Armadillo repeat-containing protein 4

Overview
NameArmadillo repeat-containing protein 4
Smed IDSMED30014492
Length (bp)2697
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Armadillo repeat-containing protein 4 (SMED30014492) t-SNE clustered cells

Violin plots show distribution of expression levels for Armadillo repeat-containing protein 4 (SMED30014492) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014492

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30014492SMESG000044790.1 SMESG000023906.1 Contig40424newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014492SMESG000044790.1 SMESG000023906.1 Contig40424uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014492SMESG000044790.1 SMESG000023906.1 Contig30922newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014492SMESG000044790.1 SMESG000023906.1 Contig30922uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testis primordiumSMED30014492SMESG000044790.1 SMESG000023906.1 PL06005A1G01_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
testis primordiumSMED30014492SMESG000044790.1 SMESG000023906.1 Contig3959_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Human
Match: ARMC4 (armadillo repeat containing 4 [Source:HGNC Symbol;Acc:HGNC:25583])

HSP 1 Score: 436.032 bits (1120), Expect = 3.529e-140
Identity = 240/633 (37.91%), Postives = 382/633 (60.35%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLD-VDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            Q++   +   YWQ+ K+++Y++ GN  AT++ LC M +  L    C  A+ D  G+ +L+NLL  ++++C+IGSLKIL+E++      +N+  LGG+  +++ L   +  L+CLAAET+A +A FKRAR  +R+  GI+ LV LLD   DS    + S+          RD     V +  A ALW  SKS  N+  +R+AG IPLLA+LL+ +++N+LIPV+GTLQ+CASE  YR +I+ E ++  L+K+LNS+N  L+   A+ I++CA D +TR LVR  GG+  L   ++   +++ L A+TGAIWKC +   N  +         L+ +L + P                       E++++NV GAL E  +  E R +++     +  ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A+A  AL  C  N +++  +++S VG LEL VN L+S N++VL++ C+ I  I KD +N+A+++D GVV LLS+L  T+N+KLR  L+EAI+ C  +  NR  FG    + P+V +L+S+D +VH + A+AL++LS+D +N   M++ G   LL++M+GS ++DLQ AAAG I N+R++ +  EK
Sbjct:  133 QEASADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEA-------RD---VEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQP-----------------------EEVLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEK 732          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Human
Match: ARMC4 (armadillo repeat containing 4 [Source:HGNC Symbol;Acc:HGNC:25583])

HSP 1 Score: 435.647 bits (1119), Expect = 1.415e-136
Identity = 240/633 (37.91%), Postives = 382/633 (60.35%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLD-VDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            Q++   +   YWQ+ K+++Y++ GN  AT++ LC M +  L    C  A+ D  G+ +L+NLL  ++++C+IGSLKIL+E++      +N+  LGG+  +++ L   +  L+CLAAET+A +A FKRAR  +R+  GI+ LV LLD   DS    + S+          RD     V +  A ALW  SKS  N+  +R+AG IPLLA+LL+ +++N+LIPV+GTLQ+CASE  YR +I+ E ++  L+K+LNS+N  L+   A+ I++CA D +TR LVR  GG+  L   ++   +++ L A+TGAIWKC +   N  +         L+ +L + P                       E++++NV GAL E  +  E R +++     +  ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A+A  AL  C  N +++  +++S VG LEL VN L+S N++VL++ C+ I  I KD +N+A+++D GVV LLS+L  T+N+KLR  L+EAI+ C  +  NR  FG    + P+V +L+S+D +VH + A+AL++LS+D +N   M++ G   LL++M+GS ++DLQ AAAG I N+R++ +  EK
Sbjct:  441 QEASADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEA-------RD---VEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQP-----------------------EEVLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEK 1040          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Human
Match: ARMC4 (armadillo repeat containing 4 [Source:HGNC Symbol;Acc:HGNC:25583])

HSP 1 Score: 435.647 bits (1119), Expect = 1.415e-136
Identity = 240/633 (37.91%), Postives = 382/633 (60.35%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLD-VDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            Q++   +   YWQ+ K+++Y++ GN  AT++ LC M +  L    C  A+ D  G+ +L+NLL  ++++C+IGSLKIL+E++      +N+  LGG+  +++ L   +  L+CLAAET+A +A FKRAR  +R+  GI+ LV LLD   DS    + S+          RD     V +  A ALW  SKS  N+  +R+AG IPLLA+LL+ +++N+LIPV+GTLQ+CASE  YR +I+ E ++  L+K+LNS+N  L+   A+ I++CA D +TR LVR  GG+  L   ++   +++ L A+TGAIWKC +   N  +         L+ +L + P                       E++++NV GAL E  +  E R +++     +  ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A+A  AL  C  N +++  +++S VG LEL VN L+S N++VL++ C+ I  I KD +N+A+++D GVV LLS+L  T+N+KLR  L+EAI+ C  +  NR  FG    + P+V +L+S+D +VH + A+AL++LS+D +N   M++ G   LL++M+GS ++DLQ AAAG I N+R++ +  EK
Sbjct:  441 QEASADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEA-------RD---VEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQP-----------------------EEVLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEK 1040          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Human
Match: ARMC4 (armadillo repeat containing 4 [Source:HGNC Symbol;Acc:HGNC:25583])

HSP 1 Score: 401.364 bits (1030), Expect = 2.307e-127
Identity = 223/598 (37.29%), Postives = 356/598 (59.53%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLD-VDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGV 2436
            Q++   +   YWQ+ K+++Y++ GN  AT++ LC M +  L    C  A+ D  G+ +L+NLL  ++++C+IGSLKIL+E++      +N+  LGG+  +++ L   +  L+CLAAET+A +A FKRAR  +R+  GI+ LV LLD   DS    + S+          RD     V +  A ALW  SKS  N+  +R+AG IPLLA+LL+ +++N+LIPV+GTLQ+CASE  YR +I+ E ++  L+K+LNS+N  L+   A+ I++CA D +TR LVR  GG+  L   ++   +++ L A+TGAIWKC +   N  +         L+ +L + P                       E++++NV GAL E  +  E R +++     +  ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A+A  AL  C  N +++  +++S VG LEL VN L+S N++VL++ C+ I  I KD +N+A+++D GVV LLS+L  T+N+KLR  L+EAI+ C  +  NR  FG    + P+V +L+S+D +VH + A+AL++LS+D +N   M++ G 
Sbjct:  133 QEASADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEA-------RD---VEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQP-----------------------EEVLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGA 697          

HSP 2 Score: 58.5362 bits (140), Expect = 4.795e-8
Identity = 95/404 (23.51%), Postives = 170/404 (42.08%), Query Frame = 1
Query: 1384 LIKHLNSQNLWLRTQSALTIFKCAV------DADTRTLVRNLGGIDVLIMHVDPE------GDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKF-ISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVK-TDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQSMM 2553
            L+K+L   N     Q+A  I  C++          +  +R++GG++VLI  ++ +      G  K+L  I+         P     + +  G  +++ ILD   KS +      I+   K  R  +    ++   G + ++  L     L   H+ST+    SL +  D  +       L  C+K+    E I +  G+P+L  + K S   ++   +  L+ C A+ EN  + IK+    +E  V  L S NE +       I +  +D +   ++   G ++ L+ L+  TDN +    ++ AI  CS  K+N  +F     I  +V  L      V V+   AL +  Q+  N   + + G    L+N++   N+ L +    A+G         E +SMM
Sbjct:  149 LVKYLKGGN-----QTATVIALCSMRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHN-------PQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARR----VVRQHGGITKLVAL-----LDCAHDSTKPAQSSLYEARDVEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQEC-ASEENYRAAIKA-ERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEEVLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVG-----ACAVEPESMM 524          

HSP 3 Score: 58.151 bits (139), Expect = 7.354e-8
Identity = 92/441 (20.86%), Postives = 171/441 (38.78%), Query Frame = 1
Query: 1225 RVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGD-----QKLLY-------AITGAI--WKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAI 2505
            ++ +R  G + +L  LL  +     I  +  L++ +     R +I   G +PI++  L+S +  L+  +A TI   A     R +VR  GGI  L+  +D   D     Q  LY       A  GA+  W C     N   +    G  +L ++L                 SH        E ++I V G L E +  E  R  IK     E  +  L  ++E L  +    + +CA+  +   ++ RL G                   L+ L S   NT+N                       ++ L+A    I +     +NV    ++  +  L  L+    +++   +  A+  C   ++NR    +   I P+VN L   +  + V+  +A+   + +P +   +++     LL +++ + + D++ +AA A+
Sbjct:  179 QLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEARDVEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLL---------------KTSH--------ENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKE-TRDLVRLHG------------------GLKPLASLLNNTDN-----------------------KERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEEVLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWAL 554          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Human
Match: ARMC4 (armadillo repeat containing 4 [Source:HGNC Symbol;Acc:HGNC:25583])

HSP 1 Score: 369.007 bits (946), Expect = 3.954e-116
Identity = 211/562 (37.54%), Postives = 333/562 (59.25%), Query Frame = 1
Query:  751 MNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLD-VDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAG 2433
            M +  L    C  A+ D  G+ +L+NLL  ++++C+IGSLKIL+E++      +N+  LGG+  +++ L   +  L+CLAAET+A +A FKRAR  +R+  GI+ LV LLD   DS    + S+          RD     V +  A ALW  SKS  N+  +R+AG IPLLA+LL+ +++N+LIPV+GTLQ+CASE  YR +I+ E ++  L+K+LNS+N  L+   A+ I++CA D +TR LVR  GG+  L   ++   +++ L A+TGAIWKC +   N  +         L+ +L + P                       E++++NV GAL E  +  E R +++     +  ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A+A  AL  C  N +++  +++S VG LEL VN L+S N++VL++ C+ I  I KD +N+A+++D GVV LLS+L  T+N+KLR  L+EAI+ C  +  NR  FG    + P+V +L+S+D +VH + A+AL++LS+D +N   M++ G
Sbjct:    1 MRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEA-------RD---VEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQP-----------------------EEVLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENG 529          

HSP 2 Score: 58.9214 bits (141), Expect = 3.803e-8
Identity = 85/372 (22.85%), Postives = 160/372 (43.01%), Query Frame = 1
Query: 1480 VRNLGGIDVLIMHVDPE------GDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKF-ISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVK-TDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQSMMKKMEKI 2571
            +R++GG++VLI  ++ +      G  K+L  I+         P     + +  G  +++ ILD   KS +      I+   K  R  +    ++   G + ++  L     L   H+ST+    SL +  D  +       L  C+K+    E I +  G+P+L  + K S   ++   +  L+ C A+ EN  + IK+    +E  V  L S NE +       I +  +D +   ++   G ++ L+ L+  TDN +    ++ AI  CS  K+N  +F     I  +V  L      V V+   AL +  Q+  N   + + G    L+N++   N+ L +    A+G      +E E   ++ +++ +
Sbjct:   15 IRDVGGLEVLINLLETDEVKCKIGSLKILKEISHN-------PQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARR----VVRQHGGITKLVAL-----LDCAHDSTKPAQSSLYEARDVEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQEC-ASEENYRAAIKA-ERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEEVLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVG---ACAVEPESMMIIDRLDGV 365          

HSP 3 Score: 58.151 bits (139), Expect = 6.419e-8
Identity = 92/441 (20.86%), Postives = 171/441 (38.78%), Query Frame = 1
Query: 1225 RVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGD-----QKLLY-------AITGAI--WKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAI 2505
            ++ +R  G + +L  LL  +     I  +  L++ +     R +I   G +PI++  L+S +  L+  +A TI   A     R +VR  GGI  L+  +D   D     Q  LY       A  GA+  W C     N   +    G  +L ++L                 SH        E ++I V G L E +  E  R  IK     E  +  L  ++E L  +    + +CA+  +   ++ RL G                   L+ L S   NT+N                       ++ L+A    I +     +NV    ++  +  L  L+    +++   +  A+  C   ++NR    +   I P+VN L   +  + V+  +A+   + +P +   +++     LL +++ + + D++ +AA A+
Sbjct:   12 QLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEARDVEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLL---------------KTSH--------ENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKE-TRDLVRLHG------------------GLKPLASLLNNTDN-----------------------KERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEEVLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWAL 387          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Fly
Match: gudu (gene:FBgn0031905 transcript:FBtr0079438)

