collagen alpha-1(I) chain isoform X4

Overview
Namecollagen alpha-1(I) chain isoform X4
Smed IDSMED30014501
Length (bp)7144
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of collagen alpha-1(I) chain isoform X4 (SMED30014501) t-SNE clustered cells

Violin plots show distribution of expression levels for collagen alpha-1(I) chain isoform X4 (SMED30014501) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of collagen alpha-1(I) chain isoform X4 (SMED30014501) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for collagen alpha-1(I) chain isoform X4 (SMED30014501) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014501

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30014501SMESG000071150.1 dd_Smed_v4_13610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014501SMESG000071150.1 dd_Smed_v4_13610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30014501SMESG000071150.1 dd_Smed_v4_13610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014501SMESG000071150.1 dd_Smed_v4_13610_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014501SMESG000071152.1 SMESG000071150.1 dd_Smed_v4_9030_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014501SMESG000071152.1 SMESG000071150.1 dd_Smed_v4_9030_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014501SMESG000071152.1 SMESG000071150.1 dd_Smed_v4_9030_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014501SMESG000071152.1 SMESG000071150.1 dd_Smed_v4_9030_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014501SMESG000071150.1 Contig55896uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014501SMESG000071150.1 Contig55896newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
body wall musculatureSMED30014501SMESG000071152.1 SMESG000071150.1 dd_Smed_v4_9030_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014501SMESG000071152.1 SMESG000071150.1 dd_Smed_v4_9030_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014501SMESG000071152.1 SMESG000071150.1 dd_Smed_v4_9030_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Human
Match: COL18A1 (collagen type XVIII alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2195])

HSP 1 Score: 76.2554 bits (186), Expect = 6.096e-13
Identity = 53/187 (28.34%), Postives = 86/187 (45.99%), Query Frame = 2
Query: 6491 PVQKPNPDNILHN--QKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSR--KPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            P +  +P    H   Q  L+ + L  P  G +R +  A+  C + A      G F+AFL  + ++L S++      +  IVN  +E LF SW  +F+G     KPG  + +F+G DVL    W  K +W G   +  + T   C  W + +P+  G   +L     L +     C ++Y + CI+ S
Sbjct:  496 PARPTSPPAHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAAS-CHHAYIVLCIENS 681          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Human
Match: COL15A1 (collagen type XV alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2192])

HSP 1 Score: 68.1662 bits (165), Expect = 2.605e-10
Identity = 49/193 (25.39%), Postives = 89/193 (46.11%), Query Frame = 2
Query: 6467 SSNTFKRIPVQKPNPDNILHNQK-KLYFILLPEPWRGNIRVSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRK--PGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            SSN  + +P   PNP +  + +K  L+   L  P+ G+IR   A+  C K A     +  ++AFL    ++L +++     +S  IVN   + LF +W  +F+G+  +    +P+ +F+G D++    W  K +W G +    +     C  W ++     G+   L     L++     C N   + CI+ S
Sbjct: 1195 SSNPHQLLP--PPNPISSANYEKPALHLAALNMPFSGDIR---ADFQCFKQARAAGLLSTYRAFLSSHLQDLSTIVRKAERYSLPIVNLKGQVLFNNWDSIFSGHGGQFNMHIPIYSFDGRDIMTDPSWPQKVIWHGSSPHGVRLVDNYCEAWRTADTAVTGLASPLSTGKILDQKAYS-CANRLIVLCIENS 1381          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Human
Match: COL15A1 (collagen type XV alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2192])

HSP 1 Score: 67.781 bits (164), Expect = 2.733e-10
Identity = 49/193 (25.39%), Postives = 89/193 (46.11%), Query Frame = 2
Query: 6467 SSNTFKRIPVQKPNPDNILHNQK-KLYFILLPEPWRGNIRVSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRK--PGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            SSN  + +P   PNP +  + +K  L+   L  P+ G+IR   A+  C K A     +  ++AFL    ++L +++     +S  IVN   + LF +W  +F+G+  +    +P+ +F+G D++    W  K +W G +    +     C  W ++     G+   L     L++     C N   + CI+ S
Sbjct: 1181 SSNPHQLLP--PPNPISSANYEKPALHLAALNMPFSGDIR---ADFQCFKQARAAGLLSTYRAFLSSHLQDLSTIVRKAERYSLPIVNLKGQVLFNNWDSIFSGHGGQFNMHIPIYSFDGRDIMTDPSWPQKVIWHGSSPHGVRLVDNYCEAWRTADTAVTGLASPLSTGKILDQKAYS-CANRLIVLCIENS 1367          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Human
Match: COL18A1 (collagen type XVIII alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2195])

HSP 1 Score: 67.3958 bits (163), Expect = 3.835e-10
Identity = 50/172 (29.07%), Postives = 81/172 (47.09%), Query Frame = 2
Query: 6530 QKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYS--RKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            Q  L+ + L  P  G +R +  A+  C + A      G F+AFL  + ++L S++      +  IVN  +E LF SW  +F+G     KPG  + +F+G DVL    W  K +W G   +  + T   C  W + +P+  G   +L     L +     C ++Y + CI+ S
Sbjct: 1163 QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAAS-CHHAYIVLCIENS 1333          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Human
Match: COL18A1 (collagen type XVIII alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2195])

HSP 1 Score: 67.3958 bits (163), Expect = 4.110e-10
Identity = 50/172 (29.07%), Postives = 81/172 (47.09%), Query Frame = 2
Query: 6530 QKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYS--RKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            Q  L+ + L  P  G +R +  A+  C + A      G F+AFL  + ++L S++      +  IVN  +E LF SW  +F+G     KPG  + +F+G DVL    W  K +W G   +  + T   C  W + +P+  G   +L     L +     C ++Y + CI+ S
Sbjct: 1578 QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAAS-CHHAYIVLCIENS 1748          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Celegans
Match: cle-1 (CLE-1B protein; CoLlagen with Endostatin domain [Source:UniProtKB/TrEMBL;Acc:G5EDV5])

HSP 1 Score: 62.003 bits (149), Expect = 4.786e-9
Identity = 48/191 (25.13%), Postives = 85/191 (44.50%), Query Frame = 2
Query: 6479 FKRIPVQKPNPDNILHNQKK-LYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVG---GALDIYQETVPSCRDW--TSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQ 7030
            + +  + +P  D  +HN+ + ++ I L +P+ GN+  +  A+  C + A    Y   F+A L    ++L  ++ +  + +  +VN     LF SW    NG    P   L +F+ HDVL+   W  K +W G   G +   Q     C  W    SS T     I+    +F +   ++ C N   + C++
Sbjct:  444 YPKANLDEPQRDAGVHNKDRVIHMIALSQPFSGNLHGLRGADLQCYREARAAGYTTTFRAMLSSNVQDLVRIVHSVDFDT-TVVNVAGHHLFPSWRSFVNGAQMNPHAKLFSFDRHDVLNDSRWPDKRVWHGSKDGGIRAEQ----YCDGWRRADSSLTSLAGHISSNTSIFQSSGSEK-CENKLVVLCVE 628          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Celegans
Match: cle-1 (CLE-1B protein; CoLlagen with Endostatin domain [Source:UniProtKB/TrEMBL;Acc:G5EDV5])

HSP 1 Score: 62.003 bits (149), Expect = 6.217e-9
Identity = 47/188 (25.00%), Postives = 84/188 (44.68%), Query Frame = 2
Query: 6479 FKRIPVQKPNPDNILHNQKK-LYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDW--TSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQ 7030
            + +  + +P  D  +HN+ + ++ I L +P+ GN+  +  A+  C + A    Y   F+A L    ++L  ++ +  + +  +VN     LF SW    NG    P   L +F+ HDVL+   W  K +W  G+ D        C  W    SS T     I+    +F +   ++ C N   + C++
Sbjct:  572 YPKANLDEPQRDAGVHNKDRVIHMIALSQPFSGNLHGLRGADLQCYREARAAGYTTTFRAMLSSNVQDLVRIVHSVDFDT-TVVNVAGHHLFPSWRSFVNGAQMNPHAKLFSFDRHDVLNDSRWPDKRVW-HGSKDGGIRAEQYCDGWRRADSSLTSLAGHISSNTSIFQSSGSEK-CENKLVVLCVE 756          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Celegans
Match: cle-1 (CLE-1B protein; CoLlagen with Endostatin domain [Source:UniProtKB/TrEMBL;Acc:G5EDV5])

HSP 1 Score: 61.6178 bits (148), Expect = 9.002e-9
Identity = 47/188 (25.00%), Postives = 84/188 (44.68%), Query Frame = 2
Query: 6479 FKRIPVQKPNPDNILHNQKK-LYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDW--TSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQ 7030
            + +  + +P  D  +HN+ + ++ I L +P+ GN+  +  A+  C + A    Y   F+A L    ++L  ++ +  + +  +VN     LF SW    NG    P   L +F+ HDVL+   W  K +W  G+ D        C  W    SS T     I+    +F +   ++ C N   + C++
Sbjct:  969 YPKANLDEPQRDAGVHNKDRVIHMIALSQPFSGNLHGLRGADLQCYREARAAGYTTTFRAMLSSNVQDLVRIVHSVDFDT-TVVNVAGHHLFPSWRSFVNGAQMNPHAKLFSFDRHDVLNDSRWPDKRVW-HGSKDGGIRAEQYCDGWRRADSSLTSLAGHISSNTSIFQSSGSEK-CENKLVVLCVE 1153          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Celegans
Match: cle-1 (CLE-1B protein; CoLlagen with Endostatin domain [Source:UniProtKB/TrEMBL;Acc:G5EDV5])

HSP 1 Score: 61.6178 bits (148), Expect = 9.307e-9
Identity = 47/188 (25.00%), Postives = 84/188 (44.68%), Query Frame = 2
Query: 6479 FKRIPVQKPNPDNILHNQKK-LYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDW--TSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQ 7030
            + +  + +P  D  +HN+ + ++ I L +P+ GN+  +  A+  C + A    Y   F+A L    ++L  ++ +  + +  +VN     LF SW    NG    P   L +F+ HDVL+   W  K +W  G+ D        C  W    SS T     I+    +F +   ++ C N   + C++
Sbjct:  932 YPKANLDEPQRDAGVHNKDRVIHMIALSQPFSGNLHGLRGADLQCYREARAAGYTTTFRAMLSSNVQDLVRIVHSVDFDT-TVVNVAGHHLFPSWRSFVNGAQMNPHAKLFSFDRHDVLNDSRWPDKRVW-HGSKDGGIRAEQYCDGWRRADSSLTSLAGHISSNTSIFQSSGSEK-CENKLVVLCVE 1116          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Fly
Match: Mp (gene:FBgn0260660 transcript:FBtr0308094)

HSP 1 Score: 56.225 bits (134), Expect = 6.752e-8
Identity = 45/177 (25.42%), Postives = 77/177 (43.50%), Query Frame = 2
Query: 6521 LHNQKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLM-PAKYWHSWQIVNKNEETLFFSWSQMFNG----YSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQV 7033
            L N   L    L EP  G+++ +  A+  C +       +G F+AFL  + +NL +++ PA       +VN   + LF SW  +FNG    +S+ P +   +F G +V+    W  K +W G   +  +     C  W S          NL+    L +  ++ C +   I C++ 
Sbjct:   17 LLNTPTLRVAALNEPSTGDLQGIRGADFACYRQGRRAGLLGTFKAFLSSRVQNLDTIVRPAD--RDLPVVNTRGDVLFNSWKGIFNGQGGFFSQAPRI--YSFSGKNVMTDSTWPMKMVWHGSLPNGERSMDTYCDAWHSGDHLKGSFASNLDGHKLLEQK-RQSCDSKLIILCVEA 188          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Fly
Match: Mp (gene:FBgn0260660 transcript:FBtr0301106)

HSP 1 Score: 58.9214 bits (141), Expect = 6.919e-8
Identity = 45/177 (25.42%), Postives = 77/177 (43.50%), Query Frame = 2
Query: 6521 LHNQKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLM-PAKYWHSWQIVNKNEETLFFSWSQMFNG----YSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQV 7033
            L N   L    L EP  G+++ +  A+  C +       +G F+AFL  + +NL +++ PA       +VN   + LF SW  +FNG    +S+ P +   +F G +V+    W  K +W G   +  +     C  W S          NL+    L +  ++ C +   I C++ 
Sbjct:  566 LLNTPTLRVAALNEPSTGDLQGIRGADFACYRQGRRAGLLGTFKAFLSSRVQNLDTIVRPAD--RDLPVVNTRGDVLFNSWKGIFNGQGGFFSQAPRI--YSFSGKNVMTDSTWPMKMVWHGSLPNGERSMDTYCDAWHSGDHLKGSFASNLDGHKLLEQK-RQSCDSKLIILCVEA 737          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Fly
Match: Mp (gene:FBgn0260660 transcript:FBtr0339903)

HSP 1 Score: 58.9214 bits (141), Expect = 6.958e-8
Identity = 45/177 (25.42%), Postives = 77/177 (43.50%), Query Frame = 2
Query: 6521 LHNQKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLM-PAKYWHSWQIVNKNEETLFFSWSQMFNG----YSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQV 7033
            L N   L    L EP  G+++ +  A+  C +       +G F+AFL  + +NL +++ PA       +VN   + LF SW  +FNG    +S+ P +   +F G +V+    W  K +W G   +  +     C  W S          NL+    L +  ++ C +   I C++ 
Sbjct:  592 LLNTPTLRVAALNEPSTGDLQGIRGADFACYRQGRRAGLLGTFKAFLSSRVQNLDTIVRPAD--RDLPVVNTRGDVLFNSWKGIFNGQGGFFSQAPRI--YSFSGKNVMTDSTWPMKMVWHGSLPNGERSMDTYCDAWHSGDHLKGSFASNLDGHKLLEQK-RQSCDSKLIILCVEA 763          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Fly
Match: Mp (gene:FBgn0260660 transcript:FBtr0339905)

HSP 1 Score: 58.9214 bits (141), Expect = 7.158e-8
Identity = 45/177 (25.42%), Postives = 77/177 (43.50%), Query Frame = 2
Query: 6521 LHNQKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLM-PAKYWHSWQIVNKNEETLFFSWSQMFNG----YSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQV 7033
            L N   L    L EP  G+++ +  A+  C +       +G F+AFL  + +NL +++ PA       +VN   + LF SW  +FNG    +S+ P +   +F G +V+    W  K +W G   +  +     C  W S          NL+    L +  ++ C +   I C++ 
Sbjct:  761 LLNTPTLRVAALNEPSTGDLQGIRGADFACYRQGRRAGLLGTFKAFLSSRVQNLDTIVRPAD--RDLPVVNTRGDVLFNSWKGIFNGQGGFFSQAPRI--YSFSGKNVMTDSTWPMKMVWHGSLPNGERSMDTYCDAWHSGDHLKGSFASNLDGHKLLEQK-RQSCDSKLIILCVEA 932          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Fly
Match: Mp (gene:FBgn0260660 transcript:FBtr0301111)

