Acc:101171752])

HSP 1 Score: 74.7146 bits (182), Expect = 5.523e-14
Identity = 65/268 (24.25%), Postives = 119/268 (44.40%), Query Frame = 1
Query:  361 PDNLSA-WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNTGSSEECEEVNDHQSN 1161
            P NLS  W++A++ FFC TIITTIG+GN+ P T +G++ C+ YA       L+ +  FG +LA     + T L            ++++ E++  +  +      + +A                                       L+++IG LI ++ +  ++FQ  E W  + ++YF  IT++T+GFGD  P     G ++    ++   ++ + GLA  +  L ++           GN L ++   T +  E EE+  H ++
Sbjct:   79 PANLSTRWDMASAFFFCGTIITTIGFGNLSPRTWFGQLFCVCYA-------LVGIPMFGILLAGVGDHMGTVL----------RKAVAKIETLFLKRKVRPTTVRVISAV--------------------------------------LSILIGCLI-FLAVPTVVFQKVERWSFLESLYFVVITLTTVGFGDYVPGGANEGGNIFKPLVL---LWIVFGLAYFASILTMI-----------GNWLRVLSKKTRA--EMEELRAHATD 274          
BLAST of kcnka vs. Ensembl Medaka
Match: kcnk18 (potassium two pore domain channel subfamily K member 18 [Source:NCBI gene;Acc:101159039])

HSP 1 Score: 73.1738 bits (178), Expect = 9.354e-14
Identity = 32/62 (51.61%), Postives = 44/62 (70.97%), Query Frame = 1
Query:  361 PDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLA 546
            PDN   W    S+FFC T+ TT+GYG I P T+ G++VC++YA +GIPLMLL + + G+ LA
Sbjct:   98 PDN---WTFFGSMFFCCTVFTTVGYGEIYPVTLSGKVVCVLYAMVGIPLMLLVILDVGDFLA 156          

HSP 2 Score: 51.9878 bits (123), Expect = 5.992e-7
Identity = 44/150 (29.33%), Postives = 71/150 (47.33%), Query Frame = 1
Query:  625 FESMSKRSAIEIKNFELE--NAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWET-WDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIV 1065
            FE +  R  ++ K   L   +   LN  P   TPP  FI  D          D  + +++P  +++  +  Y+ LG LI  +WE  +      YF FIT++TIGFGD+ P              ++ +++ I+G+AI+SM   L +  IV
Sbjct:  238 FEKILARDNLQRKGPLLRTFSCPELNQLP---TPPKGFIVWDF-----TGLGDGMDQLDVPFVLILFAVFAYICLGGLILPLWEKDFTDFDPYYFCFITLTTIGFGDIIPKHPNY--------FMLISLFIIVGMAIMSMAFKLSQTRIV 371          
BLAST of kcnka vs. Planmine SMEST
Match: SMESG000016405.1 (SMESG000016405.1)

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 413/413 (100.00%), Postives = 413/413 (100.00%), Query Frame = 1
Query:   28 MKYTCKQICQYILLGLLSHXXXXXXXXXXXXXXXXXXXXXEQENEKSSCFTSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNTGSSEECEEVNDHQSNSRIIIENSDFQNSVMHVNEAYEKDEILFKTKIKSA 1266
            MKYTCKQICQYILLGLLSHFGTLFIIILYLIGGGFLFALLEQENEKSSCFTSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVDDENDQDEIINIPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNTGSSEECEEVNDHQSNSRIIIENSDFQNSVMHVNEAYEKDEILFKTKIKSA
Sbjct:    1 MKYTCKQICQYILLGLLSHFGTLFIIILYLIGGGFLFALLEQENEKSSCFTSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVDDENDQDEIINIPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNTGSSEECEEVNDHQSNSRIIIENSDFQNSVMHVNEAYEKDEILFKTKIKSA 413          
BLAST of kcnka vs. Planmine SMEST
Match: SMESG000016405.1 (SMESG000016405.1)

HSP 1 Score: 367.466 bits (942), Expect = 2.007e-127
Identity = 198/205 (96.59%), Postives = 200/205 (97.56%), Query Frame = 1
Query:  661 KNFELE---NAENLNSNPVKATPPPKFIDEDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNTGSSEECEEVNDHQSNSRIIIENSDFQNSVMHVNEAYEKDEILFKTKIKSA 1266
            KNF+ +    AENLNSNPVKATPPPKFIDEDLDIVYVDDENDQDEIINIPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNTGSSEECEEVNDHQSNSRIIIENSDFQNSVMHVNEAYEKDEILFKTKIKSA
Sbjct:    5 KNFDKKFFYKAENLNSNPVKATPPPKFIDEDLDIVYVDDENDQDEIINIPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNTGSSEECEEVNDHQSNSRIIIENSDFQNSVMHVNEAYEKDEILFKTKIKSA 209          
BLAST of kcnka vs. Planmine SMEST
Match: SMESG000024430.1 (SMESG000024430.1)