HSP 1 Score: 375.17 bits (962), Expect = 4.880e-118
Identity = 225/631 (35.66%), Postives = 368/631 (58.32%), Query Frame = 1
Query:  661 QISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEG---DQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRL-EKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            +I   Y+ + K+++YI+ GN  AT++ LC + +  L +     A+ D  G+ +L+N+L  +D +C +G+LK+L ++   I   + +  L GI  ++D L     DL+ +AAETLA +   + AR  +R   GI  LV L+D+       KLSI  T R  +   D     +T+  A AL+ ++ SK N   MR++G++PL+A+LL+  + +++IP++GT+++C+SE  ++++I TEGM+P ++ HL+S+N  L+ + +  I+KCA D  TR LVR  GG++ L+  +  +    ++ LL   TGAIW C +             T+  +K+LD+L            + +H +  L ++ ++++ NVTGA+ E  + +  R+ ++        +SLL      LL N    LKECA+ PD M  +  LD V +++++ K   T V A A  A+  C  N  +SA L++SLVG++EL V  L+S +  VLSA C+ IA I +D  N+AIL+D  V+  L+ LV+T +D LR  L+ A+A C+ + +N E+ GR   +TPIV ++ S +  VH S A AL KLS DP N   M+Q+GV   L+  IGS NK+LQ+AAAG + N+R++ +  E+
Sbjct:   62 EIPADYYNIQKLVKYIKAGNQTATIVSLCCLKDYDLSTQINQFAISDIGGLDVLVNILECSDTKCCLGALKVLSDITLNIDIRKTIVDLDGIPLIVDILNSSMKDLKTMAAETLANVCKVRLARKYVRTCGGIPKLVDLIDI-------KLSILKTPRDQLSPDDLESLDMTRAGARALFTLADSKHNMEQMRKSGIVPLMAQLLKSCHIDVVIPIMGTVRKCSSEPKFQLAITTEGMIPDIVSHLSSENTELKMEGSTAIYKCAFDGTTRDLVREAGGLEPLVTIIKDKNVRENKPLLRGATGAIWMCAV-------------TDANVKVLDQLR-----------TVNHLVALLNDECDEVLTNVTGAISECVRFQSNREQLRQAGGLPAMVSLLNSSHAPLLENLAKGLKECAEDPDSMRILEDLDAVRLIWSLLKNPTTRVQAHAAYAICPCVRNANDSAELVRSLVGAMELVVGLLKSKDIMVLSAVCAAIATIAQDQTNLAILTDLKVIYKLADLVQTTDDLLRMNLAAAVAACACFGNNTEELGRLRTVTPIVTYMTSDNPLVHRSTAMALEKLSMDPQNCITMHQSGVVPFLLECIGSTNKELQLAAAGCLRNIRELALRAEE 661          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Zebrafish
Match: armc4 (armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB-GENE-100316-7])

HSP 1 Score: 441.81 bits (1135), Expect = 3.535e-139
Identity = 244/622 (39.23%), Postives = 371/622 (59.65%), Query Frame = 1
Query:  676 YWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            YWQ+ K+++Y++  N  AT++ LC + +  L    C  A+ D  G+ +L+NLL  +++RC+IGSLKIL+E++      R +  LGG+Q ++  L   + +L+CLAAET+A +A F+RAR  +R+  GI  LV LLD     A + LS+         QRD     V +  A ALW  SKS  N+  +RRAG IP+L +LL+   +N+LIPV+GTLQ+CASE  YRI+I+ EGM+  L+K+L+  N  L+   A  IFKCA D  TR LVR   G+  L+  ++   +++LL A TGAIWKC +   N  +        +L+++L   P                       E++++NV GAL E  ++ E    I+  +  +  ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A+A  A+  C  N +++  +++S VG LEL VN L+S N+DVL++ C+ IA+I KD +N+A+++D GVV +L+ L  T+ DKLRR L+EAIA C  +  N   FG A  + P+V +L S D  VH + ARALF+LS+DPNN   M++ GV  LL+ MIGS ++ LQ AAA  + N+R++ + ++K
Sbjct:  457 YWQIQKLVKYLKGANQTATVIVLCSLRDFNLVQDTCQLAIRDVGGLEVLINLLDTDEIRCKIGSLKILKEISCNSQIRRTIANLGGLQTMVSILDSPDKELKCLAAETIANVAKFRRARRMVRQHGGIQRLVELLDC--VPAGESLSLEQ-------QRD---VEVARCGALALWSCSKSTWNKEAIRRAGGIPMLGRLLKSPQKNMLIPVVGTLQECASEKSYRIAIQAEGMIEDLVKNLSCDNQELQMHCASAIFKCAEDKHTRDLVRQYDGLKPLVTLLNEAENKQLLAATTGAIWKCSISMENVAKFQEYKVVEILVRLLTNQP-----------------------EEVLVNVVGALGECGQISENLATIRRSSGIQPLVNLLTGTNQALLVNVTKAVGACATDPENMMIIDRLDGVRLLWSLLKNPNPEVQASAAWAICPCIENAKDAGEMVRSFVGGLELIVNLLKSQNKDVLASVCAAIAKIAKDVENLAVITDHGVVPMLASLTNTEEDKLRRYLAEAIACCCTWGSNCVSFGEAGAVAPLVRYLYSKDPSVHQATARALFELSKDPNNCITMHENGVVKLLLVMIGSTDEILQEAAASCVANIRRLALANDK 1043          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Zebrafish
Match: armc4 (armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB-GENE-100316-7])

HSP 1 Score: 441.81 bits (1135), Expect = 3.535e-139
Identity = 244/622 (39.23%), Postives = 371/622 (59.65%), Query Frame = 1
Query:  676 YWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            YWQ+ K+++Y++  N  AT++ LC + +  L    C  A+ D  G+ +L+NLL  +++RC+IGSLKIL+E++      R +  LGG+Q ++  L   + +L+CLAAET+A +A F+RAR  +R+  GI  LV LLD     A + LS+         QRD     V +  A ALW  SKS  N+  +RRAG IP+L +LL+   +N+LIPV+GTLQ+CASE  YRI+I+ EGM+  L+K+L+  N  L+   A  IFKCA D  TR LVR   G+  L+  ++   +++LL A TGAIWKC +   N  +        +L+++L   P                       E++++NV GAL E  ++ E    I+  +  +  ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A+A  A+  C  N +++  +++S VG LEL VN L+S N+DVL++ C+ IA+I KD +N+A+++D GVV +L+ L  T+ DKLRR L+EAIA C  +  N   FG A  + P+V +L S D  VH + ARALF+LS+DPNN   M++ GV  LL+ MIGS ++ LQ AAA  + N+R++ + ++K
Sbjct:  457 YWQIQKLVKYLKGANQTATVIVLCSLRDFNLVQDTCQLAIRDVGGLEVLINLLDTDEIRCKIGSLKILKEISCNSQIRRTIANLGGLQTMVSILDSPDKELKCLAAETIANVAKFRRARRMVRQHGGIQRLVELLDC--VPAGESLSLEQ-------QRD---VEVARCGALALWSCSKSTWNKEAIRRAGGIPMLGRLLKSPQKNMLIPVVGTLQECASEKSYRIAIQAEGMIEDLVKNLSCDNQELQMHCASAIFKCAEDKHTRDLVRQYDGLKPLVTLLNEAENKQLLAATTGAIWKCSISMENVAKFQEYKVVEILVRLLTNQP-----------------------EEVLVNVVGALGECGQISENLATIRRSSGIQPLVNLLTGTNQALLVNVTKAVGACATDPENMMIIDRLDGVRLLWSLLKNPNPEVQASAAWAICPCIENAKDAGEMVRSFVGGLELIVNLLKSQNKDVLASVCAAIAKIAKDVENLAVITDHGVVPMLASLTNTEEDKLRRYLAEAIACCCTWGSNCVSFGEAGAVAPLVRYLYSKDPSVHQATARALFELSKDPNNCITMHENGVVKLLLVMIGSTDEILQEAAASCVANIRRLALANDK 1043          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Zebrafish
Match: CR847789.1 (armadillo repeat containing 4 [Source:NCBI gene;Acc:799229])

HSP 1 Score: 441.425 bits (1134), Expect = 4.693e-139
Identity = 244/622 (39.23%), Postives = 371/622 (59.65%), Query Frame = 1
Query:  676 YWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            YWQ+ K+++Y++  N  AT++ LC + +  L    C  A+ D  G+ +L+NLL  +++RC+IGSLKIL+E++      R +  LGG+Q ++  L   + +L+CLAAET+A +A F+RAR  +R+  GI  LV LLD     A + LS+         QRD     V +  A ALW  SKS  N+  +RRAG IP+L +LL+   +N+LIPV+GTLQ+CASE  YRI+I+ EGM+  L+K+L+  N  L+   A  IFKCA D  TR LVR   G+  L+  ++   +++LL A TGAIWKC +   N  +        +L+++L   P                       E++++NV GAL E  ++ E    I+  +  +  ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A+A  A+  C  N +++  +++S VG LEL VN L+S N+DVL++ C+ IA+I KD +N+A+++D GVV +L+ L  T+ DKLRR L+EAIA C  +  N   FG A  + P+V +L S D  VH + ARALF+LS+DPNN   M++ GV  LL+ MIGS ++ LQ AAA  + N+R++ + ++K
Sbjct:  457 YWQIQKLVKYLKGANQTATVIVLCSLRDFNLVQDTCQLAIRDVGGLEVLINLLDTDEIRCKIGSLKILKEISCNSQIRRTIANLGGLQTMVSILDSSDKELKCLAAETIANVAKFRRARRMVRQHGGIQRLVELLDC--VPAGESLSLEQ-------QRD---VEVARCGALALWSCSKSTWNKEAIRRAGGIPMLGRLLKSPQKNMLIPVVGTLQECASEKSYRIAIQAEGMIEDLVKNLSCDNQELQMHCASAIFKCAEDKHTRDLVRQYDGLKPLVTLLNEAENKQLLAATTGAIWKCSISMENVAKFQEYKVVEILVRLLTNQP-----------------------EEVLVNVVGALGECGQISENLATIRRSSGIQPLVNLLTGTNQALLVNVTKAVGACATDPENMMIIDRLDGVRLLWSLLKNPNPEVQASAAWAICPCIENAKDAGEMVRSFVGGLELIVNLLKSQNKDVLASVCAAIAKIAKDVENLAVITDHGVVPMLASLTNTEEDKLRRYLAEAIACCCTWGSNCVSFGEAGAVAPLVRYLYSKDPSVHQATARALFELSKDPNNCITMHENGVVKLLLVMIGSTDEILQEAAASCVANIRRLALANDK 1043          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Zebrafish
Match: armc4 (armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB-GENE-100316-7])

HSP 1 Score: 98.9821 bits (245), Expect = 5.694e-24
Identity = 49/97 (50.52%), Postives = 67/97 (69.07%), Query Frame = 1
Query: 1288 QNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKC 1578
            +N+LIPV+GTLQ+CASE  YRI+I+ EGM+  L+K+L+  N  L+   A  IFKCA D  TR LVR   G+  L+  ++   +++LL A TGAIWKC
Sbjct:    2 KNMLIPVVGTLQECASEKSYRIAIQAEGMIEDLVKNLSCDNQELQMHCASAIFKCAEDKHTRDLVRQYDGLKPLVTLLNEAENKQLLAATTGAIWKC 98          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Xenopus
Match: gc (group-specific component (vitamin D binding protein) [Source:Xenbase;Acc:XB-GENE-947316])