HSP 1 Score: 58.5362 bits (140), Expect = 7.458e-8
Identity = 45/177 (25.42%), Postives = 77/177 (43.50%), Query Frame = 2
Query: 6521 LHNQKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLM-PAKYWHSWQIVNKNEETLFFSWSQMFNG----YSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQV 7033
            L N   L    L EP  G+++ +  A+  C +       +G F+AFL  + +NL +++ PA       +VN   + LF SW  +FNG    +S+ P +   +F G +V+    W  K +W G   +  +     C  W S          NL+    L +  ++ C +   I C++ 
Sbjct:  367 LLNTPTLRVAALNEPSTGDLQGIRGADFACYRQGRRAGLLGTFKAFLSSRVQNLDTIVRPAD--RDLPVVNTRGDVLFNSWKGIFNGQGGFFSQAPRI--YSFSGKNVMTDSTWPMKMVWHGSLPNGERSMDTYCDAWHSGDHLKGSFASNLDGHKLLEQK-RQSCDSKLIILCVEA 538          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Zebrafish
Match: col18a1b (collagen type XVIII alpha 1 chain b [Source:ZFIN;Acc:ZDB-GENE-110411-288])

HSP 1 Score: 83.9593 bits (206), Expect = 2.100e-15
Identity = 52/179 (29.05%), Postives = 85/179 (47.49%), Query Frame = 2
Query: 6509 PDNILHNQKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRK--PGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            P ++  + + L+ + L  P RGN++ +   +H C   A      G F+AFL  Q ++L S++         IVN  +E LF +W  +F     K      + +F+G DVL+ D W  K +W G +    + T   C  W   S    GM  +L+    L ++ +R C +SY + CI+ S
Sbjct:  685 PAHVHTSGRALHLVALNSPQRGNMQGIRGVDHQCFLQARAIGLKGTFRAFLSSQLQDLNSIVRKNDKDQLPIVNLKDEELFSNWESIFEDSEGKMYDDARIYSFDGRDVLNDDAWPEKMVWHGSSTHGQRHTESFCETWRVGSDGVMGMASSLQEGYLLQQLPRR-CTSSYIVLCIENS 862          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Zebrafish
Match: col15a1b (collagen, type XV, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-070912-689])

HSP 1 Score: 75.0998 bits (183), Expect = 1.211e-12
Identity = 55/219 (25.11%), Postives = 91/219 (41.55%), Query Frame = 2
Query: 6392 MIKVTDNPNIW-RQLNAFLGEEQFLPSSNTFKRIPVQKPNPDNILHNQKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMF--NGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            M  V D   ++ R+L +FL     LP +                 H+   L+ + L  P+ G++  +  A++ C + A        ++AFL    ++L +++      +  +VN   E LF SW  MF  NG    P  P+ +F+G +VL    W  K +W G +    + T   C  W +      G    L+    L +   R C N + I CI+ S
Sbjct:  961 MGYVIDKSELYIRELKSFLPGYNLLPDTT----------------HSMPALHLVALNAPFSGDMHGIRGADYQCYQQARARGLTSTYRAFLSSHLQDLSTIVKKADRFNLPVVNLKGEVLFSSWMAMFSGNGGVFDPLTPIYSFDGRNVLTDQAWSQKLVWHGSSTVGIRMTTNYCEAWRTGDMAVTGQASLLQTGRLLGQHT-RSCSNHFIILCIENS 1162          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Zebrafish
Match: col15a1b (collagen, type XV, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-070912-689])

HSP 1 Score: 74.7146 bits (182), Expect = 1.274e-12
Identity = 55/219 (25.11%), Postives = 91/219 (41.55%), Query Frame = 2
Query: 6392 MIKVTDNPNIW-RQLNAFLGEEQFLPSSNTFKRIPVQKPNPDNILHNQKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMF--NGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            M  V D   ++ R+L +FL     LP +                 H+   L+ + L  P+ G++  +  A++ C + A        ++AFL    ++L +++      +  +VN   E LF SW  MF  NG    P  P+ +F+G +VL    W  K +W G +    + T   C  W +      G    L+    L +   R C N + I CI+ S
Sbjct:  961 MGYVIDKSELYIRELKSFLPGYNLLPDTT----------------HSMPALHLVALNAPFSGDMHGIRGADYQCYQQARARGLTSTYRAFLSSHLQDLSTIVKKADRFNLPVVNLKGEVLFSSWMAMFSGNGGVFDPLTPIYSFDGRNVLTDQAWSQKLVWHGSSTVGIRMTTNYCEAWRTGDMAVTGQASLLQTGRLLGQHT-RSCSNHFIILCIENS 1162          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Zebrafish
Match: col15a1b (collagen, type XV, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-070912-689])

HSP 1 Score: 73.9442 bits (180), Expect = 2.254e-12
Identity = 52/198 (26.26%), Postives = 84/198 (42.42%), Query Frame = 2
Query: 6452 EQFLPSSNTFKRIPVQKPNPDNILHNQKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMF--NGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            + FLP  N           PD   H+   L+ + L  P+ G++  +  A++ C + A        ++AFL    ++L +++      +  +VN   E LF SW  MF  NG    P  P+ +F+G +VL    W  K +W G +    + T   C  W +      G    L+    L +   R C N + I CI+ S
Sbjct: 1051 KSFLPGYNLL---------PDTT-HSMPALHLVALNAPFSGDMHGIRGADYQCYQQARARGLTSTYRAFLSSHLQDLSTIVKKADRFNLPVVNLKGEVLFSSWMAMFSGNGGVFDPLTPIYSFDGRNVLTDQAWSQKLVWHGSSTVGIRMTTNYCEAWRTGDMAVTGQASLLQTGRLLGQHT-RSCSNHFIILCIENS 1237          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Zebrafish
Match: col18a1a (collagen type XVIII alpha 1 chain a [Source:ZFIN;Acc:ZDB-GENE-030516-3])

HSP 1 Score: 70.8626 bits (172), Expect = 2.329e-11
Identity = 54/186 (29.03%), Postives = 87/186 (46.77%), Query Frame = 2
Query: 6491 PVQKPNPDNILHNQKK-LYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMF-NGYSR-KPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            PV +P      H     L+ I L  P  GN+R +  A+ +C + A      G F+AFL  + ++L S++      +  IVN  ++ LF SW  +F +  SR K   P+ +F+G DVL    W  K +W G     +++T   C  W +      G+  +L+    L +     C +SY + CI+ S
Sbjct: 1158 PVNQPGGHAHTHTSGPGLHLIALNSPQVGNMRGIRGADFMCFQQARAVGMKGTFRAFLSSKLQDLYSIVRRSDRETLPIVNLKDQVLFSSWESLFSDSESRMKDNAPIYSFDGRDVLRDSAWPEKMIWHGSDGRGHRQTDNYCETWRAGDRAVTGLASSLQAGQLLQQTSSS-CSSSYIVLCIENS 1342          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Xenopus
Match: COL18A1 (collagen type XVIII alpha 1 [Source:NCBI gene;Acc:394845])

HSP 1 Score: 69.707 bits (169), Expect = 7.356e-11
Identity = 48/172 (27.91%), Postives = 80/172 (46.51%), Query Frame = 2
Query: 6539 LYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSR--KPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVI-KRP--CGNSYYIGCIQVS 7036
            L+ + L  P  G+++ +   +  C + A      G F+AFL  + ++L S++      S QIVN  +E LF +W  +F+G     +PG  + +F+G DV     W  K +W G      + T   C  W     TD G      + L   K++ +RP  C  ++ + CI+ S
Sbjct: 1115 LHLVALNTPLSGSMKSIRGVDFQCFEQARKAGLHGTFRAFLSSRLQDLYSIVRRADRQSVQIVNLRDEVLFDNWESLFSGSEAQMRPGASIFSFDGKDVATDPTWPQKMVWHGSDSKGRRLTESYCETWR----TDEGAVTGQASSLTSGKLLEQRPQSCNKNFIVLCIENS 1282          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Xenopus
Match: COL18A1 (collagen type XVIII alpha 1 [Source:NCBI gene;Acc:394845])

HSP 1 Score: 69.707 bits (169), Expect = 7.565e-11
Identity = 48/172 (27.91%), Postives = 80/172 (46.51%), Query Frame = 2
Query: 6539 LYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSR--KPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVI-KRP--CGNSYYIGCIQVS 7036
            L+ + L  P  G+++ +   +  C + A      G F+AFL  + ++L S++      S QIVN  +E LF +W  +F+G     +PG  + +F+G DV     W  K +W G      + T   C  W     TD G      + L   K++ +RP  C  ++ + CI+ S
Sbjct: 1127 LHLVALNTPLSGSMKSIRGVDFQCFEQARKAGLHGTFRAFLSSRLQDLYSIVRRADRQSVQIVNLRDEVLFDNWESLFSGSEAQMRPGASIFSFDGKDVATDPTWPQKMVWHGSDSKGRRLTESYCETWR----TDEGAVTGQASSLTSGKLLEQRPQSCNKNFIVLCIENS 1294          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Xenopus
Match: COL18A1 (collagen type XVIII alpha 1 [Source:NCBI gene;Acc:394845])

HSP 1 Score: 69.3218 bits (168), Expect = 1.017e-10
Identity = 48/172 (27.91%), Postives = 80/172 (46.51%), Query Frame = 2
Query: 6539 LYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSR--KPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVI-KRP--CGNSYYIGCIQVS 7036
            L+ + L  P  G+++ +   +  C + A      G F+AFL  + ++L S++      S QIVN  +E LF +W  +F+G     +PG  + +F+G DV     W  K +W G      + T   C  W     TD G      + L   K++ +RP  C  ++ + CI+ S
Sbjct: 1423 LHLVALNTPLSGSMKSIRGVDFQCFEQARKAGLHGTFRAFLSSRLQDLYSIVRRADRQSVQIVNLRDEVLFDNWESLFSGSEAQMRPGASIFSFDGKDVATDPTWPQKMVWHGSDSKGRRLTESYCETWR----TDEGAVTGQASSLTSGKLLEQRPQSCNKNFIVLCIENS 1590          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Xenopus
Match: COL18A1 (collagen type XVIII alpha 1 [Source:NCBI gene;Acc:394845])

HSP 1 Score: 69.3218 bits (168), Expect = 1.025e-10
Identity = 48/172 (27.91%), Postives = 80/172 (46.51%), Query Frame = 2
Query: 6539 LYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSR--KPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVI-KRP--CGNSYYIGCIQVS 7036
            L+ + L  P  G+++ +   +  C + A      G F+AFL  + ++L S++      S QIVN  +E LF +W  +F+G     +PG  + +F+G DV     W  K +W G      + T   C  W     TD G      + L   K++ +RP  C  ++ + CI+ S
Sbjct:  963 LHLVALNTPLSGSMKSIRGVDFQCFEQARKAGLHGTFRAFLSSRLQDLYSIVRRADRQSVQIVNLRDEVLFDNWESLFSGSEAQMRPGASIFSFDGKDVATDPTWPQKMVWHGSDSKGRRLTESYCETWR----TDEGAVTGQASSLTSGKLLEQRPQSCNKNFIVLCIENS 1130          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Xenopus
Match: COL18A1 (collagen type XVIII alpha 1 [Source:NCBI gene;Acc:394845])

HSP 1 Score: 68.9366 bits (167), Expect = 1.153e-10
Identity = 48/172 (27.91%), Postives = 80/172 (46.51%), Query Frame = 2
Query: 6539 LYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSR--KPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVI-KRP--CGNSYYIGCIQVS 7036
            L+ + L  P  G+++ +   +  C + A      G F+AFL  + ++L S++      S QIVN  +E LF +W  +F+G     +PG  + +F+G DV     W  K +W G      + T   C  W     TD G      + L   K++ +RP  C  ++ + CI+ S
Sbjct: 1414 LHLVALNTPLSGSMKSIRGVDFQCFEQARKAGLHGTFRAFLSSRLQDLYSIVRRADRQSVQIVNLRDEVLFDNWESLFSGSEAQMRPGASIFSFDGKDVATDPTWPQKMVWHGSDSKGRRLTESYCETWR----TDEGAVTGQASSLTSGKLLEQRPQSCNKNFIVLCIENS 1581          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Mouse
Match: Col18a1 (collagen, type XVIII, alpha 1 [Source:MGI Symbol;Acc:MGI:88451])

HSP 1 Score: 60.4622 bits (145), Expect = 3.879e-8
Identity = 49/172 (28.49%), Postives = 77/172 (44.77%), Query Frame = 2
Query: 6530 QKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGY--SRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            Q  L+ + L  P  G +R +  A+  C + A      G F+AFL  + ++L S++      S  IVN  +E L  SW  +F+G     +PG  + +F+G DVL    W  K +W G      +     C  W + +    G   +L +   L +     C NSY + CI+ S
Sbjct: 1138 QPVLHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAAS-CHNSYIVLCIENS 1308          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Mouse
Match: Col18a1 (collagen, type XVIII, alpha 1 [Source:MGI Symbol;Acc:MGI:88451])

HSP 1 Score: 60.4622 bits (145), Expect = 4.042e-8
Identity = 49/172 (28.49%), Postives = 77/172 (44.77%), Query Frame = 2
Query: 6530 QKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGY--SRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            Q  L+ + L  P  G +R +  A+  C + A      G F+AFL  + ++L S++      S  IVN  +E L  SW  +F+G     +PG  + +F+G DVL    W  K +W G      +     C  W + +    G   +L +   L +     C NSY + CI+ S
Sbjct: 1597 QPVLHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAAS-CHNSYIVLCIENS 1767          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Mouse
Match: Col18a1 (collagen, type XVIII, alpha 1 [Source:MGI Symbol;Acc:MGI:88451])

HSP 1 Score: 60.077 bits (144), Expect = 4.429e-8
Identity = 49/172 (28.49%), Postives = 77/172 (44.77%), Query Frame = 2
Query: 6530 QKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGY--SRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            Q  L+ + L  P  G +R +  A+  C + A      G F+AFL  + ++L S++      S  IVN  +E L  SW  +F+G     +PG  + +F+G DVL    W  K +W G      +     C  W + +    G   +L +   L +     C NSY + CI+ S
Sbjct: 1350 QPVLHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAAS-CHNSYIVLCIENS 1520          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Mouse
Match: Col15a1 (collagen, type XV, alpha 1 [Source:MGI Symbol;Acc:MGI:88449])

HSP 1 Score: 58.9214 bits (141), Expect = 1.190e-7
Identity = 43/171 (25.15%), Postives = 75/171 (43.86%), Query Frame = 2
Query: 6539 LYFILLPEPWRGNIRVSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRK--PGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKR---PCGNSYYIGCIQVS 7036
            L+ + L  P  G+IR   A+  C + A     +  F+AFL    ++L +++         IVN   + LF +W  +F+G   +    +P+ +F+G DV+    W  K +W G      +     C  W +   TD  +T    + L   K++ +    C N   + CI+ S
Sbjct: 1197 LHLVALNTPVAGDIR---ADFQCFQQARAAGLLSTFRAFLSSHLQDLSTVVRKAERFGLPIVNLKGQVLFNNWDSIFSGDGGQFNTHIPIYSFDGRDVMTDPSWPQKVVWHGSNPHGVRLVDKYCEAWRT---TDMAVT-GFASPLSTGKILDQKAYSCANRLIVLCIENS 1360          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Mouse
Match: Col15a1 (collagen, type XV, alpha 1 [Source:MGI Symbol;Acc:MGI:88449])