HSP 1 Score: 283.108 bits (723), Expect = 1.090e-91
Identity = 155/365 (42.47%), Postives = 217/365 (59.45%), Query Frame = 1
Query:  148 EQENEKSSCFTSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGFSPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEFESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFID--------EDLDIVYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWET-WDLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKSNTGSSEECEEVNDHQSNSRIIIENSDFQNSVMHVN 1215
            E+ NE   C   Y     KLN++  R ++I  S    +    ++   +  FSK+V+ + + PSK+C+TIGQP NL+ WN+ NSIFFC TIITTIGYGNI P T WG+I  +IY+  GIPLMLLFL+N GE++A+ FRF+Y NLCCCRCF+             S+R  I      +++ EN     ++  PPPK  +        ED + V+V           IP+TVV+  L IY+ +GA +F+IWE  W +V   YFS+IT++TIGFGD  P K+    +    ELIVG +YC++GLAILSMCLNL+++EI  KF WLGNKLG++  +    +E E  +D +  S    +  + Q  +M  N
Sbjct:   49 EENNEILVCKEKYNKYSTKLNESIQRIMAISTSRQENSQIMSELEITMTMFSKDVFKINYEPSKNCSTIGQPGNLAQWNIYNSIFFCVTIITTIGYGNITPLTDWGKINSMIYSIFGIPLMLLFLTNVGEIMATFFRFIYLNLCCCRCFI-------------SRRVEI------VDSTENDKKLNIEGQPPPKINEGNHPDYEIEDDENVFV----------VIPITVVLIVLFIYIIVGACLFRIWEQEWSMVDGTYFSYITLATIGFGDFVPGKDGFEKAETGTELIVGGMYCLLGLAILSMCLNLIQDEIASKFRWLGNKLGLIDDSDYLDKE-ELADDVEPFSYSTSQPQENQMKIMQTN 383          
BLAST of kcnka vs. Planmine SMEST
Match: SMESG000031911.1 (SMESG000031911.1)

HSP 1 Score: 146.362 bits (368), Expect = 4.554e-38
Identity = 86/256 (33.59%), Postives = 140/256 (54.69%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTS------ISEFESMSKRSAIEIK----NFELENAENLNSNPVKATPPPKFIDEDLDI---VYVXXXXXXXXXXXXPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIGFGDLYPAKNTIG-SSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIV 1104
            W  + ++ +  TIITTIGYG+IVP T  GR + I+YA IGIPLMLL L+N G+V+A  F+F+Y    C + ++K +         +    +  KRS  + K    N   EN  ++    +   P        L +    ++D  ++  E +++P+ + +  L +Y+ +GA +F  W+ W    + YF FIT++TIGFGDL P    +G  S    + I  A Y + GLA+ +MC  L++E++ E F  LG ++G++
Sbjct:  360 WTFSGALLYSITIITTIGYGHIVPKTFSGRFLTIVYAIIGIPLMLLCLTNLGKVMADLFKFMY-RFTCFKVYIKSRKRKECKQKLLDSQNNQRKRSGNQNKPEFINILSENPSSILKKEITTKPTMHSFRMSLPLGNANFMDSVHEISEEVDVPIWLPLTILGLYILVGAAVFSYWDGWTFFESCYFVFITLTTIGFGDLVPGNFELGEKSQDQTKSIFCAFYLVTGLAVFAMCFTLIQEKVKEWFEELGKRIGLI 614          
BLAST of kcnka vs. Planmine SMEST
Match: SMESG000019203.1 (SMESG000019203.1)