HSP 1 Score: 446.817 bits (1148), Expect = 4.581e-142
Identity = 246/632 (38.92%), Postives = 378/632 (59.81%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            Q+ +  +   YWQ+ K+++Y++ GN  AT++ LC + +  L    C  A+ D  G+ +L+NLL+  +++C+IG+LKIL+E++        +  LGG+Q ++  L   + DL+CLAAET+A +A F+RAR  +R+  GI  LV LLD           I S+N  +  ++D     V +  A ALW  SKS RN+  +R+AG IPLLA+LL+ ++ N+LIPV+GTLQ+CASE  YR++I+TE M+  L+K+L S+N  L+   A  IFKCA D +TR LVR  GG+  L M +    +++LL A+TGAIWKC +   N  +         L+ +L   P                       E++++NV GAL E  +    R +I+        ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A A  A+  C  N +++  +++S VG LEL VN L+S N++VL++ C+ I  I KD +N+A+++D GVV LLS L  T +DKLRR L+EAI+ C  +  NR  FG +  + P+V++L+SSD  VH + A+AL++LS+D NN   M++ GV  LLI+M+GS +  LQ AAAG I N+R++ + +EK
Sbjct:  330 QEGNTDLPSEYWQIQKLVKYLKGGNQTATVIALCSIRDFNLAQETCQLAIRDVGGLDILINLLNTEEIKCKIGALKILKEISHNSQIRSAIADLGGLQTMVGILDSQDKDLKCLAAETIANVAKFRRARRTVRQHGGIRRLVGLLDC--------APIGSSNLSAQQEKD---IEVARCGALALWSCSKSTRNKEAIRKAGGIPLLARLLKSSHSNMLIPVVGTLQECASEPSYRLAIKTEKMIEDLVKNLKSENPELQMHCASAIFKCAEDEETRDLVRQYGGLQPLAMLLGQFENKELLAAVTGAIWKCSISRDNVTKFQEYKVIETLVTLLTNQP-----------------------EEVLVNVVGALGECGQEPANRAIIRKCGGISPLVNLLSGTNQALLVNVTKAVGACASDPENMVIIDRLDGVRLLWSLLKNPHPDVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVNLLKSENKEVLASVCAAITNIAKDEENLAVITDHGVVALLSALANTTDDKLRRHLAEAISHCCMWGHNRVAFGESKAVAPLVHYLKSSDPLVHRATAQALYQLSEDANNCITMHENGVVKLLIDMVGSPDSMLQEAAAGCIANIRRLALANEK 927          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Xenopus
Match: gc (group-specific component (vitamin D binding protein) [Source:Xenbase;Acc:XB-GENE-947316])

HSP 1 Score: 446.817 bits (1148), Expect = 7.805e-142
Identity = 246/632 (38.92%), Postives = 378/632 (59.81%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            Q+ +  +   YWQ+ K+++Y++ GN  AT++ LC + +  L    C  A+ D  G+ +L+NLL+  +++C+IG+LKIL+E++        +  LGG+Q ++  L   + DL+CLAAET+A +A F+RAR  +R+  GI  LV LLD           I S+N  +  ++D     V +  A ALW  SKS RN+  +R+AG IPLLA+LL+ ++ N+LIPV+GTLQ+CASE  YR++I+TE M+  L+K+L S+N  L+   A  IFKCA D +TR LVR  GG+  L M +    +++LL A+TGAIWKC +   N  +         L+ +L   P                       E++++NV GAL E  +    R +I+        ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A A  A+  C  N +++  +++S VG LEL VN L+S N++VL++ C+ I  I KD +N+A+++D GVV LLS L  T +DKLRR L+EAI+ C  +  NR  FG +  + P+V++L+SSD  VH + A+AL++LS+D NN   M++ GV  LLI+M+GS +  LQ AAAG I N+R++ + +EK
Sbjct:  359 QEGNTDLPSEYWQIQKLVKYLKGGNQTATVIALCSIRDFNLAQETCQLAIRDVGGLDILINLLNTEEIKCKIGALKILKEISHNSQIRSAIADLGGLQTMVGILDSQDKDLKCLAAETIANVAKFRRARRTVRQHGGIRRLVGLLDC--------APIGSSNLSAQQEKD---IEVARCGALALWSCSKSTRNKEAIRKAGGIPLLARLLKSSHSNMLIPVVGTLQECASEPSYRLAIKTEKMIEDLVKNLKSENPELQMHCASAIFKCAEDEETRDLVRQYGGLQPLAMLLGQFENKELLAAVTGAIWKCSISRDNVTKFQEYKVIETLVTLLTNQP-----------------------EEVLVNVVGALGECGQEPANRAIIRKCGGISPLVNLLSGTNQALLVNVTKAVGACASDPENMVIIDRLDGVRLLWSLLKNPHPDVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVNLLKSENKEVLASVCAAITNIAKDEENLAVITDHGVVALLSALANTTDDKLRRHLAEAISHCCMWGHNRVAFGESKAVAPLVHYLKSSDPLVHRATAQALYQLSEDANNCITMHENGVVKLLIDMVGSPDSMLQEAAAGCIANIRRLALANEK 956          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Xenopus
Match: gc (group-specific component (vitamin D binding protein) [Source:Xenbase;Acc:XB-GENE-947316])

HSP 1 Score: 448.743 bits (1153), Expect = 1.725e-141
Identity = 246/632 (38.92%), Postives = 378/632 (59.81%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            Q+ +  +   YWQ+ K+++Y++ GN  AT++ LC + +  L    C  A+ D  G+ +L+NLL+  +++C+IG+LKIL+E++        +  LGG+Q ++  L   + DL+CLAAET+A +A F+RAR  +R+  GI  LV LLD           I S+N  +  ++D     V +  A ALW  SKS RN+  +R+AG IPLLA+LL+ ++ N+LIPV+GTLQ+CASE  YR++I+TE M+  L+K+L S+N  L+   A  IFKCA D +TR LVR  GG+  L M +    +++LL A+TGAIWKC +   N  +         L+ +L   P                       E++++NV GAL E  +    R +I+        ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A A  A+  C  N +++  +++S VG LEL VN L+S N++VL++ C+ I  I KD +N+A+++D GVV LLS L  T +DKLRR L+EAI+ C  +  NR  FG +  + P+V++L+SSD  VH + A+AL++LS+D NN   M++ GV  LLI+M+GS +  LQ AAAG I N+R++ + +EK
Sbjct:  452 QEGNTDLPSEYWQIQKLVKYLKGGNQTATVIALCSIRDFNLAQETCQLAIRDVGGLDILINLLNTEEIKCKIGALKILKEISHNSQIRSAIADLGGLQTMVGILDSQDKDLKCLAAETIANVAKFRRARRTVRQHGGIRRLVGLLDC--------APIGSSNLSAQQEKD---IEVARCGALALWSCSKSTRNKEAIRKAGGIPLLARLLKSSHSNMLIPVVGTLQECASEPSYRLAIKTEKMIEDLVKNLKSENPELQMHCASAIFKCAEDEETRDLVRQYGGLQPLAMLLGQFENKELLAAVTGAIWKCSISRDNVTKFQEYKVIETLVTLLTNQP-----------------------EEVLVNVVGALGECGQEPANRAIIRKCGGISPLVNLLSGTNQALLVNVTKAVGACASDPENMVIIDRLDGVRLLWSLLKNPHPDVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVNLLKSENKEVLASVCAAITNIAKDEENLAVITDHGVVALLSALANTTDDKLRRHLAEAISHCCMWGHNRVAFGESKAVAPLVHYLKSSDPLVHRATAQALYQLSEDANNCITMHENGVVKLLIDMVGSPDSMLQEAAAGCIANIRRLALANEK 1049          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Mouse
Match: Armc4 (armadillo repeat containing 4 [Source:MGI Symbol;Acc:MGI:1922184])

HSP 1 Score: 449.129 bits (1154), Expect = 5.745e-142
Identity = 242/632 (38.29%), Postives = 386/632 (61.08%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            Q+++  +   YWQ+ K+++Y++ GN  AT++ LC M +  L    C  A+ D  G+ +L+NLL  ++++C+IGSLKIL+E++      RN+  LGG+  +++ L   +  L+CL+AET+A +A FKRAR  +R+  GI+ LV LLD   +  E         +PS+ +  T    V +  A ALW  SKS  N+  +R+AG IPLLA+LL+ +++N+LIPV+GTLQ+CASE  YR +I+ E ++  L+K+LNS+N  L+   A+ I++CA D +TR LVR  GG+  L   ++   +++ L A+TGAIWKC +   N ++         L+ +L + P                       E++++NV GAL E  +  E R L++     +  ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A+A  AL  C  N +++  +++S VG LEL VN L+S N++VL++ C+ I  I KD +N+A+++D GVV LLS+L  T+NDKLRR L+EAI+ C  +  NR  FG    + P+V +L+S+D +VH + A+AL++LS+D +N   M++ G   LL++M+GS ++DLQ AAAG I N+R++ +  EK
Sbjct:  434 QEANADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFNLAQETCQLAIRDVGGLEVLINLLDTDEVKCKIGSLKILKEISHNPQIRRNIVDLGGLPIMVNILDSPHKSLKCLSAETIANVAKFKRARRAVRQHGGITKLVALLDCGQNSTE-------PTQPSLYE--TRDVEVARCGALALWSCSKSHSNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDEETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVIKFREYKAIETLVGLLTDQP-----------------------EEVLVNVVGALGECCQEYENRVLVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMAIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIENAKDAGEMVRSFVGGLELVVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNDKLRRHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEK 1033          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Mouse
Match: Armc4 (armadillo repeat containing 4 [Source:MGI Symbol;Acc:MGI:1922184])

HSP 1 Score: 449.129 bits (1154), Expect = 5.745e-142
Identity = 242/632 (38.29%), Postives = 386/632 (61.08%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            Q+++  +   YWQ+ K+++Y++ GN  AT++ LC M +  L    C  A+ D  G+ +L+NLL  ++++C+IGSLKIL+E++      RN+  LGG+  +++ L   +  L+CL+AET+A +A FKRAR  +R+  GI+ LV LLD   +  E         +PS+ +  T    V +  A ALW  SKS  N+  +R+AG IPLLA+LL+ +++N+LIPV+GTLQ+CASE  YR +I+ E ++  L+K+LNS+N  L+   A+ I++CA D +TR LVR  GG+  L   ++   +++ L A+TGAIWKC +   N ++         L+ +L + P                       E++++NV GAL E  +  E R L++     +  ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A+A  AL  C  N +++  +++S VG LEL VN L+S N++VL++ C+ I  I KD +N+A+++D GVV LLS+L  T+NDKLRR L+EAI+ C  +  NR  FG    + P+V +L+S+D +VH + A+AL++LS+D +N   M++ G   LL++M+GS ++DLQ AAAG I N+R++ +  EK
Sbjct:  434 QEANADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFNLAQETCQLAIRDVGGLEVLINLLDTDEVKCKIGSLKILKEISHNPQIRRNIVDLGGLPIMVNILDSPHKSLKCLSAETIANVAKFKRARRAVRQHGGITKLVALLDCGQNSTE-------PTQPSLYE--TRDVEVARCGALALWSCSKSHSNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDEETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVIKFREYKAIETLVGLLTDQP-----------------------EEVLVNVVGALGECCQEYENRVLVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMAIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIENAKDAGEMVRSFVGGLELVVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNDKLRRHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEK 1033          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Mouse
Match: Armc4 (armadillo repeat containing 4 [Source:MGI Symbol;Acc:MGI:1922184])

HSP 1 Score: 61.2326 bits (147), Expect = 3.718e-11
Identity = 32/81 (39.51%), Postives = 52/81 (64.20%), Query Frame = 1
Query:  715 GNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNL 957
            GN  AT++ LC M +  L    C  A+ D  G+ +L+NLL  ++++C+IGSLKIL+E++      RN+  LGG+ P++ N+
Sbjct:    6 GNQTATVIALCSMRDFNLAQETCQLAIRDVGGLEVLINLLDTDEVKCKIGSLKILKEISHNPQIRRNIVDLGGL-PIMVNI 85          
BLAST of Armadillo repeat-containing protein 4 vs. UniProt/SwissProt
Match: sp|B2RY50|ARMC4_MOUSE (Armadillo repeat-containing protein 4 OS=Mus musculus OX=10090 GN=Armc4 PE=1 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 4.019e-141
Identity = 242/632 (38.29%), Postives = 386/632 (61.08%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            Q+++  +   YWQ+ K+++Y++ GN  AT++ LC M +  L    C  A+ D  G+ +L+NLL  ++++C+IGSLKIL+E++      RN+  LGG+  +++ L   +  L+CL+AET+A +A FKRAR  +R+  GI+ LV LLD   +  E         +PS+ +  T    V +  A ALW  SKS  N+  +R+AG IPLLA+LL+ +++N+LIPV+GTLQ+CASE  YR +I+ E ++  L+K+LNS+N  L+   A+ I++CA D +TR LVR  GG+  L   ++   +++ L A+TGAIWKC +   N ++         L+ +L + P                       E++++NV GAL E  +  E R L++     +  ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A+A  AL  C  N +++  +++S VG LEL VN L+S N++VL++ C+ I  I KD +N+A+++D GVV LLS+L  T+NDKLRR L+EAI+ C  +  NR  FG    + P+V +L+S+D +VH + A+AL++LS+D +N   M++ G   LL++M+GS ++DLQ AAAG I N+R++ +  EK
Sbjct:  434 QEANADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFNLAQETCQLAIRDVGGLEVLINLLDTDEVKCKIGSLKILKEISHNPQIRRNIVDLGGLPIMVNILDSPHKSLKCLSAETIANVAKFKRARRAVRQHGGITKLVALLDCGQNSTE-------PTQPSLYE--TRDVEVARCGALALWSCSKSHSNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDEETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVIKFREYKAIETLVGLLTDQP-----------------------EEVLVNVVGALGECCQEYENRVLVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMAIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIENAKDAGEMVRSFVGGLELVVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNDKLRRHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEK 1033          
BLAST of Armadillo repeat-containing protein 4 vs. UniProt/SwissProt
Match: sp|Q5T2S8|ARMC4_HUMAN (Armadillo repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=ARMC4 PE=1 SV=1)