HSP 1 Score: 58.5362 bits (140), Expect = 1.237e-7
Identity = 43/171 (25.15%), Postives = 75/171 (43.86%), Query Frame = 2
Query: 6539 LYFILLPEPWRGNIRVSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRK--PGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKR---PCGNSYYIGCIQVS 7036
            L+ + L  P  G+IR   A+  C + A     +  F+AFL    ++L +++         IVN   + LF +W  +F+G   +    +P+ +F+G DV+    W  K +W G      +     C  W +   TD  +T    + L   K++ +    C N   + CI+ S
Sbjct: 1175 LHLVALNTPVAGDIR---ADFQCFQQARAAGLLSTFRAFLSSHLQDLSTVVRKAERFGLPIVNLKGQVLFNNWDSIFSGDGGQFNTHIPIYSFDGRDVMTDPSWPQKVVWHGSNPHGVRLVDKYCEAWRT---TDMAVT-GFASPLSTGKILDQKAYSCANRLIVLCIENS 1338          
BLAST of collagen alpha-1(I) chain isoform X4 vs. UniProt/SwissProt
Match: sp|P39059|COFA1_HUMAN (Collagen alpha-1(XV) chain OS=Homo sapiens OX=9606 GN=COL15A1 PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.251e-9
Identity = 49/193 (25.39%), Postives = 89/193 (46.11%), Query Frame = 2
Query: 6467 SSNTFKRIPVQKPNPDNILHNQK-KLYFILLPEPWRGNIRVSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRK--PGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            SSN  + +P   PNP +  + +K  L+   L  P+ G+IR   A+  C K A     +  ++AFL    ++L +++     +S  IVN   + LF +W  +F+G+  +    +P+ +F+G D++    W  K +W G +    +     C  W ++     G+   L     L++     C N   + CI+ S
Sbjct: 1195 SSNPHQLLP--PPNPISSANYEKPALHLAALNMPFSGDIR---ADFQCFKQARAAGLLSTYRAFLSSHLQDLSTIVRKAERYSLPIVNLKGQVLFNNWDSIFSGHGGQFNMHIPIYSFDGRDIMTDPSWPQKVIWHGSSPHGVRLVDNYCEAWRTADTAVTGLASPLSTGKILDQKAYS-CANRLIVLCIENS 1381          
BLAST of collagen alpha-1(I) chain isoform X4 vs. UniProt/SwissProt
Match: sp|P39060|COIA1_HUMAN (Collagen alpha-1(XVIII) chain OS=Homo sapiens OX=9606 GN=COL18A1 PE=1 SV=5)

HSP 1 Score: 67.3958 bits (163), Expect = 1.974e-9
Identity = 50/172 (29.07%), Postives = 81/172 (47.09%), Query Frame = 2
Query: 6530 QKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYS--RKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            Q  L+ + L  P  G +R +  A+  C + A      G F+AFL  + ++L S++      +  IVN  +E LF SW  +F+G     KPG  + +F+G DVL    W  K +W G   +  + T   C  W + +P+  G   +L     L +     C ++Y + CI+ S
Sbjct: 1578 QPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAAS-CHHAYIVLCIENS 1748          
BLAST of collagen alpha-1(I) chain isoform X4 vs. UniProt/SwissProt
Match: sp|P39061|COIA1_MOUSE (Collagen alpha-1(XVIII) chain OS=Mus musculus OX=10090 GN=Col18a1 PE=1 SV=4)

HSP 1 Score: 60.4622 bits (145), Expect = 2.711e-7
Identity = 49/172 (28.49%), Postives = 77/172 (44.77%), Query Frame = 2
Query: 6530 QKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGY--SRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            Q  L+ + L  P  G +R +  A+  C + A      G F+AFL  + ++L S++      S  IVN  +E L  SW  +F+G     +PG  + +F+G DVL    W  K +W G      +     C  W + +    G   +L +   L +     C NSY + CI+ S
Sbjct: 1597 QPVLHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAAS-CHNSYIVLCIENS 1767          
BLAST of collagen alpha-1(I) chain isoform X4 vs. UniProt/SwissProt
Match: sp|O35206|COFA1_MOUSE (Collagen alpha-1(XV) chain OS=Mus musculus OX=10090 GN=Col15a1 PE=1 SV=2)

HSP 1 Score: 58.9214 bits (141), Expect = 8.322e-7
Identity = 43/171 (25.15%), Postives = 75/171 (43.86%), Query Frame = 2
Query: 6539 LYFILLPEPWRGNIRVSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRK--PGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKR---PCGNSYYIGCIQVS 7036
            L+ + L  P  G+IR   A+  C + A     +  F+AFL    ++L +++         IVN   + LF +W  +F+G   +    +P+ +F+G DV+    W  K +W G      +     C  W +   TD  +T    + L   K++ +    C N   + CI+ S
Sbjct: 1197 LHLVALNTPVAGDIR---ADFQCFQQARAAGLLSTFRAFLSSHLQDLSTVVRKAERFGLPIVNLKGQVLFNNWDSIFSGDGGQFNTHIPIYSFDGRDVMTDPSWPQKVVWHGSNPHGVRLVDKYCEAWRT---TDMAVT-GFASPLSTGKILDQKAYSCANRLIVLCIENS 1360          
BLAST of collagen alpha-1(I) chain isoform X4 vs. TrEMBL
Match: A0A4D6FZQ0 (Mp-2 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=mp-2 PE=2 SV=1)

HSP 1 Score: 407.527 bits (1046), Expect = 4.785e-126
Identity = 218/225 (96.89%), Postives = 222/225 (98.67%), Query Frame = 2
Query: 5654 FPLNATDLELSMNRYEVTLNVSMDTSTISPGFTSNNNSDGRMKIDKWNXXXXXXXXXXXXXXXXXIAGSPGKPGKSEPCPISNCNLLKGEKGSPGIQGQCSTSTCLSIKGEKGDVGPIGPQGERGFMGEQGKSQQIYEDVIRKVVIEQLLIPDVQNLFKREKGEVGQATNCNCESSLTVSPKLRGLPGSPGKDGMGLDRIVNYGYGAIIVKSRDDLDRIGYYLSP 6328
            FPLNATDLELSMNRYEVTLNVSM+TST+SPGFTSNNNSDGRMKIDKWNKGEKGDKGNQGDKGDKGIAGSPGKPGKSE CPISNCNLLKGEKGSPG+QGQCSTSTCLSIKGEKGDVGPIGPQGERGFMGEQGKSQQIYEDVIRKVVIEQLLIPDVQNLFKREKGEVGQATNCNCESSLTVSPKLRGLPGSPGKDGMGLDRIVNYGY AIIVKSRDDL RIG+YLSP
Sbjct:   31 FPLNATDLELSMNRYEVTLNVSMNTSTLSPGFTSNNNSDGRMKIDKWNKGEKGDKGNQGDKGDKGIAGSPGKPGKSESCPISNCNLLKGEKGSPGVQGQCSTSTCLSIKGEKGDVGPIGPQGERGFMGEQGKSQQIYEDVIRKVVIEQLLIPDVQNLFKREKGEVGQATNCNCESSLTVSPKLRGLPGSPGKDGMGLDRIVNYGYXAIIVKSRDDLXRIGHYLSP 255          
BLAST of collagen alpha-1(I) chain isoform X4 vs. TrEMBL
Match: A0A5K4EKS9 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.124e-18
Identity = 97/384 (25.26%), Postives = 167/384 (43.49%), Query Frame = 2
Query: 5990 GDVGPIGPQGERGFMGEQGKSQQIYEDVIRKVVIEQLLIPDVQNLFKREKGEVGQATNCNCESSLTVSP--------KLRGLPGSPGKDGMGLDRIVNYGYGAIIVKSRDDLDRIGYYLSPGSLVLVINQENGSGMKKDPILMIKVTDNPNIWRQLNAFLGEEQFLPSSNTFKRIPVQKPNPDNI-------LHNQKKLYFILLPEPWRGNI----RVSEAN----HLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLD--IDP--W-RSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENV-----LFLNKVIKR-PCGNSYYIGCIQVSP 7039
            G  GP G +GE+G  GE   +      VI++ + + +L P++Q  F+  KG+ G+   C+C S    +P        +L     +          I+  GYGA+++ +  DL ++ +    G++  +         ++     +K  +  N WR +N        L S      +P+ KP P  +       +H  KKLY I   EP RG++    R++ A+      CQ+ A        F   L     N+  ++P  Y +   +VN + E LF  +  +  G S KP   LL F+G D+ D  + P  W   K +++ G  +   ++   CR+W S+ P + G+ ++L  V     LF  +  K   C     + CIQ++P
Sbjct:   47 GPQGPPGEKGEKGDPGEVDLTSDQSISVIKQAIHDFILQPEIQKQFRGPKGDPGE---CSCLSDAADNPSPKKDSNNELNSFKNNHNTKSNNNGEIL--GYGAMVLNTEMDLSKVSHTFPVGTMAYI---------READTFYLKTMEQTNTWRIIN--------LLSKADAINLPIPKPTPAPVFEPQYYPVHKGKKLYLIAQNEPLRGDLKYNDRITGAHAGSIFACQRAANLKGLGRAFYPLLSTDMFNMDYVVPPTYRYGVPLVNLHGEILFDDFMSLVEGRS-KPQAKLLNFDGVDITDDIVAPCLWIGQKPIYLNGDYEFAAQS--KCRNWQSTYPGENGLAVSLPIVDNAPGLFSKQNFKLISCSKFCRMLCIQITP 405          
BLAST of collagen alpha-1(I) chain isoform X4 vs. TrEMBL
Match: A0A443RZX5 (Collagen alpha-1(I) chain-like protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_00672 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 2.082e-17
Identity = 53/166 (31.93%), Postives = 91/166 (54.82%), Query Frame = 2
Query: 6554 LPEPWRGNIRVSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVP------LLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQV 7033
            L  P++G+I V +A+  C K A + + +G ++AFL  + +N+ S++  +    ++I+N     L+ SW ++F G     GVP      + +F G +V++ D W  K +W GG +   ++   +CR+WTSS+ TDFG    L     L +  K  C NS+ + C+QV
Sbjct:    4 LNVPYKGDIGVRDADFACYKQAKEGNVLGTYRAFLASRLQNIASIVNIRD-SRFRIMNTKGNVLYNSWRELFTG----EGVPYESSLEIYSFNGKNVMEDDTWPMKVIWHGGQVSGIRDINANCREWTSSNMTDFGKASTLRRNGLLGQE-KYSCNNSFIVLCVQV 163          
BLAST of collagen alpha-1(I) chain isoform X4 vs. TrEMBL
Match: A0A0X3NU02 (Endostatin domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR97739 PE=4 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 6.536e-17
Identity = 109/431 (25.29%), Postives = 175/431 (40.60%), Query Frame = 2
Query: 5855 GSPGKPGKSEPCPISNCNL---------LKGEKGSPGIQGQCSTSTCLSIKGEKGDVGPIGPQGERGFMGEQGKSQQIYEDVIRKVVIEQLLIPDVQNLFKREKGEVGQATNCNCESSLTVSPKLRGLPGSPGKDGMGLDRIVN----YGYGAIIVKSRDDLDRIGYYLSPGSLVLVINQENGSGMKKDPILMIKVTDNPNIWRQLNAFLGEEQF-LPSSNTFKRIPVQKPNPDNILHNQKKLYFILLPEPWRGNIRV--------SEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGAL-----DIYQETVPSCRDWTSSSPTD------FGMTINLENVLFLNKVIKRPCGNSYYIGCIQVSPYET 7048
            G  G PG+   CP S C++         L+G KG PG  GQC+   C          GP GP+G+ G  G          D++RK V+E    P+V+  F+      G   +C+C           G PG+P       D I+       YGA+++++   L +I Y L PGS+V V         ++D    +K     N+WR +      +   +PS    +     +    NI  + K+LY I   E   G +R         S A   CQ+ A +      F   L     N+  ++P    +   +VN   ET+F  +  +  G  +KP  P+L+F+G D+ + +P  S  +W+G        D        CR+W S+ P++           N   ++    + +  C    +I CIQ+ P + 
Sbjct:  130 GDAGPPGQDGVCP-SKCDVRLTTEEIERLRGPKGDPGPPGQCTLEMC----NATAIPGPQGPKGDPGEPGIFDPEDPKVVDLLRKTVVEYFNRPEVREQFR------GTPGDCSCT----------GNPGAPNNTNNPSDDILESLRKISYGAMVMENETSLAKIAYSLPPGSMVYV---------RQDDTFYLKTDTKDNVWRIVQMETASQAIKIPSPPPIQTTQPPQAPFPNI--SGKQLYLIAQSEALDGRLRFRAKLGGGHSGAIFACQREANNKRLGQSFYPLLSTDMFNMDYVVPPMNRYGLPLVNIRGETIFDDFMHLIRG-QQKPQAPILSFDGKDIFE-NPLAS-CLWLGAKPIYLNGDYEYAARSKCRNWQSNYPSEHALAAHLPPAANASGLVDQGNIYEESCSKRCHILCIQIIPSQA 525          
BLAST of collagen alpha-1(I) chain isoform X4 vs. TrEMBL
Match: A0A210QRN6 (Collagen alpha-1(XXVII) chain B OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT24311 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 6.959e-17
Identity = 114/427 (26.70%), Postives = 173/427 (40.52%), Query Frame = 2
Query: 5912 LKGEKGSPGIQGQCSTSTCLSIKGEKGDVGPIGPQGERGFMGEQGKSQQIYEDVIRKVVIEQLLIPDVQNLFKREKGEVGQATNCNCESSLTVSPKLRGLPG--------------------------------SPGKDGMGLDRIVNYGYGAIIVKSRDDLDRIGYYLSPGSLVLVINQENGSGMKKDPILMIKVTDNPNIWR--QLNAFL-----------GEEQFLPSSNTFKRIPVQKPNPDNILHNQKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSY-IG--IFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSR--KPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVI---KRPCGNSYYIGCIQ 7030
            L+G KG PG+QG       +S  G KG+       GERG  G  G S +   +    V        D  +  K EKGE G+           V P  RG PG                                +PG +G G   +     GA++  +  +L  + + L PG+ V + N+E          + I+V    N +R  QL  FL            E  +LP S++ + I              K+LY   L +P+ GNIR +  A++ C K + +    IG   F+A L   +++ +S++P        IVNK +E LF SW QM NG         P+ +F+GH+V     W+ K++W G        +  +C+ W S     F M+  L + L   K++   K  C N + + CIQ
Sbjct:  932 LRGPKGEPGVQGLGVIGGAIS-SGTKGE------PGERGLPGVPGSSGRDGNNGRPGVRGR-----DGDDGTKGEKGEAGREGR--------VGP--RGPPGPVSIGGYGESTFEGARGPAGPPGPQGRPGIPGTPGTNG-GPANLSGGSSGAVVFNAASELMTVAHSLPPGTFVYINNEEK---------VYIRVN---NGFRLIQLGQFLPLPTATTAPKTTEAPYLPPSDSGRLI---------NDRGAKRLYLFALNKPYAGNIRGIRGADYECYKESREAGISIGRKTFRALLSSSTQDFRSIVPLARDQLIPIVNKRDEILFDSWEQMLNGNGGTFNTSTPIYSFDGHNVRTSSRWKQKYVWHGSDRQGRMSSKLTCQGWHSG----FRMSEGLASNLLEGKMVETNKFSCNNEFVVLCIQ 1310          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Cavefish
Match: ENSAMXT00000057821.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:7857215:7863508:-1 gene:ENSAMXG00000033545.1 transcript:ENSAMXT00000057821.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 5.897e-13
Identity = 48/171 (28.07%), Postives = 84/171 (49.12%), Query Frame = 2
Query: 6533 KKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMF--NGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            KKL+ I L  P  G+++ +   +H C   A      G F+AFL  + ++L S++       + IVN  +E LF +W  +F  N    +  + + +F+G DVL+ D W  + +W G +   +++T   C  W + +    GM  +L++   L +   R C  S  + CI+ S
Sbjct:   35 KKLHLIALNSPQDGDMQGIRGVDHQCFLQAQAIGLKGTFRAFLSSRLQDLYSIVRRSDRDQYPIVNLRDEELFSNWDAIFSDNEGKIRDNIRIYSFDGRDVLEDDAW--QVVWHGSSTAGHRQTDSFCETWRTDNHAVTGMASSLQDGHLLQQT-PRSCSRSSILLCIENS 202          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Cavefish
Match: ENSAMXT00000043399.1 (pep primary_assembly:Astyanax_mexicanus-2.0:13:7857215:7862257:-1 gene:ENSAMXG00000033545.1 transcript:ENSAMXT00000043399.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 2.545e-11
Identity = 46/169 (27.22%), Postives = 82/169 (48.52%), Query Frame = 2
Query: 6539 LYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMF--NGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            L+ I L  P  G+++ +   +H C   A      G F+AFL  + ++L S++       + IVN  +E LF +W  +F  N    +  + + +F+G DVL+ D W  + +W G +   +++T   C  W + +    GM  +L++   L +   R C  S  + CI+ S
Sbjct:   67 LHLIALNSPQDGDMQGIRGVDHQCFLQAQAIGLKGTFRAFLSSRLQDLYSIVRRSDRDQYPIVNLRDEELFSNWDAIFSDNEGKIRDNIRIYSFDGRDVLEDDAW--QVVWHGSSTAGHRQTDSFCETWRTDNHAVTGMASSLQDGHLLQQT-PRSCSRSSILLCIENS 232          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Cavefish
Match: ENSAMXT00000037316.1 (pep primary_assembly:Astyanax_mexicanus-2.0:10:7642407:7655804:-1 gene:ENSAMXG00000043903.1 transcript:ENSAMXT00000037316.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 2.948e-8
Identity = 36/130 (27.69%), Postives = 62/130 (47.69%), Query Frame = 2
Query: 6536 KLYFILLPEPWRGNI-RVSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTS 6922
            +L  + L  P  G++  +  AN  C+  A       +++AFL    ++L  ++ A Y  S  IVN   E LF +W  +F+ +    G+PL +F+G DV+    W  K +W G +    +    +C  W +
Sbjct:   48 QLRLVALNTPQTGDLGSIHSANRQCRLQAQAMGIRDVYKAFLSHHLQDLSDVVQAPYRTSIPIVNLRGEILFKNWESIFSNHLLPSGIPLYSFDGRDVMSDPFWPQKAIWHGSSEGGRRLDDKNCESWRA 177          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003519.1 (pep scaffold:Pmarinus_7.0:GL476336:685424:702873:1 gene:ENSPMAG00000003217.1 transcript:ENSPMAT00000003519.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 2.571e-14
Identity = 61/222 (27.48%), Postives = 96/222 (43.24%), Query Frame = 2
Query: 6413 PNIWRQLNAFLGEEQFLPSSNTFKRIPVQKP-----------NPDNILHNQKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMF--NGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVS 7036
            P  WR+L   LG   F    NT    P Q P            P +      +LY   L  P  G++  +  A+ LC + A      G F+AFL   +++L +++         I+N   E LFF+W+ +F  +G S  P  P+ +F+G +VL    W  K +W G       +   SC  W SSS  D G    L++   L++     C + + + C++ S
Sbjct:  354 PGGWRKLA--LGLSVF----NTTPYSPTQPPLRFFLISNVTLTPQHPAGPAPQLYMAALNTPIMGSMGGLRGADTLCFRQARSAGLAGTFRAFLASPNQDLHAIVDRDEASQVPILNLKNELLFFNWNSLFTGDGASFNPNAPIYSFDGGNVLTDSKWPFKLVWHGADEQGRHKNGHSCTGWRSSS-DDVGQASALQSGRLLDQHTHH-CASHFVVLCVENS 567          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009156.1 (pep scaffold:Pmarinus_7.0:GL476573:61536:110082:-1 gene:ENSPMAG00000008210.1 transcript:ENSPMAT00000009156.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 4.815e-8
Identity = 45/172 (26.16%), Postives = 76/172 (44.19%), Query Frame = 2
Query: 6536 KLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKP--GVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIG--CIQVS 7036
            +L+ I L EP  G +  +  A+  C + A      G F+AFL  + ++L S++      S  I+N   E L+ +W+++F+G   +    VP+ +F+G D+L    W  K +W G      +     C  W        G    L +   L    ++P G S  +   CI+ S
Sbjct: 1175 QLHLIALNEPQPGAMHGIRGADFQCFQQARAIGLHGTFRAFLSSKVQDLVSIVRRADRDSMPIINLRGEVLYRNWNEIFSGSEGQLNYNVPIYSFDGRDILTDPAWPQKHVWHGSDAHGRRLVTQYCEMWRVGDSAVTGQASPLASRRLLQ---QQPLGCSSVLAVLCIENS 1343          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Medaka
Match: col18a1a (collagen type XVIII alpha 1 chain a [Source:ZFIN;Acc:ZDB-GENE-030516-3])