HSP 1 Score: 142.124 bits (357), Expect = 1.140e-37
Identity = 104/312 (33.33%), Postives = 156/312 (50.00%), Query Frame = 1
Query:  379 WNLANSIFFCATIITTIGYGNIVPSTVWGRIVCIIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLC---CCRCFVKGKYTS---ISEFESMSKRSAIEIK------------NFE-----------------LENA--------ENLNSNPVKATPPPKFIDEDL----------------DIVYVXXXXX----XXXXXXXPLTVVIGFLIIYMFLGALIFQIWETW-DLVAAVYFSFITVSTIGFGDLYPAKNTIGSSVATL----ELIVGAVYCIIGLAILSMCLNLVKEEIVEKFSWLGNKLGIVKS 1110
            W+   SI +  T+ITTIGYG++ P T  GRI  I YA  GIPL +L+L+N G+ LA  FR VY+ LC   C + F K K  +   +     +S  S+I+IK            +FE                 +ENA        ENL +   K+T     I E+L                ++++ D++N      +    +PLT+ +  +++Y+ +GA +F  W +  D +   YF FIT+STIGFGD+ P     G SV+ L    +LIV  +Y  IGL + +MC  L+++EIV K   L  K+GI+K+
Sbjct:  123 WSYEGSILYSVTVITTIGYGHVTPKTKLGRIFTIFYAIFGIPLTILYLNNIGDYLAEIFRLVYSQLCHPLCMKLFTKKKRLTNQLVGHHIRVSDESSIQIKSDFNENLLDTNTDFESISSRKMSHSFTEPLQSIENAKIHCWGDLENLQTKLEKSTETEIQIPENLENEIEAVQSNIDKLPVELIHFDNQNTSYFYTEVSETVPLTLTLCIMVVYIIMGAFLFTFWGSDNDYLKWSYFCFITLSTIGFGDIVP-----GISVSDLNPKEKLIVSVLYVAIGLPVFAMCFKLMEDEIVNKVKSLAKKIGIIKT 429          
The following BLAST results are available for this feature:
BLAST of kcnka vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK166.944e-1827.62potassium two pore domain channel subfamily K memb... [more]
KCNK162.891e-1726.75potassium two pore domain channel subfamily K memb... [more]
KCNK163.424e-1727.62potassium two pore domain channel subfamily K memb... [more]
KCNK163.574e-1726.75potassium two pore domain channel subfamily K memb... [more]
KCNK165.114e-1727.62potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of kcnka vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
twk-485.064e-3831.62TWiK family of potassium channels [Source:UniProt... [more]
twk-288.990e-3228.57TWiK family of potassium channels [Source:UniProt... [more]
twk-181.915e-2727.30TWiK family of potassium channels protein 18 [Sou... [more]
twk-181.915e-2727.30TWiK family of potassium channels protein 18 [Sou... [more]
twk-23.858e-2726.78TWiK family of potassium channels [Source:UniProt... [more]
back to top
BLAST of kcnka vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sand3.131e-3731.66gene:FBgn0033257 transcript:FBtr0088780[more]
CG425944.793e-3032.17gene:FBgn0260971 transcript:FBtr0345704[more]
CG425944.793e-3032.17gene:FBgn0260971 transcript:FBtr0301749[more]
CG425944.832e-3032.05gene:FBgn0260971 transcript:FBtr0345703[more]
CG343965.904e-2730.60gene:FBgn0085425 transcript:FBtr0112645[more]
back to top
BLAST of kcnka vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk187.917e-2428.42potassium channel, subfamily K, member 18 [Source:... [more]
kcnk188.040e-2428.42potassium channel, subfamily K, member 18 [Source:... [more]
kcnk189.322e-2428.42potassium channel, subfamily K, member 18 [Source:... [more]
kcnk10a2.159e-1925.08potassium channel, subfamily K, member 10a [Source... [more]
kcnk2a8.759e-1929.29potassium channel, subfamily K, member 2a [Source:... [more]
back to top
BLAST of kcnka vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KCNK189.067e-1927.08potassium two pore domain channel subfamily K memb... [more]
stk263.481e-1446.84serine/threonine kinase 26 [Source:Xenbase;Acc:XB-... [more]
stk264.034e-1446.84serine/threonine kinase 26 [Source:Xenbase;Acc:XB-... [more]
KCNK44.219e-1342.35potassium channel, two pore domain subfamily K, me... [more]
KCNK45.174e-1342.35potassium channel, two pore domain subfamily K, me... [more]
back to top
BLAST of kcnka vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Kcnk161.471e-1725.77potassium channel, subfamily K, member 16 [Source:... [more]
Kcnk182.219e-1724.46potassium channel, subfamily K, member 18 [Source:... [more]
Kcnk42.680e-1445.78potassium channel, subfamily K, member 4 [Source:M... [more]
Kcnk104.008e-1436.00potassium channel, subfamily K, member 10 [Source:... [more]
Kcnk101.314e-1341.05potassium channel, subfamily K, member 10 [Source:... [more]
back to top
BLAST of kcnka vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q18120|TWK18_CAEEL2.436e-2627.30TWiK family of potassium channels protein 18 OS=Ca... [more]
sp|P34410|TWK7_CAEEL1.407e-2430.74TWiK family of potassium channels protein 7 OS=Cae... [more]
sp|Q23435|TWK9_CAEEL1.871e-1727.68TWiK family of potassium channels protein 9 OS=Cae... [more]
sp|Q22271|UNC58_CAEEL4.813e-1725.28Uncoordinated protein 58 OS=Caenorhabditis elegans... [more]