HSP 1 Score: 435.647 bits (1119), Expect = 6.798e-136
Identity = 240/633 (37.91%), Postives = 382/633 (60.35%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLD-VDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            Q++   +   YWQ+ K+++Y++ GN  AT++ LC M +  L    C  A+ D  G+ +L+NLL  ++++C+IGSLKIL+E++      +N+  LGG+  +++ L   +  L+CLAAET+A +A FKRAR  +R+  GI+ LV LLD   DS    + S+          RD     V +  A ALW  SKS  N+  +R+AG IPLLA+LL+ +++N+LIPV+GTLQ+CASE  YR +I+ E ++  L+K+LNS+N  L+   A+ I++CA D +TR LVR  GG+  L   ++   +++ L A+TGAIWKC +   N  +         L+ +L + P                       E++++NV GAL E  +  E R +++     +  ++LL   ++ LL N    +  CA  P+ M  I+RLDGV +L+++ K     V A+A  AL  C  N +++  +++S VG LEL VN L+S N++VL++ C+ I  I KD +N+A+++D GVV LLS+L  T+N+KLR  L+EAI+ C  +  NR  FG    + P+V +L+S+D +VH + A+AL++LS+D +N   M++ G   LL++M+GS ++DLQ AAAG I N+R++ +  EK
Sbjct:  441 QEASADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEA-------RD---VEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQP-----------------------EEVLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEK 1040          
BLAST of Armadillo repeat-containing protein 4 vs. UniProt/SwissProt
Match: sp|Q9VM21|GUDU_DROME (Armadillo repeat-containing protein gudu OS=Drosophila melanogaster OX=7227 GN=gudu PE=2 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 4.892e-117
Identity = 225/631 (35.66%), Postives = 368/631 (58.32%), Query Frame = 1
Query:  661 QISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEG---DQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRL-EKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            +I   Y+ + K+++YI+ GN  AT++ LC + +  L +     A+ D  G+ +L+N+L  +D +C +G+LK+L ++   I   + +  L GI  ++D L     DL+ +AAETLA +   + AR  +R   GI  LV L+D+       KLSI  T R  +   D     +T+  A AL+ ++ SK N   MR++G++PL+A+LL+  + +++IP++GT+++C+SE  ++++I TEGM+P ++ HL+S+N  L+ + +  I+KCA D  TR LVR  GG++ L+  +  +    ++ LL   TGAIW C +             T+  +K+LD+L            + +H +  L ++ ++++ NVTGA+ E  + +  R+ ++        +SLL      LL N    LKECA+ PD M  +  LD V +++++ K   T V A A  A+  C  N  +SA L++SLVG++EL V  L+S +  VLSA C+ IA I +D  N+AIL+D  V+  L+ LV+T +D LR  L+ A+A C+ + +N E+ GR   +TPIV ++ S +  VH S A AL KLS DP N   M+Q+GV   L+  IGS NK+LQ+AAAG + N+R++ +  E+
Sbjct:   62 EIPADYYNIQKLVKYIKAGNQTATIVSLCCLKDYDLSTQINQFAISDIGGLDVLVNILECSDTKCCLGALKVLSDITLNIDIRKTIVDLDGIPLIVDILNSSMKDLKTMAAETLANVCKVRLARKYVRTCGGIPKLVDLIDI-------KLSILKTPRDQLSPDDLESLDMTRAGARALFTLADSKHNMEQMRKSGIVPLMAQLLKSCHIDVVIPIMGTVRKCSSEPKFQLAITTEGMIPDIVSHLSSENTELKMEGSTAIYKCAFDGTTRDLVREAGGLEPLVTIIKDKNVRENKPLLRGATGAIWMCAV-------------TDANVKVLDQLR-----------TVNHLVALLNDECDEVLTNVTGAISECVRFQSNREQLRQAGGLPAMVSLLNSSHAPLLENLAKGLKECAEDPDSMRILEDLDAVRLIWSLLKNPTTRVQAHAAYAICPCVRNANDSAELVRSLVGAMELVVGLLKSKDIMVLSAVCAAIATIAQDQTNLAILTDLKVIYKLADLVQTTDDLLRMNLAAAVAACACFGNNTEELGRLRTVTPIVTYMTSDNPLVHRSTAMALEKLSMDPQNCITMHQSGVVPFLLECIGSTNKELQLAAAGCLRNIRELALRAEE 661          
BLAST of Armadillo repeat-containing protein 4 vs. UniProt/SwissProt
Match: sp|Q2GW27|VAC8_CHAGB (Vacuolar protein 8 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=VAC8 PE=3 SV=3)

HSP 1 Score: 64.3142 bits (155), Expect = 3.081e-9
Identity = 54/193 (27.98%), Postives = 95/193 (49.22%), Query Frame = 1
Query: 1942 PILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEM--NQAGVSHLLINMIGSENKDLQIAAAGAIGNL 2514
            PILF + + S   V  AA  AL +   NT+N   +++  +G L+  + Q+ S N +V       I  +    +N A ++  G +  L+RL K+ + +++R  + A+   +   +NR+Q   A  I  +V  L SSD+ V      AL  ++ D NN  ++   +  +   L+N+  S +  +Q  AA A+ NL
Sbjct:   91 PILF-LLENSDIEVQRAASAALGNLAVNTDNKVLIVQ--LGGLQPLIKQMMSPNVEVQCNAVGCITNLATHEENKAKIARSGALGPLTRLAKSKDMRVQRNATGALLNMTHSDENRQQLVNAGAIPVLVQLLSSSDVDVQYYCTTALSNIAVDANNRRKLAETEQRLVQYLVNLTESSSPKVQCQAALALRNL 280          
BLAST of Armadillo repeat-containing protein 4 vs. UniProt/SwissProt
Match: sp|Q2U5T5|VAC8_ASPOR (Vacuolar protein 8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=vac8 PE=3 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 1.367e-8
Identity = 56/203 (27.59%), Postives = 96/203 (47.29%), Query Frame = 1
Query: 1912 MEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQ--AGVSHLLINMIGSENKDLQIAAAGAIGNL 2514
            + E++R    PILF + + S   V  AA  AL +   N +N   ++   +G L   + Q+ S N +V       I  +    DN A ++  G +  L RL K+ + +++R  + A+   +   DNR+Q   A  I  +V  L SSD+ V      AL  ++ D +N   + Q  + +   L++++ S    +Q  AA A+ NL
Sbjct:  100 VREVDRDTLEPILF-LLQSSDIEVQRAASAALGNLAVNADNKVLIVA--LGGLAPLIRQMMSPNVEVQCNAVGCITNLATHEDNKAKIARSGALGPLIRLAKSKDMRVQRNATGALLNMTHSDDNRQQLVNAGAIPVLVQLLSSSDVDVQYYCTTALSNIAVDASNRKRLAQTESRLVQSLVHLMDSSTPKVQCQAALALRNL 299          
BLAST of Armadillo repeat-containing protein 4 vs. TrEMBL
Match: A0A4S2M213 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003307 PE=4 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 3.012e-153
Identity = 257/636 (40.41%), Postives = 403/636 (63.36%), Query Frame = 1
Query:  649 KSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQSMMK 2556
            +S V +   YWQ+ K+++Y++ GN  +T++ LC + +  L +  C  A+ D  G+ +L+NLL   ++RC++GSLKILRE+       R +  +GG+QPL++ L+  N DL+CL+AE +A +A F RAR  +R++ GI  LV LLD          S+++    + ++RD     V +  A ALW  SKS++N++ M++AGVI LLA+LL+  ++N+LIPV+GTLQ+CASE  YR++IRTEGM+  L+K+L   N  L+   A TIFKCA + +TR LVR  GG++ LI+ +  + +++LL A TGAIWKC +   N V+         L+ +L+E P+    YL  + S S ++  + + EK+++NV GAL E++K       I+  +     +SLL   +++LL NT   +++CA  P+ M  I  LDGV +L+++ K     V + A  A+  C  N +++  +++S VG LEL V+ L S N +VL+A C+ +++I  D +N+A+++D GVV LLSRL  T +DKLR  L+EAIA C  +  NR  FGRA  ++P+V +L S+D +VH S A+ALF+LS+DPNN   M+ AGV   L+ M+GS + +LQ AAAG I N+R++ + +EK  + +
Sbjct:  471 ESHVDLPSEYWQIGKIVKYLKGGNQTSTIISLCALQDMPLNTEVCQLAVRDVGGLDVLINLLETEEVRCKLGSLKILREITKNPKIRRAIADVGGLQPLVNLLRSPNRDLKCLSAEVIANVANFHRARRTVRQYGGIKRLVALLDCP--------SLNAVPMTTDVERD---IEVARCGALALWSCSKSRKNKLAMKKAGVISLLARLLKSPHENMLIPVVGTLQECASEPTYRVAIRTEGMVEDLVKNLKRPNPELQMHCASTIFKCAEEPETRDLVRLYGGLEPLIVLLAKQDNKELLAAATGAIWKCAISKENVVQFQKLGVIEKLVGLLNEQPEEMSTYLYVE-SVSPRIQLVLRTEKVLVNVVGALGEMAKDANNIVTIRRTHGIPPLVSLLTRTNQDLLINTTRAIEKCAGEPESMSIIESLDGVRLLWSLLKNPNPEVQSGAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLRSTNMNVLAAVCAAVSKIAVDEENLAVITDHGVVALLSRLTCTKDDKLRCPLTEAIARCCTWGTNRVDFGRAGAVSPLVGYLNSTDPNVHRSTAKALFQLSRDPNNCVAMHDAGVVKPLLQMVGSPDMELQTAAAGCISNIRRLSLANEKAQLTR 1094          
BLAST of Armadillo repeat-containing protein 4 vs. TrEMBL
Match: A0A095AS04 (Armadillo repeat-containing protein 4 OS=Schistosoma haematobium OX=6185 GN=MS3_05488 PE=4 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 8.480e-153
Identity = 256/642 (39.88%), Postives = 393/642 (61.21%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQSMMKKMEKI 2571
            Q ++  +   YWQ+ K+++Y++ GN  +T++ LC + +  LK+  C  A+ D  GI LL+NLL  +++RC++GSLKIL+E+       ++VT +GG+QPL++ L+  N DL+CL AE +A +A   RAR  +R++ GI +LV LLD          S++S    S ++RD     V +  A ALW  SKS++N++ M+ AGVIPLL +LL+  ++N+LIPV+GTLQ+CASE  YR +IRTEGM+  L+K+L   N  L+   A TIFKCA + +TR LVR   G++ L+  +  + +++LL A+TGAIWKC +   N  +         L+ +L ELP                       E++++NV GAL E++K    R  I+        +SLL   ++ LL NT   + +CA+  D M  I  LDGV +L+++ K     V + A  AL  C  N +++  L++S VG LEL V+ L S + +VL+A C+ +++I +D +N+A+++D GVV LLSRL  T +D+LR  L++AIA C  +  NR  FGRA  + PIV +L+SSD +VH S A+ALF+LS+DPNN   M+Q  V   L+ M+GS + +LQ A+AG I N+R++ + +EK  + K  EK+
Sbjct:   48 QDANADLPSEYWQVGKIIKYLKGGNQTSTIISLCALKDMPLKTEICQLAVRDVGGIELLINLLETDEVRCKLGSLKILKEITKNPQIRKSVTDIGGLQPLVNLLRSLNRDLKCLCAEVIANVANCHRARRTVRQYGGIKYLVALLDCP--------SLNSVPMTSEVERD---IEVARCGALALWSCSKSRKNKLAMKHAGVIPLLVRLLKSPHENMLIPVVGTLQECASEESYRFAIRTEGMIGDLVKNLKRDNDELQMHCASTIFKCAEEPETRDLVRTYNGLEPLVALLSKQSNKELLAAVTGAIWKCAISKENVKQFQKLGTIEQLVGLLSELP-----------------------EEVLVNVVGALSEMAKDSSNRSTIRKAGGIPSLVSLLTRTNQELLTNTTKAVGKCAEEADSMSIIENLDGVRLLWSLLKNPNPKVQSYAAWALCPCIQNAKDAGELVRSFVGGLELIVSLLNSKDLEVLAAVCAAVSKIAEDEENLAVITDHGVVPLLSRLTHTKDDRLRCPLTDAIAKCCTWGTNRIDFGRAGAVIPIVRYLKSSDPNVHRSTAKALFQLSRDPNNCVSMHQVNVVKYLLQMVGSSDPELQTASAGCISNIRRLALANEKVHLTKLHEKV 655          
BLAST of Armadillo repeat-containing protein 4 vs. TrEMBL
Match: A0A3Q0KTP0 (Putative armc4 OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 474.937 bits (1221), Expect = 2.561e-152
Identity = 255/642 (39.72%), Postives = 394/642 (61.37%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQSMMKKMEKI 2571
            Q ++  +   YWQ+ K+++Y++ GN  +T++ LC + +  LK+  C  A+ D  GI +L+NLL  +++RC++GSLKIL+E+       ++VT +GG+QPL++ L+  N DL+CL AE +A +A   RAR  +R++ GI +LV LLD          S++S    S ++RD     V +  A ALW  SKS++N++ M+RAGVI LL +LL+  ++N+LIPV+GTLQ+CASE  YRI+IRTEGM+  L+K+L   N  L+   A TIFKCA + +TR LVR   G++ L+  +  + +++LL A+TGAIWKC +   N  +         L+ +L+E P                       E++++NV GAL E++K    R  I+        +SLL   ++ LL NT   + +CA+  D M  I  LDGV +L+++ K     V + A  AL  C  N +++  L++S VG LEL V+ L S + +VL+A C+ +++I +D +N+A+++D GVV LLSRL  T +D+LR  L++A+A C  +  NR  FGRA  + PIV +L+SSD +VH S A+ALF+LS+DPNN   M+Q  V   L+ M+GS + +LQ A+AG I N+R++ + +EK  + K  EKI
Sbjct:   10 QDANADLPSEYWQIGKIIKYLKGGNQTSTIISLCALKDMPLKTEICQLAVRDVGGIEVLINLLETDEVRCKLGSLKILKEITKNPQIRKSVTDIGGLQPLVNLLRSLNRDLKCLCAEVIANVANCHRARRTVRQYGGIKYLVALLDCP--------SLNSVPMTSEVERD---IEVARCGALALWSCSKSRKNKLAMKRAGVISLLVRLLKSPHENMLIPVVGTLQECASEESYRIAIRTEGMISDLVKNLKRDNDELQMHCASTIFKCAEEPETRDLVRTYNGLEPLVALLSKQSNKELLAAVTGAIWKCAISKENVKQFQRLGTIEQLVGLLNEQP-----------------------EEVLVNVVGALSEMAKDPSNRSTIRKAGGIPSLVSLLTRTNQELLTNTTKAVGKCAEEADSMSIIENLDGVRLLWSLLKNPNPKVQSYAAWALCPCIQNAKDAGELVRSFVGGLELIVSLLNSKDLEVLAAVCAAVSKIAEDEENLAVITDHGVVPLLSRLTHTKDDRLRCPLTDAVAKCCTWGTNRIDFGRAGAVIPIVRYLKSSDPNVHRSTAKALFQLSRDPNNCVSMHQVNVVKYLLQMVGSSDPELQTASAGCISNIRRLALANEKVHLTKLHEKI 617          
BLAST of Armadillo repeat-containing protein 4 vs. TrEMBL
Match: A0A4S2M1Z9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003307 PE=4 SV=1)