HSP 1 Score: 69.707 bits (169), Expect = 3.910e-11
Identity = 52/204 (25.49%), Postives = 89/204 (43.63%), Query Frame = 2
Query: 6464 PSSNTFKRIPVQKPNP------DNILHNQKKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRK--PGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQ---VSP 7039
            PS   +   P ++PNP      +        L  I L  P  GN++ +   ++LC + A      G F+AFL  + ++L +++         IVN   + LF SW  +F     K    VP+ +F+G D+L    W  K +W G +   +++T   C  W +      G+  +L++   L +     C  +  + CI+   VSP
Sbjct: 1029 PSDGKYAVTPQRRPNPPVPGPVETSTLGVSGLRLIALNTPQSGNMKGIRGPDYLCFEQARAAGLRGTFRAFLSSKVQDLHTIVRHSDREKPPIVNLKNQVLFDSWQSIFGESVSKMRKNVPIYSFDGRDILRDSAWPEKMVWHGSSKKGHRQTDQYCEAWRAGDQAVTGLASSLQSSHLLQQT-PTSCSRACIVLCIENAMVSP 1231          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Medaka
Match: col18a1a (collagen type XVIII alpha 1 chain a [Source:ZFIN;Acc:ZDB-GENE-030516-3])

HSP 1 Score: 65.855 bits (159), Expect = 5.072e-11
Identity = 46/175 (26.29%), Postives = 80/175 (45.71%), Query Frame = 2
Query: 6533 KKLYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRK--PGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQ---VSP 7039
            ++L  I L  P  GN++ +   ++LC + A      G F+AFL  + ++L +++         IVN     LF SW  +F     K    VP+ +F+G D+L    W  K +W G +   +++T   C  W +      G+  +L++   L +     C  +  + CI+   VSP
Sbjct:   60 RQLRLIALNTPQSGNMKGIRGPDYLCFEQARAAGLRGTFRAFLSSKVQDLHTIVRHSDREKPPIVNLKVRLLFDSWQSIFGESVSKMRKNVPIYSFDGRDILRDSAWPEKMVWHGSSKKGHRQTDQYCEAWRAGDQAVTGLASSLQSSHLLQQT-PTSCSRACIVLCIENAMVSP 233          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Medaka
Match: ENSORLT00000002294.2 (pep primary_assembly:ASM223467v1:2:12378816:12382011:1 gene:ENSORLG00000001841.2 transcript:ENSORLT00000002294.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 5.214e-10
Identity = 41/149 (27.52%), Postives = 69/149 (46.31%), Query Frame = 2
Query: 6539 LYFILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNK 6982
            L+ I L  P  G++  +   + +C K A      G F+AFL  + ++L S++ +   ++  IVN  +E LF SW  +F        V + +F+G DVL  D W  K +W G + +  +     C  W  +     GM  +L    F+ +
Sbjct:   44 LHIIALNAPQSGSMHGLIGVDAMCYKQAQAIKMKGTFRAFLSSRLQDLYSIVHSAQRNAVPIVNLKDEVLFDSWINIFKEGKINENVSIYSFDGKDVLRDDTWPEKMVWHGSSHEGQRNVNNMCESWRVNDQAVTGMAASLLQGSFMQQ 192          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Medaka
Match: ENSORLT00000031348.1 (pep primary_assembly:ASM223467v1:17:19717601:19722917:1 gene:ENSORLG00000023987.1 transcript:ENSORLT00000031348.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 9.711e-10
Identity = 43/164 (26.22%), Postives = 73/164 (44.51%), Query Frame = 2
Query: 6548 ILLPEPWRGNIR-VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMF--NGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQ 7030
            + L  P +G++R +  A+  C + A    +   ++AFL    ++L +++     H+  +VN   E LF SW  +F  NG   +P   + +F G DV+  D    K +W G      + T   C  W ++     G    L+    L +   R C N Y + CI+
Sbjct:   57 VALNAPLKGDMRGIRGADLQCYQQARSMGHTSTYRAFLSSHLQDLATIVRKADRHNLPVVNLKGEVLFSSWMSIFSGNGGVFEPSASIYSFNGRDVM-TDSAPEKMVWHGSNAVGTRLTTNYCEAWRTADMAVTGQAALLQTGRLLGQ-HARSCSNHYIVLCIE 218          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Medaka
Match: ENSORLT00000042441.1 (pep primary_assembly:ASM223467v1:2:12377917:12382011:1 gene:ENSORLG00000001841.2 transcript:ENSORLT00000042441.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 9.709e-9
Identity = 36/127 (28.35%), Postives = 59/127 (46.46%), Query Frame = 2
Query: 6602 LCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNK 6982
            +C K A      G F+AFL  + ++L S++ +   ++  IVN  +E LF SW  +F        V + +F+G DVL  D W  K +W G + +  +     C  W  +     GM  +L    F+ +
Sbjct:   58 MCYKQAQAIKMKGTFRAFLSSRLQDLYSIVHSAQRNAVPIVNLKDEVLFDSWINIFKEGKINENVSIYSFDGKDVLRDDTWPEKMVWHGSSHEGQRNVNNMCESWRVNDQAVTGMAASLLQGSFMQQ 184          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Planmine SMEST
Match: SMESG000071150.1 (SMESG000071150.1)