sp|Q96T55|KCNKG_HUMAN1.389e-1626.75Potassium channel subfamily K member 16 OS=Homo sa... [more]
back to top
BLAST of kcnka vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A1CVW08.246e-122100.00Kcnka (Fragment) OS=Schmidtea mediterranea OX=7932... [more]
A0A1I8IZX51.784e-8246.56Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HPD61.883e-8246.56Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A5K3FSV14.094e-8139.35Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3U9N23.751e-8039.35Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of kcnka vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000047723.14.404e-2129.93pep primary_assembly:Astyanax_mexicanus-2.0:9:1589... [more]
kcnk10a5.217e-2031.02potassium channel subfamily K member 10-like [Sour... [more]
kcnk4a2.771e-1827.78potassium channel subfamily K member 4 [Source:NCB... [more]
kcnk155.587e-1826.55potassium channel subfamily K member 15-like [Sour... [more]
KCNK165.396e-1628.57potassium channel subfamily K member 16 [Source:NC... [more]
back to top
BLAST of kcnka vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003416.16.684e-2933.17pep scaffold:Pmarinus_7.0:GL476517:78247:80718:1 g... [more]
KCNK101.577e-1438.95potassium two pore domain channel subfamily K memb... [more]
KCNK162.913e-1241.54potassium two pore domain channel subfamily K memb... [more]
KCNK163.381e-1241.54potassium two pore domain channel subfamily K memb... [more]
kcnk74.999e-1041.82potassium channel, subfamily K, member 7 [Source:Z... [more]
back to top
BLAST of kcnka vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TOK13.050e-1123.12Outward-rectifier potassium channel of the plasma ... [more]
back to top
BLAST of kcnka vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO331931.962e-1929.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434641.342e-1831.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485642.211e-1727.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO359235.125e-1552.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309499.241e-1525.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of kcnka vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk5a1.316e-1727.50potassium two pore domain channel subfamily K memb... [more]
kcnk10a2.435e-1728.83potassium channel subfamily K member 10 [Source:NC... [more]
kcnk10a2.508e-1728.83potassium channel subfamily K member 10 [Source:NC... [more]
kcnk4a5.523e-1424.25uncharacterized LOC101171752 [Source:NCBI gene;Acc... [more]
kcnk189.354e-1451.61potassium two pore domain channel subfamily K memb... [more]
back to top
BLAST of kcnka vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016405.10.000e+0100.00SMESG000016405.1[more]
SMESG000016405.12.007e-12796.59SMESG000016405.1[more]
SMESG000024430.11.090e-9142.47SMESG000024430.1[more]
SMESG000031911.14.554e-3833.59SMESG000031911.1[more]
SMESG000019203.11.140e-3733.33SMESG000019203.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014505
GenBankAIX99544.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014505 ID=SMED30014505|Name=kcnka|organism=Schmidtea mediterranea sexual|type=transcript|length=1307bp
TCTATATAAATCTTATATGATCAAGTCATGAAATACACTTGCAAACAGAT
CTGTCAATATATTCTGTTGGGTTTGTTGAGCCATTTCGGAACTCTTTTTA
TCATTATTCTTTATTTGATTGGAGGGGGATTTCTTTTTGCTTTACTCGAA
CAAGAAAATGAAAAGAGTTCGTGTTTTACTTCGTACAAATTATTAATGGA
CAAACTTAACGATACGACATACCGTGGTGTATCAATCGGAAACTCAGGGT
ACAACGCCACTATTTACTATCAACAAATGTATTCAATGCTTTTTAATTTT
TCAAAAGAGGTTTACACTCTGGGATTTTCCCCTTCCAAAGATTGTACAAC
AATTGGTCAGCCCGATAACTTGTCCGCTTGGAATTTAGCAAATTCAATAT
TTTTTTGTGCTACAATTATTACCACCATAGGATACGGTAATATTGTTCCA
TCAACTGTATGGGGGCGAATCGTCTGTATTATATACGCTTTTATTGGAAT
TCCGCTAATGTTGCTATTTCTGAGCAATTTTGGAGAGGTTTTAGCTTCCG
CTTTCAGATTTGTTTATACAAACCTATGCTGTTGTCGCTGCTTTGTCAAA
GGTAAATATACATCAATCTCGGAATTTGAATCGATGTCCAAACGTTCTGC
TATTGAGATCAAAAACTTTGAACTTGAAAACGCTGAAAACTTAAATAGTA
ATCCAGTGAAAGCAACTCCGCCGCCAAAATTTATAGATGAAGACCTTGAT
ATTGTGTATGTGGACGATGAAAATGACCAAGACGAAATCATTAACATACC
ACTTACTGTCGTTATAGGGTTTTTGATCATCTATATGTTTCTTGGAGCAT
TAATATTTCAAATTTGGGAGACATGGGATCTCGTTGCTGCAGTGTACTTT
TCGTTCATTACGGTCTCTACAATTGGATTTGGGGATCTGTATCCAGCAAA
GAATACGATAGGAAGTAGTGTGGCTACTCTCGAACTTATTGTAGGTGCTG
TTTACTGTATCATTGGATTAGCTATTCTTTCAATGTGTTTGAATCTGGTA
AAAGAAGAGATCGTGGAAAAGTTCTCCTGGCTAGGAAATAAACTTGGAAT
AGTAAAGTCGAACACTGGGAGTTCCGAAGAATGTGAAGAAGTTAATGATC
ACCAGTCTAATTCCAGAATCATTATTGAGAATTCAGATTTCCAAAATTCA
GTTATGCACGTTAACGAAGCCTACGAAAAGGATGAAATTTTATTTAAAAC
TAAAATCAAATCTGCTTGATAATACATTTTATGGCTGTGACAAAAAATTG
AGATTTG
back to top