HSP 1 Score: 491.115 bits (1263), Expect = 4.663e-152
Identity = 272/687 (39.59%), Postives = 427/687 (62.15%), Query Frame = 1
Query:  496 YSDVVTRMKNIHKRLNKHHSSQQTYXXXXXXXXXXXXXXKHLDFLESIIYQKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQSMMK 2556
            Y+DV+T  +   + L KH S+   +ED+ +   SE E  +  D  E     +S V +   YWQ+ K+++Y++ GN  +T++ LC + +  L +  C  A+ D  G+ +L+NLL   ++RC++GSLKILRE+       R +  +GG+QPL++ L+  N DL+CL+AE +A +A F RAR  +R++ GI  LV LLD          S+++    + ++RD     V +  A ALW  SKS++N++ M++AGVI LLA+LL+  ++N+LIPV+GTLQ+CASE  YR++IRTEGM+  L+K+L   N  L+   A TIFKCA + +TR LVR  GG++ LI+ +  + +++LL A TGAIWKC +   N V+         L+ +L+E P+    YL  + S S ++  + + EK+++NV GAL E++K       I+  +     +SLL   +++LL NT   +++CA  P+ M  I  LDGV +L+++ K     V + A  A+  C  N +++  +++S VG LEL V+ L S N +VL+A C+ +++I  D +N+A+++D GVV LLSRL  T +DKLR  L+EAIA C  +  NR  FGRA  ++P+V +L S+D +VH S A+ALF+LS+DPNN   M+ AGV   L+ M+GS + +LQ AAAG I N+R++ + +EK  + +
Sbjct:  545 YTDVITLERLKGQSLQKHVSA--GHEDSPNDVSSESETEEDDDVPEH--QGESHVDLPSEYWQIGKIVKYLKGGNQTSTIISLCALQDMPLNTEVCQLAVRDVGGLDVLINLLETEEVRCKLGSLKILREITKNPKIRRAIADVGGLQPLVNLLRSPNRDLKCLSAEVIANVANFHRARRTVRQYGGIKRLVALLDCP--------SLNAVPMTTDVERD---IEVARCGALALWSCSKSRKNKLAMKKAGVISLLARLLKSPHENMLIPVVGTLQECASEPTYRVAIRTEGMVEDLVKNLKRPNPELQMHCASTIFKCAEEPETRDLVRLYGGLEPLIVLLAKQDNKELLAAATGAIWKCAISKENVVQFQKLGVIEKLVGLLNEQPEEMSTYLYVE-SVSPRIQLVLRTEKVLVNVVGALGEMAKDANNIVTIRRTHGIPPLVSLLTRTNQDLLINTTRAIEKCAGEPESMSIIESLDGVRLLWSLLKNPNPEVQSGAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLRSTNMNVLAAVCAAVSKIAVDEENLAVITDHGVVALLSRLTCTKDDKLRCPLTEAIARCCTWGTNRVDFGRAGAVSPLVGYLNSTDPNVHRSTAKALFQLSRDPNNCVAMHDAGVVKPLLQMVGSPDMELQTAAAGCISNIRRLSLANEKAQLTR 1215          
BLAST of Armadillo repeat-containing protein 4 vs. TrEMBL
Match: G7Y940 (Armadillo repeat-containing protein 4 OS=Clonorchis sinensis OX=79923 GN=CLF_103110 PE=4 SV=1)

HSP 1 Score: 479.174 bits (1232), Expect = 1.051e-151
Identity = 256/647 (39.57%), Postives = 398/647 (61.51%), Query Frame = 1
Query:  649 KSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQSMMKKMEKIHKKNAR 2589
            +S V +   YWQ+ K+++Y++ GN  +T++ LC +++  L +  C  A+ D  G+ +L+NLL   ++RC++GSLKILRE+       R +  +GG+QPL++ L+  N DL+CL+AE +A +A F RAR  +R++ GI  LV LLD          S+++    + ++RD     V +  A ALW  SKS++N++ M++AGVI LLA+LL+  ++N+LIPV+GTLQ+CASE  YR++IRTEGM+  L+K+L   N  L+   A TIFKCA + +TR LVR  GG++ LI+ +  + +++LL A TGAIWKC +   N V+         L+ +L+E P                       E++++NV GAL E++K       I+  +     +SLL   +++LL NT   +++CA  P+ M  I  LDGV +L+++ K     V + A  A+  C  N +++  +++S VG LEL V+ L S N DVL+A C+ +++I  D +N+A+++D GVV LLSRL  T +DKLR  L+EAIA C  +  NR  FGRA  ++P+V +L S+D +VH S A+ALF+LS+DPNN   M+ AGV   L+ M+GS + +LQ AAAG I N+R++ + +EK  + +   +   K AR
Sbjct:  214 ESHVDLPSEYWQIGKIVKYLKGGNQTSTIISLCALHDMPLNTEVCQLAVRDVGGLDVLINLLETEEVRCKLGSLKILREITKNPKIRRAIADVGGLQPLVNLLRSPNRDLKCLSAEVIANVANFHRARRTVRQYGGIKRLVALLDCS--------SLNTIPMTTDVERD---IEVARCGALALWSCSKSRKNKLAMKKAGVISLLARLLKSPHENMLIPVVGTLQECASEPTYRVAIRTEGMIEDLVKNLKRPNPELQMHCASTIFKCAEEPETRDLVRLYGGLEPLIVLLTKQDNKELLAAATGAIWKCAISKENVVQFQKLGVIEKLVGLLNEQP-----------------------EEVLVNVVGALGEMAKDANNIVTIRKTHGIPPLVSLLTRTNQDLLINTTRAIEKCAGEPESMSIIESLDGVRLLWSLLKNPNPEVQSGAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLRSNNMDVLAAVCAAVSKIAVDEENLAVITDHGVVALLSRLTCTKDDKLRCPLTEAIARCCTWGTNRVDFGRAGAVSPLVGYLNSTDPNVHRSTAKALFQLSRDPNNCVTMHDAGVVKPLLQMVGSPDMELQTAAAGCISNIRRLSLANEKAQLTRMHAQKQDKKAR 826          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Cavefish
Match: armc4 (armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB-GENE-100316-7])

HSP 1 Score: 427.172 bits (1097), Expect = 1.253e-134
Identity = 236/623 (37.88%), Postives = 373/623 (59.87%), Query Frame = 1
Query:  676 YWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLD-VDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            YW++ K+++Y+++GN  AT++ LC + +  L    C  A+ D  G+ +L+NLL  ++++C+IGSLKIL+E++      + +  L G+Q ++  L   + +L+CLAAET+A +A F+RAR  +R++ GI  LV LL+ V DS      ++S+     V         V +  A ALW  SKS RN+  +R+AG IPLLA+LL+   +N+LIPV+GTLQ+CASE  YRI+I+TEGM+  L+K+LN  N  L+   A  IFKCA D  TR LVR   G+  L+  +    +++LL A TGAIWKC +   N  +        +LL +L   P                       E++++NV GAL E ++    R  I       + +SLL+  ++ LL N    +  CA  PD M  I+ LDGV +L+++ ++    V A+A  A+  C  N +++  +++S +G L+L V+ L+S N++VL++ C++I+ I KD +N+AI+++ GV+ +L+ L  T NDKLRR L+EAI+ C  + +N   FG    + P+V +LRS D  VH + A AL++LS+DPNN   M+++GV   LI M+GS ++ LQ AAAG + N+R + + ++K
Sbjct:  364 YWEIQKLVKYLKVGNQTATVIALCCIRDFNLAQETCQLAIRDGGGLEVLINLLDTDEVKCKIGSLKILKEISCSSQIRQAIADLRGLQTMVSILDSPDKELKCLAAETIANVAKFRRARRTVRQYGGIKRLVELLNCVPDSA-----TLSAEQEKDV--------EVARCGALALWSCSKSTRNKEAIRKAGGIPLLARLLKSPQKNMLIPVVGTLQECASESSYRIAIQTEGMIKDLVKNLNCDNQELQMHCASAIFKCAEDKRTRDLVRQYKGLQPLVSLLSQTDNKQLLAAATGAIWKCSISMENVAKFEEFKTLEILLSLLTAQP-----------------------EEVLVNVVGALGECAQRSANRIAIGKSGGIPRLVSLLRETNQALLVNVTRAVGACATEPDNMVIIDHLDGVRLLWSLLRKPDPDVQASAAWAICPCIENVKDAGEMVRSFMGGLKLIVDLLKSTNKEVLASVCAVISRIAKDKENLAIITEHGVMPMLANLTNTVNDKLRRHLAEAISHCCMWGNNHVAFGEERAVAPLVRYLRSKDPSVHQATALALYQLSRDPNNCITMHESGVVQPLIVMMGSTDEVLQEAAAGCVRNIRLLALANDK 950          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Cavefish
Match: armc3 (armadillo repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE-110614-1])