HSP 1 Score: 3021.11 bits (7831), Expect = 0.000e+0
Identity = 1675/1675 (100.00%), Postives = 1675/1675 (100.00%), Query Frame = 2
Query:  293 MMLLCKTRICLFGITCIFFSLYNANDIFQGDLLYEFKDKLIGNPSVILNFFNLADEDASQDPKETDSSDSNAGIEIHSPILIEKPANLFLMNDKIPEELSVFVKFKPKYDPIKGSYKSGFLFSILDPDLETIRFAVQFRVVLFGHAVINEMWIYLNDNINRKGQTDPIAKVTLPTIQSVIAEDTITFSFKLTGSTITTWHGCPQQSTYLSSEKITRSVNENQMPPGTAFYLLSGGPSLKNTFTGKVLGLRFYKSVSGIDEYCAENEIQGSGSTKKFKRILPEKFGNVLIQTSTTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVVIPKNILTSTDILTSSNTKQYKLDQQSPGSDKTDIISTIXXXXXXXXXXXXXXIAVKAISPKSXXXXXXXXXXXXXXXLKSTEINIFNRKDILSDFIQNEPKIDGVFIQRSDEEDLTVQVKKRVNLARPSILYFSNNKFPTDFGFSIEFNFQQTDGYLFALVDPDGTTVRLGLRIQNQTDSMNGDSLKMRKLFLYFNDDVNIVGEEISVSSVPLPMTNKRKSFLFYIFISQTQVTIWSGCPLDENQISNVGIKRNLETNMKKGSALYLFSAGDLLKGYFKGTVHQLKLFYSFESMMSTCNKKIEGSGKVSDRISSPVTDEPDSEDNQITDEPITIMTDLTKLPESTINKDVXXXXXXXXXXXXSNMENLPSGVKLNINQPDTEETHIEIKEKVTIQQPAMMIYPNLKFPNDLGIIVDFIPNEGFILSIMDQDLSTIRLALSVSIKNQEVXXXXXXXXXXXXXXXDRTFSPMSSESIVASVPLSDKTDDHFQKSKFLKLSILISRMKISIWSKCPSDEMILYEHEITRSSEEPNMKIGGSIYLFSAGPLLNGYYMGSIRSLKLFNSKENLLATCKQNQIEGSGKQTIPPIIGNVLEEESTTRKKEISTTPESSTKVSTTQNLSRKVAEKILESTTTLSGKVSDRINLTISSTYPSTFSQLVSISTVEKGMMNTNSTFIVEEPLDASTKKLKIFTDSEIENSERDESLIPEDFLNEYLISKVPTPGIISTIFNEDSEETKIKVIKDVHISKPSMIYFPNNKFPRELGFVAEFVPSSEVSKSFLFAFIDPDLKTLRLAVEISWITEEMSGIQSKELKVGVYLKDDNNLEVLPQKPIISANLFISQANKKSTYKISFLINENDIQLWHECPSPKNLIRTAIYKRNNKNQNLKPGGILYLFSGGPSLQNYYQGEILSLKMIKSSDQLIKNCRSVELEGSGTRIIPRIEGNILITETTKSSKKIRPLKTKLTSPGIETSTTESVVTKQSKENITSSKSTFTNXXXXXXXXXXXXXXXXXXXXXXXXRPTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSSMIINPDLEENGVTDSSGNENESEFDLLREYLVXXXXXXXXXXXXLHEDSEEIKIKINQDVLISKPSMIYFPNNKFPSELGVIAEFRSSSEKGEAFLFSFVDPDLKTLRLGFQTSWKTHEISGIETKSLFINVFFKDNDVSDQYPQKPILSANLFNIPSNKKSSYKMSFLMKGDEFQLWNDCPSPQNQIRSTRYSRSYENENLKTGGILYLFSGGPDLTDYFQGEIITLEMFGTNEKLLRKCRTSEIEGSGKFIIPKIQGNALITKEQNATNISTVKTKQ 5317
            MMLLCKTRICLFGITCIFFSLYNANDIFQGDLLYEFKDKLIGNPSVILNFFNLADEDASQDPKETDSSDSNAGIEIHSPILIEKPANLFLMNDKIPEELSVFVKFKPKYDPIKGSYKSGFLFSILDPDLETIRFAVQFRVVLFGHAVINEMWIYLNDNINRKGQTDPIAKVTLPTIQSVIAEDTITFSFKLTGSTITTWHGCPQQSTYLSSEKITRSVNENQMPPGTAFYLLSGGPSLKNTFTGKVLGLRFYKSVSGIDEYCAENEIQGSGSTKKFKRILPEKFGNVLIQTSTTKRTERPTSTSTLSTTTTELPTSTTEQKSTSTTTKVVIPKNILTSTDILTSSNTKQYKLDQQSPGSDKTDIISTINSNDLNNKSLNDKKIAVKAISPKSINFNNGNNFENSSEILKSTEINIFNRKDILSDFIQNEPKIDGVFIQRSDEEDLTVQVKKRVNLARPSILYFSNNKFPTDFGFSIEFNFQQTDGYLFALVDPDGTTVRLGLRIQNQTDSMNGDSLKMRKLFLYFNDDVNIVGEEISVSSVPLPMTNKRKSFLFYIFISQTQVTIWSGCPLDENQISNVGIKRNLETNMKKGSALYLFSAGDLLKGYFKGTVHQLKLFYSFESMMSTCNKKIEGSGKVSDRISSPVTDEPDSEDNQITDEPITIMTDLTKLPESTINKDVIAIFDIIETFIISNMENLPSGVKLNINQPDTEETHIEIKEKVTIQQPAMMIYPNLKFPNDLGIIVDFIPNEGFILSIMDQDLSTIRLALSVSIKNQEVNNQIIQIKQFNIHFNDRTFSPMSSESIVASVPLSDKTDDHFQKSKFLKLSILISRMKISIWSKCPSDEMILYEHEITRSSEEPNMKIGGSIYLFSAGPLLNGYYMGSIRSLKLFNSKENLLATCKQNQIEGSGKQTIPPIIGNVLEEESTTRKKEISTTPESSTKVSTTQNLSRKVAEKILESTTTLSGKVSDRINLTISSTYPSTFSQLVSISTVEKGMMNTNSTFIVEEPLDASTKKLKIFTDSEIENSERDESLIPEDFLNEYLISKVPTPGIISTIFNEDSEETKIKVIKDVHISKPSMIYFPNNKFPRELGFVAEFVPSSEVSKSFLFAFIDPDLKTLRLAVEISWITEEMSGIQSKELKVGVYLKDDNNLEVLPQKPIISANLFISQANKKSTYKISFLINENDIQLWHECPSPKNLIRTAIYKRNNKNQNLKPGGILYLFSGGPSLQNYYQGEILSLKMIKSSDQLIKNCRSVELEGSGTRIIPRIEGNILITETTKSSKKIRPLKTKLTSPGIETSTTESVVTKQSKENITSSKSTFTNSEWSKSSTMTSQSTESPSQSTITIRPTDFSISESTSTKSSSKTKQISKKKSFTKKKSKKKLSTLEPSTVSSMIINPDLEENGVTDSSGNENESEFDLLREYLVPQIQTPGIIPTILHEDSEEIKIKINQDVLISKPSMIYFPNNKFPSELGVIAEFRSSSEKGEAFLFSFVDPDLKTLRLGFQTSWKTHEISGIETKSLFINVFFKDNDVSDQYPQKPILSANLFNIPSNKKSSYKMSFLMKGDEFQLWNDCPSPQNQIRSTRYSRSYENENLKTGGILYLFSGGPDLTDYFQGEIITLEMFGTNEKLLRKCRTSEIEGSGKFIIPKIQGNALITKEQNATNISTVKTKQ
Sbjct:    1 MMLLCKTRICLFGITCIFFSLYNANDIFQGDLLYEFKDKLIGNPSVILNFFNLADEDASQDPKETDSSDSNAGIEIHSPILIEKPANLFLMNDKIPEELSVFVKFKPKYDPIKGSYKSGFLFSILDPDLETIRFAVQFRVVLFGHAVINEMWIYLNDNINRKGQTDPIAKVTLPTIQSVIAEDTITFSFKLTGSTITTWHGCPQQSTYLSSEKITRSVNENQMPPGTAFYLLSGGPSLKNTFTGKVLGLRFYKSVSGIDEYCAENEIQGSGSTKKFKRILPEKFGNVLIQTSTTKRTERPTSTSTLSTTTTELPTSTTEQKSTSTTTKVVIPKNILTSTDILTSSNTKQYKLDQQSPGSDKTDIISTINSNDLNNKSLNDKKIAVKAISPKSINFNNGNNFENSSEILKSTEINIFNRKDILSDFIQNEPKIDGVFIQRSDEEDLTVQVKKRVNLARPSILYFSNNKFPTDFGFSIEFNFQQTDGYLFALVDPDGTTVRLGLRIQNQTDSMNGDSLKMRKLFLYFNDDVNIVGEEISVSSVPLPMTNKRKSFLFYIFISQTQVTIWSGCPLDENQISNVGIKRNLETNMKKGSALYLFSAGDLLKGYFKGTVHQLKLFYSFESMMSTCNKKIEGSGKVSDRISSPVTDEPDSEDNQITDEPITIMTDLTKLPESTINKDVIAIFDIIETFIISNMENLPSGVKLNINQPDTEETHIEIKEKVTIQQPAMMIYPNLKFPNDLGIIVDFIPNEGFILSIMDQDLSTIRLALSVSIKNQEVNNQIIQIKQFNIHFNDRTFSPMSSESIVASVPLSDKTDDHFQKSKFLKLSILISRMKISIWSKCPSDEMILYEHEITRSSEEPNMKIGGSIYLFSAGPLLNGYYMGSIRSLKLFNSKENLLATCKQNQIEGSGKQTIPPIIGNVLEEESTTRKKEISTTPESSTKVSTTQNLSRKVAEKILESTTTLSGKVSDRINLTISSTYPSTFSQLVSISTVEKGMMNTNSTFIVEEPLDASTKKLKIFTDSEIENSERDESLIPEDFLNEYLISKVPTPGIISTIFNEDSEETKIKVIKDVHISKPSMIYFPNNKFPRELGFVAEFVPSSEVSKSFLFAFIDPDLKTLRLAVEISWITEEMSGIQSKELKVGVYLKDDNNLEVLPQKPIISANLFISQANKKSTYKISFLINENDIQLWHECPSPKNLIRTAIYKRNNKNQNLKPGGILYLFSGGPSLQNYYQGEILSLKMIKSSDQLIKNCRSVELEGSGTRIIPRIEGNILITETTKSSKKIRPLKTKLTSPGIETSTTESVVTKQSKENITSSKSTFTNSEWSKSSTMTSQSTESPSQSTITIRPTDFSISESTSTKSSSKTKQISKKKSFTKKKSKKKLSTLEPSTVSSMIINPDLEENGVTDSSGNENESEFDLLREYLVPQIQTPGIIPTILHEDSEEIKIKINQDVLISKPSMIYFPNNKFPSELGVIAEFRSSSEKGEAFLFSFVDPDLKTLRLGFQTSWKTHEISGIETKSLFINVFFKDNDVSDQYPQKPILSANLFNIPSNKKSSYKMSFLMKGDEFQLWNDCPSPQNQIRSTRYSRSYENENLKTGGILYLFSGGPDLTDYFQGEIITLEMFGTNEKLLRKCRTSEIEGSGKFIIPKIQGNALITKEQNATNISTVKTKQ 1675          

HSP 2 Score: 112.464 bits (280), Expect = 4.022e-24
Identity = 98/300 (32.67%), Postives = 154/300 (51.33%), Query Frame = 2
Query: 2393 GVKLNINQPDTEETHIEIKEKVTIQQPAMMIYPNLKFPNDLGIIVDFIPN----EGFILSIMDQDLSTIRLALSVSIKNQEVXXXXXXXXXXXXXXXDRTFSPMSSESIVASVPLSDKTDDHFQKSKFLKLSILISRMKISIWSKCPSDEMILYEHEITRSSEEPNMKIGGSIYLFSAGPLLNGYYMGSIRSLKLFNSKENLLATCKQNQIEGSGKQTIPPIIGNVL--EEE-----STTRKKEI--------STTPESSTKVSTTQNLSRKVAEKILESTTTLSGKVSDRINLTISSTY 3235
            G+   I   D+EE  I+I + V I +P+M+ +PN KFP++LG+I +F  +    E F+ S +D DL T+RL    S K  E++    +    N+ F D   S    +  + S  L +   +  +KS + K+S L+   +  +W+ CPS +  +     +RS E  N+K GG +YLFS GP L  Y+ G I +L++F + E LL  C+ ++IEGSGK  IP I GN L  +E+     ST + K+I        +TT   +T    T     +   K   STTT +   +  +  T ++T 
Sbjct: 1435 GIIPTILHEDSEEIKIKINQDVLISKPSMIYFPNNKFPSELGVIAEFRSSSEKGEAFLFSFVDPDLKTLRLGFQTSWKTHEISGIETKSLFINVFFKDNDVSDQYPQKPILSANLFNIPSN--KKSSY-KMSFLMKGDEFQLWNDCPSPQNQIRSTRYSRSYENENLKTGGILYLFSGGPDLTDYFQGEIITLEMFGTNEKLLRKCRTSEIEGSGKFIIPKIQGNALITKEQNATNISTVKTKQIINSTKPTTTTTIPPTTTTIPTTTTLLQTTTKTTMSTTTTTKPTTTTLQQTTTTTI 1731          

HSP 3 Score: 60.4622 bits (145), Expect = 2.067e-8
Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 1
Query: 5530 KYNYHNPHYNYVAIHYNHTASKXXXXXXXXXXXXXXXKFNPISIKCD 5670
            KYNYHNPHYNYVAIHYNHTASKYNYNNTHHDYYNTNYKFNPISIKCD
Sbjct: 2995 KYNYHNPHYNYVAIHYNHTASKYNYNNTHHDYYNTNYKFNPISIKCD 3041          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Planmine SMEST
Match: SMESG000071150.1 (SMESG000071150.1)