protein sequence of SMED30014505-orf-1

>SMED30014505-orf-1 ID=SMED30014505-orf-1|Name=SMED30014505-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=414bp
MKYTCKQICQYILLGLLSHFGTLFIIILYLIGGGFLFALLEQENEKSSCF
TSYKLLMDKLNDTTYRGVSIGNSGYNATIYYQQMYSMLFNFSKEVYTLGF
SPSKDCTTIGQPDNLSAWNLANSIFFCATIITTIGYGNIVPSTVWGRIVC
IIYAFIGIPLMLLFLSNFGEVLASAFRFVYTNLCCCRCFVKGKYTSISEF
ESMSKRSAIEIKNFELENAENLNSNPVKATPPPKFIDEDLDIVYVDDEND
QDEIINIPLTVVIGFLIIYMFLGALIFQIWETWDLVAAVYFSFITVSTIG
FGDLYPAKNTIGSSVATLELIVGAVYCIIGLAILSMCLNLVKEEIVEKFS
WLGNKLGIVKSNTGSSEECEEVNDHQSNSRIIIENSDFQNSVMHVNEAYE
KDEILFKTKIKSA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR0032802pore_dom_K_chnl
IPR013099K_chnl_dom
Vocabulary: molecular function
TermDefinition
GO:0005267potassium channel activity
Vocabulary: biological process
TermDefinition
GO:0071805potassium ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003280Two pore domain potassium channelPRINTSPR013332POREKCHANELcoord: 132..160
score: 53.54
coord: 300..309
score: 67.59
IPR013099Potassium channel domainPFAMPF07885Ion_trans_2coord: 268..344
e-value: 6.6E-16
score: 58.0
coord: 117..175
e-value: 6.0E-20
score: 71.0
NoneNo IPR availablePANTHERPTHR11003POTASSIUM CHANNEL, SUBFAMILY Kcoord: 18..355
NoneNo IPR availablePANTHERPTHR11003:SF276TWIK FAMILY OF POTASSIUM CHANNELScoord: 18..355
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 259..355
NoneNo IPR availableSUPERFAMILYSSF81324Voltage-gated potassium channelscoord: 21..187
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 323..344
NoneNo IPR availableTMHMMTMhelixcoord: 118..140
NoneNo IPR availableTMHMMTMhelixcoord: 257..279
NoneNo IPR availableTMHMMTMhelixcoord: 147..169
NoneNo IPR availableTMHMMTMhelixcoord: 286..308