HSP 1 Score: 51.6026 bits (122), Expect = 3.881e-6
Identity = 44/159 (27.67%), Postives = 79/159 (49.69%), Query Frame = 1
Query: 1987 AAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQ-DPNNSHEMNQAGVSHLLINMI 2460
            A AL  + +C  +TE S  LI+   G  +L    +     +V +     IA + + S+   +L +  V + L  L+ T+N  +   + +A+AV S  + + + F   N I PIV  L S +  V  +AA+AL  LS  +P N+  +++A    L++ ++
Sbjct:  188 ADALRVIFNCLEDTE-SVKLIQGNGGLEKLLQFVITPTTPEVQTNAVKAIARVAESSETRKLLHEQNVEKALIDLLATENKSVHTAVCQAVAVLSKNQSSMDTFRLLNGIKPIVQLLNSQENGVKEAAAQALSSLSSGNPLNAQAISEAEGEKLMVQIL 345          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008159.1 (pep scaffold:Pmarinus_7.0:GL482338:1463:16382:1 gene:ENSPMAG00000007377.1 transcript:ENSPMAT00000008159.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 445.277 bits (1144), Expect = 3.361e-146
Identity = 242/632 (38.29%), Postives = 379/632 (59.97%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            Q++ + +   YWQ+ K+++YI+ GN  AT++ LC M +  L    C  AM+D  G+ +L+NLL  +D++C+IGSLKIL+E++      +++  +GG+Q +++ L     +L+CLAAET+A +A F+RAR  +R+ +GI  LV L+D         + + S N     ++D     V +  A ALW  SKS++N+  +R+AG IPLLA+LL+  ++N+LIPV+GTLQ+CASE  YR++I+TE M+  L+K+LNS N  L+   A  IFKCA D +TR LVR  GG+  L + +    +++LL A+TGAIWKC +   N   +        L+ +L   P                       E+++INV GAL E  +    R +I+        + LL   ++ LL N    +  CA  P+ M  I+ LDGV +L+++ K S + V A+A  A+  C  N +++  +++S VG LEL VN L+S + +VL++ C+ I++I KD +N+A+++D GVV LL+ L  T +DKLR+ L+EAIA C  +  NR  FG A  + P+V +L+S D  VH + A+AL++LS  P N   M+  GV   L+ M+GS +  LQ+AAAG I N+R++ + +EK
Sbjct:   22 QEASMDLPSEYWQIQKLIKYIKSGNPTATVIALCCMRDFNLAQETCQLAMKDVGGLEVLINLLDTDDIKCKIGSLKILKEISHNSQIRQSIVDIGGLQTMVNILDSSEKELKCLAAETIANVAKFRRARRTVRKHNGIKKLVGLMDC--------VPMRSANLSPAQEKD---IEVARCGALALWSCSKSRKNKQAIRKAGGIPLLARLLKSPHENMLIPVVGTLQECASEASYRLAIQTEKMIEDLVKNLNSDNQELQMHCASAIFKCAEDKETRDLVRQYGGLHPLDILLGKSENKELLAAVTGAIWKCSISQENVAILQELRTIETLVSLLSNQP-----------------------EEVLINVVGALGECCQEPANRAIIRKTGGIHPLVQLLTGTNQPLLINVTRAVGACAMDPENMGIIDHLDGVRLLWSLLKNSNSQVQASAAWAICPCIENVKDAGEMVRSFVGGLELIVNLLKSDDNEVLASVCAAISKIAKDEENLAVITDHGVVPLLANLTSTTDDKLRKNLAEAIACCCTWGSNRAAFGDAQAVAPLVRYLKSKDALVHRATAQALYQLSLAPENCITMHSNGVVKPLVAMVGSTDTFLQVAAAGCISNIRQLALANEK 619          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Sea Lamprey
Match: CTNNB1 (catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514])

HSP 1 Score: 49.6766 bits (117), Expect = 3.087e-6
Identity = 40/151 (26.49%), Postives = 69/151 (45.70%), Query Frame = 1
Query: 1009 LAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVD 1461
            LA+     S +R    I  LV LL V      ++  +++  +P  +    M+  + +    AL  +++   NR  +R    +PL  +LL  N +NI     G L + A E     +I TEG    L + L+S+N  + T +A  +F+ + D
Sbjct:  515 LALLPANHSPLRDHGAIPRLVQLL-VRAHQDTQRQGVAANGQPQYVDGIRME-EIVEGCTGALHILARDAHNRSVIRGLNTVPLFVQLLYSNIENIQRVAAGVLCELAQEKEAAETIETEGATAPLTELLHSRNEGVATYAAAVLFRMSED 663          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Sea Lamprey
Match: CTNNB1 (catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514])

HSP 1 Score: 48.521 bits (114), Expect = 6.570e-6
Identity = 69/306 (22.55%), Postives = 134/306 (43.79%), Query Frame = 1
Query: 1105 KKLSISSTNRPSVIQRDTMQF----------SVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYY-RISIRTEGMMPILIKHL-NSQNLWLRTQSALTIFKCAV----DAD-TRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKA-------EKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPIL 1950
            K LS+ S+N+P++++   MQ            + QN+   L  +S +   +  M   G++ +L + L  ++ N++    G L       Y  ++     G + +L+K L  + +    T+ A+   +       +A+  +  VR   G+ V++  + P     L+ A  G I    LCP N   +  +    VL +++  L ++ Q   R      H +  ++++       E+I+   TGAL  +++    R++I   N    F+ LL  ++EN+     GVL E A+  +  + I R    P+L
Sbjct:  344 KVLSVCSSNKPAIVEAGGMQALALHLSHPSQRLVQNSLWTLRNLSDAATKQDNMD--GLLQMLVQALDSSDLNVVTCAAGILSNLTCNNYKNKLMACQMGGIEVLVKTLMQAGDREDITEPAVCALRHLTSRHPEAEMAQNAVRLHYGLPVVVKLLQPPSHWPLIKADVGLIRNLALCPANHAPLREQG---VLERLVQLLVRAHQDTQR------HTMGTMQQSQPDGIRMEEIVEGCTGALQILARDAANREVIYSLNVIPVFVQLLYSNNENVQRVATGVLCEMAQDKEAADAIEREGATPVL 638          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Yeast
Match: VAC8 (Phosphorylated and palmitoylated vacuolar membrane protein; interacts with Atg13p, required for the cytoplasm-to-vacuole targeting (Cvt) pathway; interacts with Nvj1p to form nucleus-vacuole junctions [Source:SGD;Acc:S000000739])

HSP 1 Score: 48.9062 bits (115), Expect = 2.771e-6
Identity = 46/193 (23.83%), Postives = 91/193 (47.15%), Query Frame = 1
Query: 1942 PILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAG--VSHLLINMIGSENKDLQIAAAGAIGNL 2514
            PIL  +  +     VAA   AL +   N EN   +++  +G LE  +NQ+   N +V       I  +    DN   ++  G +  L++L K+ + +++R  + A+   +  ++NR++   A  +  +V+ L S+D  V      AL  ++ D  N  ++ Q    +   L++++ S +  ++  A  A+ NL
Sbjct:   89 PILILLQSQDPQIQVAAC-AALGNLAVNNENKLLIVE--MGGLEPLINQMMGDNVEVQCNAVGCITNLATRDDNKHKIATSGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNL 278          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Nematostella
Match: EDO43886 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXR2])

HSP 1 Score: 451.055 bits (1159), Expect = 1.499e-145
Identity = 241/632 (38.13%), Postives = 382/632 (60.44%), Query Frame = 1
Query:  646 QKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            Q+S+  +   YWQ+ K+++Y++ GN  AT++ LC M +  L    C  A+ D  G+ +L+NLL   +++C+IGSLKIL+E++      + +  LGG+Q +++ ++  N +L+CLAAET+A +A F+RAR  +R++ GI  LV LLD         LS +S           +  +V ++ A ALW  SKS +N+  +R+AG IPLLA+LL+  N+ +LIPV+GTLQ+CASE  YR++IRTEGM+  L+ +L S+N  L+   A  IFKCA D DTR LVR  GG+D L+  +    +++LL A TGAIWKC +   N            L+ +L + P                       E+++INV GAL E +++   R  I+        ++LL   ++ LL N    +  CA  PD M  I+RLDGV +L+++ K +   V A+A  A+  C  N +++  +++S VG LEL V+ L+S +++VL++ C+ IA I KD +N+A+++D GVV +L++L  T  D+LR+ L+E+IA C  + +NR  FG+   + P+V +L+S    VH + ARAL++LS+DP+N   M+ +GV   L+ M+GS++  LQ A+AG + N+RK+ + +EK
Sbjct:  230 QESNADLPSEYWQIQKLVKYLKGGNQTATIIALCAMRDFNLTQETCQLAIRDVGGLEVLINLLETEEIKCKIGSLKILKEISRNTLIRKAIADLGGLQTMVNIVQSMNKELKCLAAETIAHVAKFRRARRTVRQYGGIRKLVSLLDCG------LLSGASD----------IDVAVARSGALALWSCSKSTKNKKAIRKAGGIPLLARLLKSKNEAMLIPVVGTLQECASEQTYRLAIRTEGMVEDLVNNLKSENQELQRHCASAIFKCAEDEDTRNLVRQYGGLDPLVSLLTNIENKELLAAATGAIWKCSISVENVTRFQELKAIEQLVALLTDQP-----------------------EEVLINVVGALGECAQMLANRTAIRKAGGIPSLVNLLTSTNQALLVNVTKAVGACATEPDNMAIIDRLDGVRLLWSLLKSTNPRVQASAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSNDQEVLASVCAAIANIAKDEENLAVITDHGVVPMLAKLASTKEDRLRQYLAESIARCCMWGNNRVAFGKEGAVPPLVGYLKSPSQDVHRATARALYQLSRDPDNCISMHDSGVVQPLMKMVGSQDDVLQEASAGCLKNIRKLALANEK 822          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Nematostella
Match: EDO49017 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHP9])

HSP 1 Score: 327.791 bits (839), Expect = 4.201e-102
Identity = 192/565 (33.98%), Postives = 320/565 (56.64%), Query Frame = 1
Query:  850 RCRIGSLKILRELASIIFYCRNVTF-LGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK 2541
            +C+IGSLKIL+ L +   Y RN    LGG+Q L+D +   + ++Q LAA TLA +A+  RAR+ +RR  GI  +V LL+  D    K+ S    N         +   V ++AA ALW  S S RNR  + +AG +PLLA+L+R   +++LIPV+G +Q+CA E  YR + + E M+  ++++L ++N  L+   A  IFKCA D DTR +V   GG++ L+  +    ++KLL A+TGAIWKC +   N       +    LL+ L +                H+    E+ E++ +++ GAL E++K+++GR  I      +  + L    +E L+      +  C++  +C  + NR DG+ +L+++ K +   V+A+A   +     +T  +    +S VG LEL VN LES + +VL++ C+ I  +  + +N+ +++D+GVV+ L++L   ++  LRR L++AIA C  +  N   F R   +  +V +L + D  +  SA RAL +L++ P +  +M+ +GV   L+ M+GSE++ LQ AAAG + N+RK+ + +EK
Sbjct:    1 KCKIGSLKILQPLTTSSKYNRNAIINLGGVQLLVDLVTTGSQEVQGLAAATLANIAMASRARNILRRCGGIRKMVNLLNYQDKSWRKQKSQEQKN---------LDLEVARSAALALWSCSTSMRNRTSIFKAGSVPLLARLIRLEREDVLIPVVGLVQECAIETRYRTAFKNENMIEPIVQNLKTENQELQIYCANAIFKCAEDEDTRKVVHKYGGLETLVKLLSSHQNKKLLAAVTGAIWKCSVSVENTKRFLELDIVEALLRFLQD---------------EHE----EQPEQVQVHIVGALSELAKVQKGRLEILACKGCKTLVDLSTDPNEELVEQVGRAIAACSQDVECRGQFNRRDGLRLLWSLLKSNNPKVIASASWGIHGLMEDTPEAWENARSFVGGLELIVNMLESDDIEVLTSVCAAIGNVANEGENIGVITDYGVVKHLAKLTVLNDIALRRHLAKAIARCCKWGHNARDFTREGAVEAMVEYLSTDDTILKRSAVRALHQLARYPESCIKMHSSGVVKPLMEMVGSEDEALQEAAAGCLLNIRKLAMANEK 537          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Nematostella
Match: EDO45816 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRS5])