HSP 1 Score: 3018.41 bits (7824), Expect = 0.000e+0
Identity = 1674/1674 (100.00%), Postives = 1674/1674 (100.00%), Query Frame = 2
Query:  296 MLLCKTRICLFGITCIFFSLYNANDIFQGDLLYEFKDKLIGNPSVILNFFNLADEDASQDPKETDSSDSNAGIEIHSPILIEKPANLFLMNDKIPEELSVFVKFKPKYDPIKGSYKSGFLFSILDPDLETIRFAVQFRVVLFGHAVINEMWIYLNDNINRKGQTDPIAKVTLPTIQSVIAEDTITFSFKLTGSTITTWHGCPQQSTYLSSEKITRSVNENQMPPGTAFYLLSGGPSLKNTFTGKVLGLRFYKSVSGIDEYCAENEIQGSGSTKKFKRILPEKFGNVLIQTSTTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVVIPKNILTSTDILTSSNTKQYKLDQQSPGSDKTDIISTIXXXXXXXXXXXXXXIAVKAISPKSXXXXXXXXXXXXXXXLKSTEINIFNRKDILSDFIQNEPKIDGVFIQRSDEEDLTVQVKKRVNLARPSILYFSNNKFPTDFGFSIEFNFQQTDGYLFALVDPDGTTVRLGLRIQNQTDSMNGDSLKMRKLFLYFNDDVNIVGEEISVSSVPLPMTNKRKSFLFYIFISQTQVTIWSGCPLDENQISNVGIKRNLETNMKKGSALYLFSAGDLLKGYFKGTVHQLKLFYSFESMMSTCNKKIEGSGKVSDRISSPVTDEPDSEDNQITDEPITIMTDLTKLPESTINKDVXXXXXXXXXXXXSNMENLPSGVKLNINQPDTEETHIEIKEKVTIQQPAMMIYPNLKFPNDLGIIVDFIPNEGFILSIMDQDLSTIRLALSVSIKNQEVXXXXXXXXXXXXXXXDRTFSPMSSESIVASVPLSDKTDDHFQKSKFLKLSILISRMKISIWSKCPSDEMILYEHEITRSSEEPNMKIGGSIYLFSAGPLLNGYYMGSIRSLKLFNSKENLLATCKQNQIEGSGKQTIPPIIGNVLEEESTTRKKEISTTPESSTKVSTTQNLSRKVAEKILESTTTLSGKVSDRINLTISSTYPSTFSQLVSISTVEKGMMNTNSTFIVEEPLDASTKKLKIFTDSEIENSERDESLIPEDFLNEYLISKVPTPGIISTIFNEDSEETKIKVIKDVHISKPSMIYFPNNKFPRELGFVAEFVPSSEVSKSFLFAFIDPDLKTLRLAVEISWITEEMSGIQSKELKVGVYLKDDNNLEVLPQKPIISANLFISQANKKSTYKISFLINENDIQLWHECPSPKNLIRTAIYKRNNKNQNLKPGGILYLFSGGPSLQNYYQGEILSLKMIKSSDQLIKNCRSVELEGSGTRIIPRIEGNILITETTKSSKKIRPLKTKLTSPGIETSTTESVVTKQSKENITSSKSTFTNXXXXXXXXXXXXXXXXXXXXXXXXRPTDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSSMIINPDLEENGVTDSSGNENESEFDLLREYLVXXXXXXXXXXXXLHEDSEEIKIKINQDVLISKPSMIYFPNNKFPSELGVIAEFRSSSEKGEAFLFSFVDPDLKTLRLGFQTSWKTHEISGIETKSLFINVFFKDNDVSDQYPQKPILSANLFNIPSNKKSSYKMSFLMKGDEFQLWNDCPSPQNQIRSTRYSRSYENENLKTGGILYLFSGGPDLTDYFQGEIITLEMFGTNEKLLRKCRTSEIEGSGKFIIPKIQGNALITKEQNATNISTVKTKQ 5317
            MLLCKTRICLFGITCIFFSLYNANDIFQGDLLYEFKDKLIGNPSVILNFFNLADEDASQDPKETDSSDSNAGIEIHSPILIEKPANLFLMNDKIPEELSVFVKFKPKYDPIKGSYKSGFLFSILDPDLETIRFAVQFRVVLFGHAVINEMWIYLNDNINRKGQTDPIAKVTLPTIQSVIAEDTITFSFKLTGSTITTWHGCPQQSTYLSSEKITRSVNENQMPPGTAFYLLSGGPSLKNTFTGKVLGLRFYKSVSGIDEYCAENEIQGSGSTKKFKRILPEKFGNVLIQTSTTKRTERPTSTSTLSTTTTELPTSTTEQKSTSTTTKVVIPKNILTSTDILTSSNTKQYKLDQQSPGSDKTDIISTINSNDLNNKSLNDKKIAVKAISPKSINFNNGNNFENSSEILKSTEINIFNRKDILSDFIQNEPKIDGVFIQRSDEEDLTVQVKKRVNLARPSILYFSNNKFPTDFGFSIEFNFQQTDGYLFALVDPDGTTVRLGLRIQNQTDSMNGDSLKMRKLFLYFNDDVNIVGEEISVSSVPLPMTNKRKSFLFYIFISQTQVTIWSGCPLDENQISNVGIKRNLETNMKKGSALYLFSAGDLLKGYFKGTVHQLKLFYSFESMMSTCNKKIEGSGKVSDRISSPVTDEPDSEDNQITDEPITIMTDLTKLPESTINKDVIAIFDIIETFIISNMENLPSGVKLNINQPDTEETHIEIKEKVTIQQPAMMIYPNLKFPNDLGIIVDFIPNEGFILSIMDQDLSTIRLALSVSIKNQEVNNQIIQIKQFNIHFNDRTFSPMSSESIVASVPLSDKTDDHFQKSKFLKLSILISRMKISIWSKCPSDEMILYEHEITRSSEEPNMKIGGSIYLFSAGPLLNGYYMGSIRSLKLFNSKENLLATCKQNQIEGSGKQTIPPIIGNVLEEESTTRKKEISTTPESSTKVSTTQNLSRKVAEKILESTTTLSGKVSDRINLTISSTYPSTFSQLVSISTVEKGMMNTNSTFIVEEPLDASTKKLKIFTDSEIENSERDESLIPEDFLNEYLISKVPTPGIISTIFNEDSEETKIKVIKDVHISKPSMIYFPNNKFPRELGFVAEFVPSSEVSKSFLFAFIDPDLKTLRLAVEISWITEEMSGIQSKELKVGVYLKDDNNLEVLPQKPIISANLFISQANKKSTYKISFLINENDIQLWHECPSPKNLIRTAIYKRNNKNQNLKPGGILYLFSGGPSLQNYYQGEILSLKMIKSSDQLIKNCRSVELEGSGTRIIPRIEGNILITETTKSSKKIRPLKTKLTSPGIETSTTESVVTKQSKENITSSKSTFTNSEWSKSSTMTSQSTESPSQSTITIRPTDFSISESTSTKSSSKTKQISKKKSFTKKKSKKKLSTLEPSTVSSMIINPDLEENGVTDSSGNENESEFDLLREYLVPQIQTPGIIPTILHEDSEEIKIKINQDVLISKPSMIYFPNNKFPSELGVIAEFRSSSEKGEAFLFSFVDPDLKTLRLGFQTSWKTHEISGIETKSLFINVFFKDNDVSDQYPQKPILSANLFNIPSNKKSSYKMSFLMKGDEFQLWNDCPSPQNQIRSTRYSRSYENENLKTGGILYLFSGGPDLTDYFQGEIITLEMFGTNEKLLRKCRTSEIEGSGKFIIPKIQGNALITKEQNATNISTVKTKQ
Sbjct:    1 MLLCKTRICLFGITCIFFSLYNANDIFQGDLLYEFKDKLIGNPSVILNFFNLADEDASQDPKETDSSDSNAGIEIHSPILIEKPANLFLMNDKIPEELSVFVKFKPKYDPIKGSYKSGFLFSILDPDLETIRFAVQFRVVLFGHAVINEMWIYLNDNINRKGQTDPIAKVTLPTIQSVIAEDTITFSFKLTGSTITTWHGCPQQSTYLSSEKITRSVNENQMPPGTAFYLLSGGPSLKNTFTGKVLGLRFYKSVSGIDEYCAENEIQGSGSTKKFKRILPEKFGNVLIQTSTTKRTERPTSTSTLSTTTTELPTSTTEQKSTSTTTKVVIPKNILTSTDILTSSNTKQYKLDQQSPGSDKTDIISTINSNDLNNKSLNDKKIAVKAISPKSINFNNGNNFENSSEILKSTEINIFNRKDILSDFIQNEPKIDGVFIQRSDEEDLTVQVKKRVNLARPSILYFSNNKFPTDFGFSIEFNFQQTDGYLFALVDPDGTTVRLGLRIQNQTDSMNGDSLKMRKLFLYFNDDVNIVGEEISVSSVPLPMTNKRKSFLFYIFISQTQVTIWSGCPLDENQISNVGIKRNLETNMKKGSALYLFSAGDLLKGYFKGTVHQLKLFYSFESMMSTCNKKIEGSGKVSDRISSPVTDEPDSEDNQITDEPITIMTDLTKLPESTINKDVIAIFDIIETFIISNMENLPSGVKLNINQPDTEETHIEIKEKVTIQQPAMMIYPNLKFPNDLGIIVDFIPNEGFILSIMDQDLSTIRLALSVSIKNQEVNNQIIQIKQFNIHFNDRTFSPMSSESIVASVPLSDKTDDHFQKSKFLKLSILISRMKISIWSKCPSDEMILYEHEITRSSEEPNMKIGGSIYLFSAGPLLNGYYMGSIRSLKLFNSKENLLATCKQNQIEGSGKQTIPPIIGNVLEEESTTRKKEISTTPESSTKVSTTQNLSRKVAEKILESTTTLSGKVSDRINLTISSTYPSTFSQLVSISTVEKGMMNTNSTFIVEEPLDASTKKLKIFTDSEIENSERDESLIPEDFLNEYLISKVPTPGIISTIFNEDSEETKIKVIKDVHISKPSMIYFPNNKFPRELGFVAEFVPSSEVSKSFLFAFIDPDLKTLRLAVEISWITEEMSGIQSKELKVGVYLKDDNNLEVLPQKPIISANLFISQANKKSTYKISFLINENDIQLWHECPSPKNLIRTAIYKRNNKNQNLKPGGILYLFSGGPSLQNYYQGEILSLKMIKSSDQLIKNCRSVELEGSGTRIIPRIEGNILITETTKSSKKIRPLKTKLTSPGIETSTTESVVTKQSKENITSSKSTFTNSEWSKSSTMTSQSTESPSQSTITIRPTDFSISESTSTKSSSKTKQISKKKSFTKKKSKKKLSTLEPSTVSSMIINPDLEENGVTDSSGNENESEFDLLREYLVPQIQTPGIIPTILHEDSEEIKIKINQDVLISKPSMIYFPNNKFPSELGVIAEFRSSSEKGEAFLFSFVDPDLKTLRLGFQTSWKTHEISGIETKSLFINVFFKDNDVSDQYPQKPILSANLFNIPSNKKSSYKMSFLMKGDEFQLWNDCPSPQNQIRSTRYSRSYENENLKTGGILYLFSGGPDLTDYFQGEIITLEMFGTNEKLLRKCRTSEIEGSGKFIIPKIQGNALITKEQNATNISTVKTKQ 1674          

HSP 2 Score: 112.464 bits (280), Expect = 4.022e-24
Identity = 98/300 (32.67%), Postives = 154/300 (51.33%), Query Frame = 2
Query: 2393 GVKLNINQPDTEETHIEIKEKVTIQQPAMMIYPNLKFPNDLGIIVDFIPN----EGFILSIMDQDLSTIRLALSVSIKNQEVXXXXXXXXXXXXXXXDRTFSPMSSESIVASVPLSDKTDDHFQKSKFLKLSILISRMKISIWSKCPSDEMILYEHEITRSSEEPNMKIGGSIYLFSAGPLLNGYYMGSIRSLKLFNSKENLLATCKQNQIEGSGKQTIPPIIGNVL--EEE-----STTRKKEI--------STTPESSTKVSTTQNLSRKVAEKILESTTTLSGKVSDRINLTISSTY 3235
            G+   I   D+EE  I+I + V I +P+M+ +PN KFP++LG+I +F  +    E F+ S +D DL T+RL    S K  E++    +    N+ F D   S    +  + S  L +   +  +KS + K+S L+   +  +W+ CPS +  +     +RS E  N+K GG +YLFS GP L  Y+ G I +L++F + E LL  C+ ++IEGSGK  IP I GN L  +E+     ST + K+I        +TT   +T    T     +   K   STTT +   +  +  T ++T 
Sbjct: 1434 GIIPTILHEDSEEIKIKINQDVLISKPSMIYFPNNKFPSELGVIAEFRSSSEKGEAFLFSFVDPDLKTLRLGFQTSWKTHEISGIETKSLFINVFFKDNDVSDQYPQKPILSANLFNIPSN--KKSSY-KMSFLMKGDEFQLWNDCPSPQNQIRSTRYSRSYENENLKTGGILYLFSGGPDLTDYFQGEIITLEMFGTNEKLLRKCRTSEIEGSGKFIIPKIQGNALITKEQNATNISTVKTKQIINSTKPTTTTTIPPTTTTIPTTTTLLQTTTKTTMSTTTTTKPTTTTLQQTTTTTI 1730          

HSP 3 Score: 60.4622 bits (145), Expect = 2.067e-8
Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 1
Query: 5530 KYNYHNPHYNYVAIHYNHTASKXXXXXXXXXXXXXXXKFNPISIKCD 5670
            KYNYHNPHYNYVAIHYNHTASKYNYNNTHHDYYNTNYKFNPISIKCD
Sbjct: 2994 KYNYHNPHYNYVAIHYNHTASKYNYNNTHHDYYNTNYKFNPISIKCD 3040          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Planmine SMEST
Match: SMESG000071152.1 (SMESG000071152.1)

HSP 1 Score: 859.366 bits (2219), Expect = 0.000e+0
Identity = 435/435 (100.00%), Postives = 435/435 (100.00%), Query Frame = 2
Query: 5753 SNNNSDGRMKIDKWNXXXXXXXXXXXXXXXXXIAGSPGKPGKSEPCPISNCNLLKGEKGSPGIQGQCSTSTCLSIKGEKGDVGPIGPQGERGFMGEQGKSQQIYEDVIRKVVIEQLLIPDVQNLFKREKGEVGQATNCNCESSLTVSPKLRGLPGSPGKDGMGLDRIVNYGYGAIIVKSRDDLDRIGYYLSPGSLVLVINQENGSGMKKDPILMIKVTDNPNIWRQLNAFLGEEQFLPSSNTFKRIPVQKPNPDNILHNQKKLYFILLPEPWRGNIRVSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVSPYETRNL 7057
            SNNNSDGRMKIDKWNKGEKGDKGNQGDKGDKGIAGSPGKPGKSEPCPISNCNLLKGEKGSPGIQGQCSTSTCLSIKGEKGDVGPIGPQGERGFMGEQGKSQQIYEDVIRKVVIEQLLIPDVQNLFKREKGEVGQATNCNCESSLTVSPKLRGLPGSPGKDGMGLDRIVNYGYGAIIVKSRDDLDRIGYYLSPGSLVLVINQENGSGMKKDPILMIKVTDNPNIWRQLNAFLGEEQFLPSSNTFKRIPVQKPNPDNILHNQKKLYFILLPEPWRGNIRVSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVSPYETRNL
Sbjct:   21 SNNNSDGRMKIDKWNKGEKGDKGNQGDKGDKGIAGSPGKPGKSEPCPISNCNLLKGEKGSPGIQGQCSTSTCLSIKGEKGDVGPIGPQGERGFMGEQGKSQQIYEDVIRKVVIEQLLIPDVQNLFKREKGEVGQATNCNCESSLTVSPKLRGLPGSPGKDGMGLDRIVNYGYGAIIVKSRDDLDRIGYYLSPGSLVLVINQENGSGMKKDPILMIKVTDNPNIWRQLNAFLGEEQFLPSSNTFKRIPVQKPNPDNILHNQKKLYFILLPEPWRGNIRVSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVSPYETRNL 455          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Planmine SMEST
Match: SMESG000071152.1 (SMESG000071152.1)

HSP 1 Score: 843.188 bits (2177), Expect = 0.000e+0
Identity = 427/427 (100.00%), Postives = 427/427 (100.00%), Query Frame = 2
Query: 5777 MKIDKWNXXXXXXXXXXXXXXXXXIAGSPGKPGKSEPCPISNCNLLKGEKGSPGIQGQCSTSTCLSIKGEKGDVGPIGPQGERGFMGEQGKSQQIYEDVIRKVVIEQLLIPDVQNLFKREKGEVGQATNCNCESSLTVSPKLRGLPGSPGKDGMGLDRIVNYGYGAIIVKSRDDLDRIGYYLSPGSLVLVINQENGSGMKKDPILMIKVTDNPNIWRQLNAFLGEEQFLPSSNTFKRIPVQKPNPDNILHNQKKLYFILLPEPWRGNIRVSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVSPYETRNL 7057
            MKIDKWNKGEKGDKGNQGDKGDKGIAGSPGKPGKSEPCPISNCNLLKGEKGSPGIQGQCSTSTCLSIKGEKGDVGPIGPQGERGFMGEQGKSQQIYEDVIRKVVIEQLLIPDVQNLFKREKGEVGQATNCNCESSLTVSPKLRGLPGSPGKDGMGLDRIVNYGYGAIIVKSRDDLDRIGYYLSPGSLVLVINQENGSGMKKDPILMIKVTDNPNIWRQLNAFLGEEQFLPSSNTFKRIPVQKPNPDNILHNQKKLYFILLPEPWRGNIRVSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVSPYETRNL
Sbjct:    1 MKIDKWNKGEKGDKGNQGDKGDKGIAGSPGKPGKSEPCPISNCNLLKGEKGSPGIQGQCSTSTCLSIKGEKGDVGPIGPQGERGFMGEQGKSQQIYEDVIRKVVIEQLLIPDVQNLFKREKGEVGQATNCNCESSLTVSPKLRGLPGSPGKDGMGLDRIVNYGYGAIIVKSRDDLDRIGYYLSPGSLVLVINQENGSGMKKDPILMIKVTDNPNIWRQLNAFLGEEQFLPSSNTFKRIPVQKPNPDNILHNQKKLYFILLPEPWRGNIRVSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVSPYETRNL 427          
BLAST of collagen alpha-1(I) chain isoform X4 vs. Planmine SMEST
Match: SMESG000075164.1 (SMESG000075164.1)

HSP 1 Score: 101.679 bits (252), Expect = 5.945e-21
Identity = 112/421 (26.60%), Postives = 181/421 (42.99%), Query Frame = 2
Query: 5855 GSPGKPGKSEPCPISNCNLLKGEKGSPGIQGQCSTSTCLSIKGEKGDVGPIGPQGERGFMGEQGKSQQIYEDVIRKVVIEQLLIPDVQN--LFKREKGEVGQATNCNCESSLTVSPKLRGLPGSPGKDGMGLDRIVNYGYGAIIVKSRDDLDRIGYYLSPGSLVLVINQENGSGMKKDPILMIKVTDNPNIWRQLNAFLGEEQFLPSSNTFKR-IPVQKPNPDNI---LHN--QKKLYFILLPEPWRGNIR--------VSEANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEETLFFSWSQMFNGYSRKPGVPLLTFE----GHDVLDIDPWRSKFMWVGGALDIYQETVPSCRDWTSSSPTDFGMT--INLENVLF--LNKVIKRPCGNSYYIGCIQVSPYE 7045
            G  G  G +  C  S C++    KG  G  GQC+ S CL IKGE+   GPIG +G+ G  GE+G+S  I  ++IR  +   ++   +++  LF+  KGE G+   C C          + +P          +  VN GYG+++ ++R+ L++    L  GS+V +          +  I +IK+  + N+WR ++         P S T+   IP+  P  +       N   KKL+ I L  P  G+++         S A   CQ+      Y      F+     +LK  +  K+ +   I N   ETL  +++ + +G        +L F+      D+L    W  K    G  ++   +T   C +W S  P   G+   IN    LF   N+ +   C    Y+ CIQ  PY+
Sbjct: 1092 GDRGPSGINGVCNASICSVNLPSKGDKGDPGQCNKSQCLVIKGER---GPIGLKGDMGQKGERGESNDINIELIR-YLTHSIIKAQIESMTLFQNGKGEKGEPGACKC---------AQKVPDKSFNANDIYEENVNIGYGSLVFETRELLEQTSNRLPAGSMVYI---------SQSDIFLIKIDQSNNVWRTIS-------MEPKSRTWILPIPMNIPKHETTYPPYQNGFSKKLHLIALITPTMGDLKPMLRQPGGYSGAAFQCQQAGEMYGYGRFMHPFINTDPFHLKFSINQKHMN-LPIYNSRGETLASNFNALLSGNDDLQN-EILDFKKEPISRDILSQCVWLGK-EPSGNDIEYNVKTESRCVNWMSREPHIHGLAAFINSTKSLFDEYNRGL-LSCSRQCYVLCIQTEPYD 1479          
The following BLAST results are available for this feature:
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COL18A16.096e-1328.34collagen type XVIII alpha 1 chain [Source:HGNC Sym... [more]
COL15A12.605e-1025.39collagen type XV alpha 1 chain [Source:HGNC Symbol... [more]
COL15A12.733e-1025.39collagen type XV alpha 1 chain [Source:HGNC Symbol... [more]
COL18A13.835e-1029.07collagen type XVIII alpha 1 chain [Source:HGNC Sym... [more]
COL18A14.110e-1029.07collagen type XVIII alpha 1 chain [Source:HGNC Sym... [more]
back to top
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cle-14.786e-925.13CLE-1B protein; CoLlagen with Endostatin domain [... [more]
cle-16.217e-925.00CLE-1B protein; CoLlagen with Endostatin domain [... [more]
cle-19.002e-925.00CLE-1B protein; CoLlagen with Endostatin domain [... [more]
cle-19.307e-925.00CLE-1B protein; CoLlagen with Endostatin domain [... [more]
back to top
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mp6.752e-825.42gene:FBgn0260660 transcript:FBtr0308094[more]
Mp6.919e-825.42gene:FBgn0260660 transcript:FBtr0301106[more]
Mp6.958e-825.42gene:FBgn0260660 transcript:FBtr0339903[more]
Mp7.158e-825.42gene:FBgn0260660 transcript:FBtr0339905[more]
Mp7.458e-825.42gene:FBgn0260660 transcript:FBtr0301111[more]
back to top
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col18a1b2.100e-1529.05collagen type XVIII alpha 1 chain b [Source:ZFIN;A... [more]
col15a1b1.211e-1225.11collagen, type XV, alpha 1b [Source:ZFIN;Acc:ZDB-G... [more]
col15a1b1.274e-1225.11collagen, type XV, alpha 1b [Source:ZFIN;Acc:ZDB-G... [more]
col15a1b2.254e-1226.26collagen, type XV, alpha 1b [Source:ZFIN;Acc:ZDB-G... [more]
col18a1a2.329e-1129.03collagen type XVIII alpha 1 chain a [Source:ZFIN;A... [more]
back to top
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COL18A17.356e-1127.91collagen type XVIII alpha 1 [Source:NCBI gene;Acc:... [more]
COL18A17.565e-1127.91collagen type XVIII alpha 1 [Source:NCBI gene;Acc:... [more]
COL18A11.017e-1027.91collagen type XVIII alpha 1 [Source:NCBI gene;Acc:... [more]
COL18A11.025e-1027.91collagen type XVIII alpha 1 [Source:NCBI gene;Acc:... [more]
COL18A11.153e-1027.91collagen type XVIII alpha 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Col18a13.879e-828.49collagen, type XVIII, alpha 1 [Source:MGI Symbol;A... [more]
Col18a14.042e-828.49collagen, type XVIII, alpha 1 [Source:MGI Symbol;A... [more]
Col18a14.429e-828.49collagen, type XVIII, alpha 1 [Source:MGI Symbol;A... [more]
Col15a11.190e-725.15collagen, type XV, alpha 1 [Source:MGI Symbol;Acc:... [more]
Col15a11.237e-725.15collagen, type XV, alpha 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of collagen alpha-1(I) chain isoform X4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|P39059|COFA1_HUMAN1.251e-925.39Collagen alpha-1(XV) chain OS=Homo sapiens OX=9606... [more]
sp|P39060|COIA1_HUMAN1.974e-929.07Collagen alpha-1(XVIII) chain OS=Homo sapiens OX=9... [more]
sp|P39061|COIA1_MOUSE2.711e-728.49Collagen alpha-1(XVIII) chain OS=Mus musculus OX=1... [more]
sp|O35206|COFA1_MOUSE8.322e-725.15Collagen alpha-1(XV) chain OS=Mus musculus OX=1009... [more]
back to top
BLAST of collagen alpha-1(I) chain isoform X4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D6FZQ04.785e-12696.89Mp-2 (Fragment) OS=Schmidtea mediterranea OX=79327... [more]
A0A5K4EKS93.124e-1825.26Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A443RZX52.082e-1731.93Collagen alpha-1(I) chain-like protein OS=Leptotro... [more]
A0A0X3NU026.536e-1725.29Endostatin domain-containing protein (Fragment) OS... [more]
A0A210QRN66.959e-1726.70Collagen alpha-1(XXVII) chain B OS=Mizuhopecten ye... [more]
back to top
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000057821.15.897e-1328.07pep primary_assembly:Astyanax_mexicanus-2.0:13:785... [more]
ENSAMXT00000043399.12.545e-1127.22pep primary_assembly:Astyanax_mexicanus-2.0:13:785... [more]
ENSAMXT00000037316.12.948e-827.69pep primary_assembly:Astyanax_mexicanus-2.0:10:764... [more]
back to top
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003519.12.571e-1427.48pep scaffold:Pmarinus_7.0:GL476336:685424:702873:1... [more]
ENSPMAT00000009156.14.815e-826.16pep scaffold:Pmarinus_7.0:GL476573:61536:110082:-1... [more]
back to top
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of collagen alpha-1(I) chain isoform X4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col18a1a3.910e-1125.49collagen type XVIII alpha 1 chain a [Source:ZFIN;A... [more]
col18a1a5.072e-1126.29collagen type XVIII alpha 1 chain a [Source:ZFIN;A... [more]
ENSORLT00000002294.25.214e-1027.52pep primary_assembly:ASM223467v1:2:12378816:123820... [more]
ENSORLT00000031348.19.711e-1026.22pep primary_assembly:ASM223467v1:17:19717601:19722... [more]
ENSORLT00000042441.19.709e-928.35pep primary_assembly:ASM223467v1:2:12377917:123820... [more]
back to top
BLAST of collagen alpha-1(I) chain isoform X4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071150.14.022e-24100.00SMESG000071150.1[more]
SMESG000071150.14.022e-24100.00SMESG000071150.1[more]
SMESG000071152.10.000e+0100.00SMESG000071152.1[more]
SMESG000071152.10.000e+0100.00SMESG000071152.1[more]
SMESG000075164.15.945e-2126.60SMESG000075164.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014501 ID=SMED30014501|Name=collagen alpha-1(I) chain isoform X4|organism=Schmidtea mediterranea sexual|type=transcript|length=7144bp
TGATTTCTATTACAGAAATTTCAGTGAATAATTACATTAGCATTATTTAA
CAGTCCGAATATCCACTAAGCAAAAATTAAAGCATTAATTACAATTATTC
AACATTTACCTTTTTTGCAAAAGGTCAGTGATGATATTATGCATGCAACA
GACTTTTTATTCTGATCAAATCAATCTTTTGATCGCTTTACTAAACTTAT
TCATCTTCATTAATAATAACATGCTGATGTGGGAATTTATTTCACGGAAA
TTTGATATTTTTACCACTTTGAAAAGTTGAATTTGATTTACTATGATGCT
ATTGTGCAAAACAAGGATTTGTCTTTTCGGCATCACCTGCATTTTCTTTT
CTCTATACAATGCCAATGACATATTCCAAGGAGACCTTTTGTATGAATTC
AAAGACAAATTGATTGGAAATCCCAGTGTGATACTTAATTTTTTTAATTT
GGCCGACGAAGATGCGAGTCAAGATCCGAAAGAAACTGACTCGTCTGATT
CCAATGCCGGAATAGAAATTCATAGTCCGATTTTAATTGAAAAACCGGCG
AATCTCTTTTTAATGAATGACAAAATTCCTGAAGAATTGAGCGTATTTGT
AAAATTTAAACCCAAATATGATCCAATAAAAGGATCATATAAATCAGGCT
TTCTGTTTAGTATACTTGATCCGGATCTAGAGACAATCCGATTTGCAGTT
CAGTTTCGAGTTGTTTTATTTGGACATGCGGTTATTAATGAAATGTGGAT
ATACTTAAACGATAATATCAACCGAAAAGGTCAGACTGATCCCATTGCAA
AAGTAACGTTGCCAACTATTCAATCAGTGATTGCCGAGGACACGATAACA
TTTTCTTTCAAATTGACAGGTAGCACCATTACTACATGGCATGGCTGCCC
CCAACAGTCGACATACCTGTCCTCAGAAAAAATTACTCGATCAGTTAACG
AAAACCAAATGCCACCAGGGACCGCGTTTTATTTGTTAAGCGGTGGACCT
TCTCTTAAAAACACATTCACGGGTAAAGTTTTGGGTCTGAGATTCTACAA
GTCGGTATCTGGCATTGATGAATATTGTGCAGAAAATGAAATTCAAGGAA
GTGGAAGTACAAAGAAATTCAAGAGAATACTGCCTGAAAAGTTTGGAAAT
GTTTTGATTCAAACAAGTACCACGAAAAGAACAGAAAGACCAACGTCTAC
ATCAACCCTTTCCACAACCACAACAGAACTTCCCACCTCAACTACTGAAC
AAAAATCCACGTCGACGACGACTAAAGTTGTTATTCCAAAGAATATCTTA
ACCTCCACAGATATCTTAACATCATCAAATACTAAACAATATAAACTTGA
TCAGCAATCTCCCGGCTCAGATAAAACTGATATTATTTCTACAATTAATT
CTAATGATTTAAACAATAAATCTTTGAACGATAAAAAAATAGCTGTTAAA
GCAATTTCACCAAAATCAATAAATTTCAACAATGGAAATAATTTTGAAAA
TTCTTCGGAAATTCTCAAATCTACGGAAATAAATATCTTTAACCGAAAAG
ATATATTATCTGATTTTATTCAAAATGAACCGAAAATTGATGGAGTATTT
ATTCAACGTTCTGACGAAGAAGACTTAACAGTTCAAGTAAAAAAACGAGT
AAACTTGGCTCGGCCAAGTATTTTATACTTTTCTAACAATAAATTTCCCA
CGGACTTTGGATTTTCGATTGAGTTCAATTTCCAGCAAACAGATGGATAC
TTATTTGCTCTCGTCGATCCAGATGGAACTACTGTTCGTCTTGGTTTACG
AATTCAAAACCAAACAGATTCAATGAATGGCGATTCATTAAAAATGAGGA
AATTATTTTTGTATTTTAATGACGACGTGAACATTGTTGGAGAGGAAATT
TCAGTGTCCAGCGTTCCTTTACCGATGACCAATAAGAGAAAATCATTCCT
ATTTTATATTTTTATATCACAAACACAAGTGACAATTTGGTCCGGATGTC
CGTTGGATGAAAATCAAATTAGCAACGTAGGAATCAAACGGAATCTAGAA
ACAAATATGAAAAAAGGAAGTGCATTATATTTGTTCAGCGCGGGAGATTT
ATTGAAAGGATATTTTAAGGGAACCGTTCATCAATTGAAACTTTTTTATT
CGTTTGAATCAATGATGTCAACTTGTAATAAAAAGATAGAAGGAAGCGGT
AAAGTTTCAGATAGAATATCCAGCCCGGTAACAGATGAACCTGATTCAGA
AGATAACCAAATTACCGATGAACCCATTACGATCATGACCGATTTAACAA
AGCTTCCGGAATCAACAATAAATAAAGATGTGATAGCTATATTTGATATT
ATTGAAACTTTTATCATATCCAATATGGAAAATTTACCCTCGGGGGTCAA
GTTGAATATTAACCAGCCCGACACAGAAGAAACTCACATAGAAATAAAAG
AAAAAGTTACAATTCAACAACCGGCAATGATGATTTATCCGAATCTCAAA
TTTCCGAATGATTTGGGAATCATTGTTGACTTCATTCCAAATGAAGGATT
TATTTTGTCGATCATGGATCAGGATTTAAGCACGATCAGATTGGCCTTGT
CAGTCTCCATAAAAAACCAAGAAGTCAACAATCAGATCATTCAAATTAAA
CAATTTAATATACATTTCAATGACAGAACTTTCAGTCCAATGAGCTCGGA
AAGTATTGTGGCATCAGTTCCACTATCAGATAAAACAGATGATCATTTTC
AAAAATCCAAATTTTTAAAATTAAGCATTCTGATTTCAAGAATGAAAATT
TCTATTTGGTCAAAGTGTCCATCGGATGAAATGATTTTATATGAACATGA
AATTACAAGAAGTTCTGAAGAGCCAAATATGAAGATTGGTGGTTCGATAT
ATCTTTTTAGTGCGGGACCACTTTTAAATGGCTATTATATGGGTTCAATT
CGGTCATTGAAATTATTCAATTCTAAAGAAAATCTATTGGCAACATGCAA
ACAGAATCAAATTGAAGGGAGTGGGAAACAGACCATTCCACCAATTATTG
GAAATGTTCTAGAGGAAGAATCTACTACAAGAAAAAAAGAAATATCTACA
ACGCCAGAATCCTCTACTAAAGTCTCAACAACTCAAAATCTTTCAAGAAA
AGTAGCAGAGAAAATTCTAGAATCTACTACTACATTGAGTGGAAAGGTCT
CAGATCGGATAAACCTAACCATCTCTTCAACATATCCTTCAACTTTCAGT
CAGTTGGTTTCTATAAGCACCGTTGAGAAAGGCATGATGAATACCAATTC
TACTTTCATTGTCGAGGAGCCTCTTGATGCGTCAACTAAAAAACTAAAAA
TTTTCACTGATTCAGAAATTGAGAATTCTGAGAGAGATGAATCTTTAATA
CCAGAAGACTTTTTAAATGAATATTTGATATCTAAAGTTCCAACTCCAGG
AATAATATCCACAATTTTCAATGAAGATTCAGAAGAAACGAAAATCAAAG
TAATTAAAGATGTTCATATTTCAAAGCCATCAATGATTTATTTTCCAAAT
AATAAATTTCCTAGAGAGTTAGGTTTTGTGGCTGAATTTGTTCCTTCTTC
AGAAGTCAGCAAATCATTCCTCTTTGCTTTTATAGACCCTGACTTAAAGA
CATTGCGTTTGGCCGTTGAAATTTCTTGGATAACAGAAGAAATGAGTGGC
ATACAATCTAAAGAGTTAAAAGTAGGAGTATATCTCAAAGACGATAATAA
TCTAGAAGTTCTTCCTCAAAAACCAATAATTTCAGCTAATTTATTCATTT
CACAAGCTAATAAAAAATCTACATACAAAATCTCATTTCTGATAAATGAA
AATGACATTCAGCTATGGCATGAATGCCCATCACCAAAAAATCTGATACG
TACTGCAATTTATAAAAGAAATAATAAAAATCAAAATTTAAAACCAGGAG
GAATCCTTTATTTATTCAGTGGAGGTCCCAGTTTGCAAAATTATTATCAA
GGAGAGATTCTGTCCCTTAAAATGATCAAATCAAGTGATCAATTAATAAA
AAATTGCCGATCAGTAGAACTAGAAGGAAGCGGCACACGCATAATACCAA
GAATAGAAGGGAATATTCTAATCACAGAAACCACCAAATCATCAAAAAAA
ATAAGACCTCTGAAAACGAAATTAACTAGCCCCGGCATTGAAACGTCAAC
GACAGAAAGTGTAGTGACCAAGCAATCAAAAGAAAATATTACTAGTTCAA
AATCTACTTTTACCAACAGCGAGTGGTCTAAGTCTTCAACAATGACGTCA
CAGTCGACCGAATCTCCTAGCCAGTCAACTATCACAATTAGACCTACGGA
CTTTTCAATTAGCGAATCAACATCAACCAAATCTTCTTCAAAGACAAAAC
AGATATCTAAGAAAAAATCTTTCACAAAAAAGAAGTCAAAAAAAAAGTTA
TCAACATTGGAACCATCTACTGTCTCATCTATGATAATTAATCCGGATTT
AGAAGAAAATGGTGTGACTGATTCAAGCGGAAATGAGAATGAAAGCGAAT
TTGATTTATTGAGGGAGTATTTAGTTCCTCAAATTCAAACACCTGGAATT
ATTCCGACTATTTTGCATGAAGACTCAGAGGAAATAAAAATAAAAATAAA
TCAGGACGTACTGATATCAAAGCCATCAATGATTTACTTTCCAAATAATA
AATTTCCTTCAGAACTGGGAGTTATAGCCGAATTTCGATCATCATCAGAA
AAAGGAGAGGCATTTCTATTTTCTTTTGTTGATCCAGATTTGAAGACGTT
ACGCCTTGGTTTCCAAACCTCTTGGAAGACTCATGAAATTAGTGGAATAG
AAACTAAATCTTTGTTTATAAATGTCTTTTTCAAAGACAACGATGTTTCT
GATCAGTATCCCCAAAAACCGATATTGTCGGCTAATTTGTTTAATATTCC
TTCAAATAAAAAATCTAGTTATAAAATGTCATTTTTGATGAAAGGTGACG
AATTTCAGCTGTGGAATGATTGTCCGTCCCCACAAAATCAGATTCGATCA
ACGCGTTACAGCAGAAGTTATGAGAACGAGAACTTGAAAACTGGAGGAAT
TCTGTACTTATTTAGTGGTGGACCAGATCTTACAGATTATTTTCAGGGAG
AAATAATTACTCTTGAAATGTTTGGAACAAATGAGAAGCTATTAAGAAAA
TGCCGAACATCTGAAATCGAAGGAAGTGGGAAGTTTATAATACCTAAAAT
TCAAGGAAACGCATTAATAACTAAAGAACAAAATGCAACAAATATAAGCA
CAGTAAAAACCAAACAGATTATAAATAGTACTAAACCAACCACAACTACA
ACAATACCCCCTACAACTACAACAATTCCCACTACAACTACACTGCTGCA
AACAACAACAAAAACAACAATGTCAACCACAACGACAACAAAACCCACTA
CAACTACGCTGCAGCAAACCACAACTACAACAATGCCAACCACCACTACC
ACAATTCCAACTACAACTACATTGCTGCCAAATATAACTACCACAATCCC
CATTACAACTACGTTGCAATCCACTACAACCACACTGCTAGCAAATACAA
CTACAACAACACCCACCATGACTACTACAATACGAACTACAAATTCAACC
CTATTTCCATTAAATGCGACTGATTTGGAATTATCAATGAATCGTTATGA
GGTTACTCTGAATGTTTCTATGGACACCTCGACAATTTCTCCTGGATTTA
CTAGTAACAACAATTCAGATGGACGCATGAAAATAGATAAGTGGAATAAA
GGCGAAAAGGGTGACAAGGGCAACCAAGGTGATAAAGGCGATAAAGGTAT
TGCTGGTTCACCGGGTAAGCCAGGAAAATCAGAACCTTGTCCCATTTCAA
ATTGTAACTTGCTGAAAGGAGAAAAGGGCTCACCTGGAATACAAGGACAA
TGCTCGACGTCAACATGTTTGAGTATTAAAGGAGAAAAGGGAGACGTAGG
ACCTATTGGTCCACAGGGCGAAAGAGGTTTCATGGGTGAACAAGGAAAGA
GTCAGCAAATTTATGAAGATGTCATTCGAAAAGTTGTTATTGAGCAACTT
CTTATACCCGATGTGCAGAATCTATTCAAAAGAGAAAAAGGTGAAGTTGG
CCAAGCAACAAATTGTAATTGTGAATCTAGTTTAACTGTTTCTCCCAAAC
TTCGAGGACTTCCAGGATCACCTGGTAAAGATGGTATGGGATTAGATAGA
ATAGTAAATTATGGATACGGGGCAATTATTGTTAAGTCAAGAGACGATTT
AGATAGAATAGGATATTATCTATCTCCTGGATCTTTGGTATTAGTTATCA
ATCAAGAAAATGGATCTGGAATGAAAAAAGATCCGATTTTAATGATTAAA
GTAACAGACAATCCAAATATCTGGCGACAGTTAAATGCCTTTCTTGGAGA
AGAACAATTCCTCCCCTCGTCTAATACTTTTAAAAGAATTCCTGTACAAA
AACCTAATCCAGATAATATTTTGCATAATCAGAAAAAACTTTACTTCATT
TTATTACCCGAACCTTGGAGAGGAAACATCCGAGTCAGTGAAGCAAATCA
TTTGTGCCAAAAGTTCGCAGCTGACAATAGTTATATAGGTATTTTTCAGG
CATTTCTAGAAGACCAATCAAGAAATCTGAAAAGCTTGATGCCGGCGAAA
TATTGGCACTCATGGCAAATTGTCAACAAAAATGAAGAGACTTTATTTTT
TTCTTGGAGTCAAATGTTTAATGGATATTCCAGAAAACCAGGAGTACCGC
TTTTAACTTTTGAAGGTCATGATGTGTTAGATATAGATCCATGGAGATCG
AAGTTTATGTGGGTTGGAGGTGCCTTAGACATTTATCAGGAAACTGTTCC
TTCATGCCGCGATTGGACATCGAGTTCTCCAACTGATTTTGGAATGACTA
TTAATCTTGAAAATGTGTTATTCCTTAACAAAGTAATTAAAAGGCCTTGC
GGAAATTCTTATTATATCGGTTGTATTCAAGTTTCTCCATACGAAACACG
AAATCTTTGAATTATTTTTCAAATGACATATATGTTGACGATTGCTTTTA
TATTTAAATATTAATTTTTATACTTAATATATTTAACTGGTGAG
back to top