HSP 1 Score: 154.066 bits (388), Expect = 2.749e-38
Identity = 130/493 (26.37%), Postives = 221/493 (44.83%), Query Frame = 1
Query:  640 IYQKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHL--NSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYA-ITGAIWKCCLCPINAVEVNNKNGTNVLLKILD------ELPKS-----------FQIYLRPQ----------ISASHKLNRL-----EKAEKIMINVTGALYEISKL---EEGRKLIKLHNSTEKFISLLQM---DDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAA 1995
            I +K   +++  YW++ ++++Y+R GN   T++ LC + +  ++   C  ++ D     +LLNLL+ ++  C IGSL++LR L+   F    +  LGG++ L+  L+  +F++Q LAA TLA L  F +A S +R+  GI  LV LL   D+ + K  +   TN       D    ++ +NA  ALW  SKS +N   +R AG +P+LA LL     ++ +P +G +Q+C+++  +R  +R  GM+  +++ L   S+++     SA+   +     DT++       + V       + D   L      A+W C     N   +       +L  +L       +LP             F+  LR            I  S  +  L     +K +      T A   I K    EE R+L+  H   +  + +L      +  LL    G L +CA+  D M  + RL  V  L    K   +  V+ A
Sbjct:  459 ITRKIRPELTTEYWEIHRLVKYLRAGNPTVTIIALCALQDFSIEQEGCQLSLLDLRAAPVLLNLLNTDNYSCMIGSLQLLRRLSCSKFVNLELYRLGGVEQLVSCLESSSFEVQSLAAATLANLVSFGKAYSAVRKGRGIRKLVELLKPGDTKSVKVHTRRYTN-------DHDHSTLRRNACNALWSCSKSSKNITAIRTAGTVPILASLLTSGKHDLQLPAVGIIQECSNDTVFRGELRKHGMIQEIVQLLIDGSEDMKALCASAIDKVELLKPGDTKS-------VKVHTRRYTNDHDHSTLRRNACNALWSCSKSSKNITAIRTAGTVPILASLLTSGKHDLQLPAVGIIQECSNDTIFRGELRKHGMIQEIVQLLIDGSEDMKALCASAIDKVKAQPSPSTPACLAIDKCAEDEETRELVLKHGGLDPMVDVLATRPCKNAELLAAVAGALWKCAEHGDSMRRLERLGTVNHLITQVKLEHSLPVSIA 937          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Nematostella
Match: EDO38462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCU6])

HSP 1 Score: 55.0694 bits (131), Expect = 1.175e-7
Identity = 42/180 (23.33%), Postives = 79/180 (43.89%), Query Frame = 1
Query: 1027 ARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTN------------------RPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLI 1512
            +R  I + +GI  ++ LL  ++    +  S++  N                   P ++     +  V  NAA  L  ++  +  R  +++ GV+P L + L+ N+  +   V   +     +   R   RTEG +P L++ L S N  +R  ++  + +C  D+ T   +  LGG+DVL 
Sbjct:  349 SRDMIGKLEGIPPIIALLSNENPEVRESASLAVANITTANPTNCNEMVEKGGIEPIIMMLMDTKPLVQANAAVCLTNLAADESWRSEVQQHGVVPALVQALKSNSTIVQSKVAMAVAAYVCDAESRSEFRTEGGLPRLVELLQSNNDEVRRSASWAVLQCGNDSATAAEICKLGGLDVLF 528          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Medaka
Match: armc4 (armadillo repeat containing 4 [Source:NCBI gene;Acc:101161014])

HSP 1 Score: 333.954 bits (855), Expect = 2.704e-99
Identity = 220/633 (34.76%), Postives = 356/633 (56.24%), Query Frame = 1
Query:  649 KSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQS 2547
            +SD  +S  + Q+ K+++Y++ G+   TLL LC M +  L    C  A+ D  G+  LLNLL  N+ +C+IG+LKIL  ++  +   R++  + G++ L++NL      ++ LAAET+A +A F RAR  +R+  GI  L+ LLD    +  +K S  S N               +  A ALW  S+S +N+  +  AG IPLL  LL  + +++LIPV+GTLQ+CASE   RI+I+++ ++  L+K+L S    L+ Q ++ +FKCA D +TR LVR   G+ +L+  ++   +++LL A TGAIWKC +    ++E       NVL+   D++ +S    L  Q             E+++INV GAL E  ++   + +I+  +  +  I LL   ++ LL N    +  CA   + M+ I+ LDG+ +L+++ +     V A+A  A+  C  N++++   + S  G   +  N L S N +VL++ C++IA++ K  + +A L+D G+V LL++L  T +D+LR  LS+AI  C  + +N   FG A  + P+V +++S DI V  SA  ALF+LS DPNN+  M   G    LI MIGS  +++Q AAA  + N+R   +E  K S
Sbjct:  422 ESDFYLSSEFLQIKKLVKYLKKGDQKVTLLMLCCMLDLDLTQDSCNLAIRDEGGLQFLLNLLDTNEDKCKIGALKILIRMSRCVPIQRSMEDMLGVRSLVNNLDSEVTKVKALAAETIANVANFPRARRTVRQSGGIEKLIKLLDC--FLKSQKKSDHSEN-----------MEAARCGALALWSCSRSTKNKKAICSAGGIPLLGCLLTSSLESMLIPVVGTLQECASEESSRITIQSKDIIKNLVKNLRSNCTDLQIQCSMALFKCAEDTETRDLVRKYKGLKLLVELLNNTNNKELLAAATGAIWKCSI----SIE-------NVLIFQNDKVLESLAGLLTAQ------------PEEVLINVAGALTEFLQVPANKAVIRKCDGIKPMIQLLLSTNQALLVNVTKAVGACATDRENMKIIDELDGISLLWSLLQNPNPEVQASAAWAICPCIGNSKDAMRTVLSFQGFGRIP-NLLMSTNNEVLASICAVIAKLAKYKNILATLTDLGIVSLLTKLTNTKDDRLRHHLSDAICHCCQFANNTASFGEAGAVEPLVRYMKSEDILVRQSATMALFQLSWDPNNNLTMLSRGAVKRLIPMIGSTLEEVQEAAACCVRNIRMTAMECRKAS 1017          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Medaka
Match: armc4 (armadillo repeat containing 4 [Source:NCBI gene;Acc:101161014])

HSP 1 Score: 302.368 bits (773), Expect = 4.954e-88
Identity = 195/564 (34.57%), Postives = 316/564 (56.03%), Query Frame = 1
Query:  856 RIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQS 2547
            +IG+LKIL  ++  +   R++  + G++ L++NL      ++ LAAET+A +A F RAR  +R+  GI  L+ LLD    +  +K S  S N               +  A ALW  S+S +N+  +  AG IPLL  LL  + +++LIPV+GTLQ+CASE   RI+I+++ ++  L+K+L S    L+ Q ++ +FKCA D +TR LVR   G+ +L+  ++   +++LL A TGAIWKC +    ++E       NVL+   D++ +S    L  Q             E+++INV GAL E  ++   + +I+  +  +  I LL   ++ LL N    +  CA   + M+ I+ LDG+ +L+++ +     V A+A  A+  C  N++++   + S  G   +  N L S N +VL++ C++IA++ K  + +A L+D G+V LL++L  T +D+LR  LS+AI  C  + +N   FG A  + P+V +++S DI V  SA  ALF+LS DPNN+  M   G    LI MIGS  +++Q AAA  + N+R   +E  K S
Sbjct:  442 KIGALKILIRMSRCVPIQRSMEDMLGVRSLVNNLDSEVTKVKALAAETIANVANFPRARRTVRQSGGIEKLIKLLDC--FLKSQKKSDHSEN-----------MEAARCGALALWSCSRSTKNKKAICSAGGIPLLGCLLTSSLESMLIPVVGTLQECASEESSRITIQSKDIIKNLVKNLRSNCTDLQIQCSMALFKCAEDTETRDLVRKYKGLKLLVELLNNTNNKELLAAATGAIWKCSI----SIE-------NVLIFQNDKVLESLAGLLTAQ------------PEEVLINVAGALTEFLQVPANKAVIRKCDGIKPMIQLLLSTNQALLVNVTKAVGACATDRENMKIIDELDGISLLWSLLQNPNPEVQASAAWAICPCIGNSKDAMRTVLSFQGFGRIP-NLLMSTNNEVLASICAVIAKLAKYKNILATLTDLGIVSLLTKLTNTKDDRLRHHLSDAICHCCQFANNTASFGEAGAVEPLVRYMKSEDILVRQSATMALFQLSWDPNNNLTMLSRGAVKRLIPMIGSTLEEVQEAAACCVRNIRMTAMECRKAS 968          
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Medaka
Match: armc3 (armadillo repeat containing 3 [Source:NCBI gene;Acc:101162265])

HSP 1 Score: 51.9878 bits (123), Expect = 2.695e-6
Identity = 107/522 (20.50%), Postives = 210/522 (40.23%), Query Frame = 1
Query:  925 LGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQR--DTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKC-AVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKN-GTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKS-CFANTENSASLIKSLVGSLELTVNQL-ESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSEN 2472
            LG ++PLI  L H +  ++  A   L  +AV    ++ +++ + I                         PS++++     +  V + A  +L  +SK    +  M  +  +P L +LL   + ++    +  +     +   R++    G +P L++ L S +  +    AL   +C   D D+R   R   G D L M V    D   L+A        CL     V++ +K+ G   LL  L          + P             A  +       L ++++  E  +L+    + +    LL +DD  +  +    +   +  P   +    L  VP L  + +R +  + AAA  AL      +  N+ S+  +  G  E+ V QL E+  + V S+  +L     +++   +I+S  G ++ L+  +K+ + ++  + +  +A  +  ++ R +  RA  +  +V  L S    V  +A  A+   + D  ++ EM + G   +L  MI  E+
Sbjct:   66 LGALEPLIRLLSHSSRAVRRGAVVALGSMAVHGEVKNALKKLNAI-------------------------PSILEKLSPEEETVVHEFATLSLTHLSKDFSCKAQMFDSNGLPPLIQLLSSPDPDVKKNSVEVIYNLVQDYKSRLAFHKLGGIPSLLELLKS-DFPVIQHLALGTLQCVTTDPDSRRTFREEQGFDRL-MDVLSNPDFSDLHAAALQTLSNCLSDSQTVKLVHKSRGLARLLHFL----------MAP------------NAPGVQSAAVDCLTKVAQSAESLRLLHEEGTEKVLAELLSVDDIGVKTSACQAVAAMSFHPASKDIFRDLGVVPALTQLLRRQSLMLRAAATRALYGLSHGDQLNALSIYNT--GGHEILVQQLHEACPKTVASSAATLYNMAAQEAIRSSIVS-HGAMQALAEALKSKDTEVLLSSTLCVAELACEEEARAELRRAGGLEALVRLLHSPHEEVWKNACFAVKVCASDKPSAVEMCRLGALEILQEMICPES 535          
BLAST of Armadillo repeat-containing protein 4 vs. Planmine SMEST
Match: SMESG000044790.1 (SMESG000044790.1)

HSP 1 Score: 1596.64 bits (4133), Expect = 0.000e+0
Identity = 820/821 (99.88%), Postives = 821/821 (100.00%), Query Frame = 1
Query:  130 MPTYQSNVIVXXXXXXXXXXXXXXXXXXXRRQIMFNKIDDFIDEKLNRNYVKFSSDSANQSNQIIANSPRQINLSSSSKFQKFNTSLYSNTEPNKSLQCRENTFKSYEKIMKKVKRKYNAGYYSDVVTRMKNIHKRLNKHHSSQQTYXXXXXXXXXXXXXXKHLDFLESIIYQKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQSMMKKMEKIHKKNARS 2592
            MPTYQSNVIVDDEEYEEEEEEDENK+LEERRQIMFNKIDDFIDEKLNRNYVKFSSDSANQSNQIIANSPRQINLSSSSKFQKFNTSLYSNTEPNKSLQCRENTFKSYEKIMKKVKRKYNAGYYSDVVTRMKNIHKRLNKHHSSQQTYEDADSSSESEDEEAKHLDFLESIIYQKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQSMMKKMEKIHKKNARS
Sbjct:    1 MPTYQSNVIVDDEEYEEEEEEDENKDLEERRQIMFNKIDDFIDEKLNRNYVKFSSDSANQSNQIIANSPRQINLSSSSKFQKFNTSLYSNTEPNKSLQCRENTFKSYEKIMKKVKRKYNAGYYSDVVTRMKNIHKRLNKHHSSQQTYEDADSSSESEDEEAKHLDFLESIIYQKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQSMMKKMEKIHKKNARS 821          
BLAST of Armadillo repeat-containing protein 4 vs. Planmine SMEST
Match: SMESG000023906.1 (SMESG000023906.1)