protein sequence of SMED30014501-orf-1

>SMED30014501-orf-1 ID=SMED30014501-orf-1|Name=SMED30014501-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2256bp
MMLLCKTRICLFGITCIFFSLYNANDIFQGDLLYEFKDKLIGNPSVILNF
FNLADEDASQDPKETDSSDSNAGIEIHSPILIEKPANLFLMNDKIPEELS
VFVKFKPKYDPIKGSYKSGFLFSILDPDLETIRFAVQFRVVLFGHAVINE
MWIYLNDNINRKGQTDPIAKVTLPTIQSVIAEDTITFSFKLTGSTITTWH
GCPQQSTYLSSEKITRSVNENQMPPGTAFYLLSGGPSLKNTFTGKVLGLR
FYKSVSGIDEYCAENEIQGSGSTKKFKRILPEKFGNVLIQTSTTKRTERP
TSTSTLSTTTTELPTSTTEQKSTSTTTKVVIPKNILTSTDILTSSNTKQY
KLDQQSPGSDKTDIISTINSNDLNNKSLNDKKIAVKAISPKSINFNNGNN
FENSSEILKSTEINIFNRKDILSDFIQNEPKIDGVFIQRSDEEDLTVQVK
KRVNLARPSILYFSNNKFPTDFGFSIEFNFQQTDGYLFALVDPDGTTVRL
GLRIQNQTDSMNGDSLKMRKLFLYFNDDVNIVGEEISVSSVPLPMTNKRK
SFLFYIFISQTQVTIWSGCPLDENQISNVGIKRNLETNMKKGSALYLFSA
GDLLKGYFKGTVHQLKLFYSFESMMSTCNKKIEGSGKVSDRISSPVTDEP
DSEDNQITDEPITIMTDLTKLPESTINKDVIAIFDIIETFIISNMENLPS
GVKLNINQPDTEETHIEIKEKVTIQQPAMMIYPNLKFPNDLGIIVDFIPN
EGFILSIMDQDLSTIRLALSVSIKNQEVNNQIIQIKQFNIHFNDRTFSPM
SSESIVASVPLSDKTDDHFQKSKFLKLSILISRMKISIWSKCPSDEMILY
EHEITRSSEEPNMKIGGSIYLFSAGPLLNGYYMGSIRSLKLFNSKENLLA
TCKQNQIEGSGKQTIPPIIGNVLEEESTTRKKEISTTPESSTKVSTTQNL
SRKVAEKILESTTTLSGKVSDRINLTISSTYPSTFSQLVSISTVEKGMMN
TNSTFIVEEPLDASTKKLKIFTDSEIENSERDESLIPEDFLNEYLISKVP
TPGIISTIFNEDSEETKIKVIKDVHISKPSMIYFPNNKFPRELGFVAEFV
PSSEVSKSFLFAFIDPDLKTLRLAVEISWITEEMSGIQSKELKVGVYLKD
DNNLEVLPQKPIISANLFISQANKKSTYKISFLINENDIQLWHECPSPKN
LIRTAIYKRNNKNQNLKPGGILYLFSGGPSLQNYYQGEILSLKMIKSSDQ
LIKNCRSVELEGSGTRIIPRIEGNILITETTKSSKKIRPLKTKLTSPGIE
TSTTESVVTKQSKENITSSKSTFTNSEWSKSSTMTSQSTESPSQSTITIR
PTDFSISESTSTKSSSKTKQISKKKSFTKKKSKKKLSTLEPSTVSSMIIN
PDLEENGVTDSSGNENESEFDLLREYLVPQIQTPGIIPTILHEDSEEIKI
KINQDVLISKPSMIYFPNNKFPSELGVIAEFRSSSEKGEAFLFSFVDPDL
KTLRLGFQTSWKTHEISGIETKSLFINVFFKDNDVSDQYPQKPILSANLF
NIPSNKKSSYKMSFLMKGDEFQLWNDCPSPQNQIRSTRYSRSYENENLKT
GGILYLFSGGPDLTDYFQGEIITLEMFGTNEKLLRKCRTSEIEGSGKFII
PKIQGNALITKEQNATNISTVKTKQIINSTKPTTTTTIPPTTTTIPTTTT
LLQTTTKTTMSTTTTTKPTTTTLQQTTTTTMPTTTTTIPTTTTLLPNITT
TIPITTTLQSTTTTLLANTTTTTPTMTTTIRTTNSTLFPLNATDLELSMN
RYEVTLNVSMDTSTISPGFTSNNNSDGRMKIDKWNKGEKGDKGNQGDKGD
KGIAGSPGKPGKSEPCPISNCNLLKGEKGSPGIQGQCSTSTCLSIKGEKG
DVGPIGPQGERGFMGEQGKSQQIYEDVIRKVVIEQLLIPDVQNLFKREKG
EVGQATNCNCESSLTVSPKLRGLPGSPGKDGMGLDRIVNYGYGAIIVKSR
DDLDRIGYYLSPGSLVLVINQENGSGMKKDPILMIKVTDNPNIWRQLNAF
LGEEQFLPSSNTFKRIPVQKPNPDNILHNQKKLYFILLPEPWRGNIRVSE
ANHLCQKFAADNSYIGIFQAFLEDQSRNLKSLMPAKYWHSWQIVNKNEET
LFFSWSQMFNGYSRKPGVPLLTFEGHDVLDIDPWRSKFMWVGGALDIYQE
TVPSCRDWTSSSPTDFGMTINLENVLFLNKVIKRPCGNSYYIGCIQVSPY
ETRNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000240body wall musculature
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR016186C-type_lectin-like/link_sf
IPR010515Collagenase_NC10/endostatin
IPR016187CTDL_fold
IPR013320ConA-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
Vocabulary: cellular component
TermDefinition
GO:0031012extracellular matrix
GO:0005581collagen trimer
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 1031..1261
e-value: 7.7E-6
score: 27.5
coord: 1410..1642
e-value: 9.2E-11
score: 43.6
coord: 672..908
e-value: 3.7E-6
score: 28.5
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 420..628
e-value: 4.9E-8
score: 34.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1295..1367
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 293..325
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1817..1864
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1286..1391
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1829..1848
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1898..1917
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1704..1732
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1368..1382
NoneNo IPR availablePANTHERPTHR22917HEMOPEXIN DOMAIN-CONTAINING PROTEINcoord: 1664..1808
IPR016186C-type lectin-like/link domain superfamilyGENE3DG3DSA:3.10.100.10coord: 2075..2254
e-value: 3.8E-29
score: 103.3
IPR010515Collagenase NC10/endostatinPFAMPF06482Endostatincoord: 2063..2248
e-value: 1.0E-26
score: 94.2
IPR016187C-type lectin foldSUPERFAMILYSSF56436C-type lectin-likecoord: 2081..2246
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 454..620