HSP 1 Score: 1590.09 bits (4116), Expect = 0.000e+0
Identity = 818/821 (99.63%), Postives = 820/821 (99.88%), Query Frame = 1
Query:  130 MPTYQSNVIVXXXXXXXXXXXXXXXXXXXRRQIMFNKIDDFIDEKLNRNYVKFSSDSANQSNQIIANSPRQINLSSSSKFQKFNTSLYSNTEPNKSLQCRENTFKSYEKIMKKVKRKYNAGYYSDVVTRMKNIHKRLNKHHSSQQTYXXXXXXXXXXXXXXKHLDFLESIIYQKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQSMMKKMEKIHKKNARS 2592
            MPTYQSNVIVDDEEYEEEEEEDENKELEERRQIMFNKIDDFIDEKLNRNY+KFSSDSANQSNQIIANSPRQINLSSSSKFQKFNTSLYSNTEPNKSLQCRENTFKSYEKIMKKVKRKYNAGYYSDVVTRMKNIHKRLNKHHSSQQTYEDADSSSESEDEEAKHLDFLESIIYQKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKA DCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVL+ATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQSMMKKMEKIHKKNARS
Sbjct:    1 MPTYQSNVIVDDEEYEEEEEEDENKELEERRQIMFNKIDDFIDEKLNRNYIKFSSDSANQSNQIIANSPRQINLSSSSKFQKFNTSLYSNTEPNKSLQCRENTFKSYEKIMKKVKRKYNAGYYSDVVTRMKNIHKRLNKHHSSQQTYEDADSSSESEDEEAKHLDFLESIIYQKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAIDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLAATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEKQSMMKKMEKIHKKNARS 821          
BLAST of Armadillo repeat-containing protein 4 vs. Planmine SMEST
Match: SMESG000057827.1 (SMESG000057827.1)

HSP 1 Score: 476.478 bits (1225), Expect = 5.269e-152
Identity = 251/633 (39.65%), Postives = 402/633 (63.51%), Query Frame = 1
Query:  664 ISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK--QSMMK 2556
            +S  YWQ+ K+++Y++ GN  +T++ LC + +  L +  C  A+ D  G+ +L+NLL  +++RC+IGSLKIL+E++      R +  LGG+  +++ LK  N DL+CL+AET+A +A F+RAR  +R + GI  LV LLD  +         +S  +P+ I+RD     V +  A ALW  SKSK+N+  M++AG+I LL+KLL+ N+ N+LIP++GTLQ+CASE  YRI+IRTEGM+  L+K+L S N  L    A TIFKCA + + R LVR+ GG++ L+  +  + +++LL A+TGAIWKC +   N  +         L+ +L++ P+   +YL    S+S+K+  +++ EK+++NV GAL E++K    R +I+        ++LL   ++ LL NT   +  CA+ PD M  I++ DGV +L+++ K     V A A  A+  C  N +++  +++S VG LEL V+ L+S   +VL++ C+ I +I  D +N+A+++D GVV LL+RL  T +D LR  L+EAI+ C ++  NR  FG+   + P+V +L+SSD  VH S A+AL++LS+ P N   M++AGV  LL+ ++GS ++ LQ AAA  I N+R++ + +EK  Q ++K
Sbjct:  465 MSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTG----PANSQAQPADIERD---IEVARCVALALWSCSKSKKNKEAMKKAGIISLLSKLLKSNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVD-SSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPLLARLTTTTDDLLRCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAGVVKLLLGLVGSADEQLQEAAASCIANIRRLALANEKSQQKLLK 1089          
BLAST of Armadillo repeat-containing protein 4 vs. Planmine SMEST
Match: SMESG000057827.1 (SMESG000057827.1)

HSP 1 Score: 466.463 bits (1199), Expect = 7.013e-147
Identity = 257/708 (36.30%), Postives = 422/708 (59.60%), Query Frame = 1
Query:  439 FKSYEKIMKKVKRKYNAGYYSDVVTRMKNIHKRLNKHHSSQQTYXXXXXXXXXXXXXXKHLDFLESIIYQKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK--QSMMK 2556
             + Y +I + V+ ++N   Y+D++TR++   +   + H  ++     + +      E++  +       + SD  +S  YWQ+ K+++Y++ GN  +T++ LC + +  L +  C  A+ D  G+ +L+NLL  +++RC+IGSLKIL+E++      R +  LGG+  +++ LK  N DL+CL+AET+A +A F+RAR  +R + GI  LV LLD  +         +S  +P+ I+RD     V +  A ALW  SKSK+N+  M++AG+I LL+KLL+ N+ N+LIP++GTLQ+CASE  YRI+IRTEGM+  L+K+L S N  L    A TIFKCA + + R LVR+ GG++ L+  +  + +++LL A+TGAIWKC +   N  +         L+ +L++ P                       E++++NV GAL E++K    R +I+        ++LL   ++ LL NT   +  CA+ PD M  I++ DGV +L+++ K     V A A  A+  C  N +++  +++S VG LEL V+ L+S   +VL++ C+ I +I  D +N+A+++D GVV LL+RL  T +D LR  L+EAI+ C ++  NR  FG+   + P+V +L+SSD  VH S A+AL++LS+ P N   M++AGV  LL+ ++GS ++ LQ AAA  I N+R++ + +EK  Q ++K
Sbjct:  555 IRRYSEIQETVRERFNNDEYTDLITRLRFQDETRQRKHDKKKLDNRENENMSESSSESEEDEDAPDRRQETSD--MSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTG----PANSQAQPADIERD---IEVARCVALALWSCSKSKKNKEAMKKAGIISLLSKLLKSNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQP-----------------------EEVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPLLARLTTTTDDLLRCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAGVVKLLLGLVGSADEQLQEAAASCIANIRRLALANEKSQQKLLK 1230          
The following BLAST results are available for this feature:
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARMC43.529e-14037.91armadillo repeat containing 4 [Source:HGNC Symbol;... [more]
ARMC41.415e-13637.91armadillo repeat containing 4 [Source:HGNC Symbol;... [more]
ARMC41.415e-13637.91armadillo repeat containing 4 [Source:HGNC Symbol;... [more]
ARMC42.307e-12737.29armadillo repeat containing 4 [Source:HGNC Symbol;... [more]
ARMC43.954e-11637.54armadillo repeat containing 4 [Source:HGNC Symbol;... [more]
back to top
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gudu4.880e-11835.66gene:FBgn0031905 transcript:FBtr0079438[more]
back to top
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
armc43.535e-13939.23armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB... [more]
armc43.535e-13939.23armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB... [more]
CR847789.14.693e-13939.23armadillo repeat containing 4 [Source:NCBI gene;Ac... [more]
armc45.694e-2450.52armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gc4.581e-14238.92group-specific component (vitamin D binding protei... [more]
gc7.805e-14238.92group-specific component (vitamin D binding protei... [more]
gc1.725e-14138.92group-specific component (vitamin D binding protei... [more]
back to top
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Armc45.745e-14238.29armadillo repeat containing 4 [Source:MGI Symbol;A... [more]
Armc45.745e-14238.29armadillo repeat containing 4 [Source:MGI Symbol;A... [more]
Armc43.718e-1139.51armadillo repeat containing 4 [Source:MGI Symbol;A... [more]
back to top
BLAST of Armadillo repeat-containing protein 4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B2RY50|ARMC4_MOUSE4.019e-14138.29Armadillo repeat-containing protein 4 OS=Mus muscu... [more]
sp|Q5T2S8|ARMC4_HUMAN6.798e-13637.91Armadillo repeat-containing protein 4 OS=Homo sapi... [more]
sp|Q9VM21|GUDU_DROME4.892e-11735.66Armadillo repeat-containing protein gudu OS=Drosop... [more]
sp|Q2GW27|VAC8_CHAGB3.081e-927.98Vacuolar protein 8 OS=Chaetomium globosum (strain ... [more]
sp|Q2U5T5|VAC8_ASPOR1.367e-827.59Vacuolar protein 8 OS=Aspergillus oryzae (strain A... [more]
back to top
BLAST of Armadillo repeat-containing protein 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M2133.012e-15340.41Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A095AS048.480e-15339.88Armadillo repeat-containing protein 4 OS=Schistoso... [more]
A0A3Q0KTP02.561e-15239.72Putative armc4 OS=Schistosoma mansoni OX=6183 PE=4... [more]
A0A4S2M1Z94.663e-15239.59Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7Y9401.051e-15139.57Armadillo repeat-containing protein 4 OS=Clonorchi... [more]
back to top
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
armc41.253e-13437.88armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB... [more]
armc33.881e-627.67armadillo repeat containing 3 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000008159.13.361e-14638.29pep scaffold:Pmarinus_7.0:GL482338:1463:16382:1 ge... [more]
CTNNB13.087e-626.49catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514][more]
CTNNB16.570e-622.55catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514][more]
back to top
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VAC82.771e-623.83Phosphorylated and palmitoylated vacuolar membrane... [more]
back to top
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO438861.499e-14538.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490174.201e-10233.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458162.749e-3826.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384621.175e-723.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Armadillo repeat-containing protein 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
armc42.704e-9934.76armadillo repeat containing 4 [Source:NCBI gene;Ac... [more]
armc44.954e-8834.57armadillo repeat containing 4 [Source:NCBI gene;Ac... [more]
armc32.695e-620.50armadillo repeat containing 3 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Armadillo repeat-containing protein 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000044790.10.000e+099.88SMESG000044790.1[more]
SMESG000023906.10.000e+099.63SMESG000023906.1[more]
SMESG000057827.15.269e-15239.65SMESG000057827.1[more]
SMESG000057827.17.013e-14736.30SMESG000057827.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014492 ID=SMED30014492|Name=Armadillo repeat-containing protein 4|organism=Schmidtea mediterranea sexual|type=transcript|length=2697bp
GTCACTGCTATAAATTATGGAAATAAAATTCCAAAATATCATTTACATAT
AATCAATAACCAACTGATTGTTTAAACAATTATTTGAAATCATTTTCTAA
GCTTATTTAAATTTGAAACTTAAACAACTATGCCAACTTATCAGTCAAAT
GTAATAGTTGATGACGAGGAATATGAAGAAGAAGAGGAAGAAGACGAGAA
TAAAGAGCTAGAAGAAAGAAGACAAATAATGTTTAATAAAATTGATGATT
TCATTGACGAAAAATTAAATAGAAATTATGTAAAATTCAGTTCCGATTCT
GCCAATCAAAGTAACCAAATCATTGCCAACAGCCCTCGACAGATAAATCT
CAGTTCGAGCTCAAAATTTCAGAAGTTTAACACGTCTCTTTATTCTAACA
CTGAACCAAATAAAAGTCTACAGTGCCGTGAAAATACATTTAAATCCTAC
GAAAAAATTATGAAAAAAGTGAAAAGAAAATATAATGCTGGTTATTACAG
CGATGTAGTCACCAGAATGAAAAATATACATAAGCGACTTAATAAGCATC
ACAGTAGTCAACAGACATATGAAGACGCTGATAGCAGCTCAGAATCGGAA
GATGAAGAAGCAAAGCATCTTGATTTTTTAGAGTCAATTATTTATCAGAA
ATCCGACGTTCAAATAAGCCCTCTTTATTGGCAACTAACTAAGGTTTTGC
GTTATATAAGAATCGGAAACGTCCATGCAACGTTATTGTGTTTGTGTTAC
ATGAATAATAATAAGCTAAAGTCCCCAGAATGTATGAGAGCAATGGAAGA
TAGTGATGGAATTGCCTTATTGTTAAATCTCCTCAGTGCTAATGACATGC
GATGTAGAATTGGTTCTTTGAAAATCCTTCGAGAGTTGGCTAGCATTATA
TTTTATTGTAGAAATGTCACATTTCTTGGAGGCATACAACCTCTCATTGA
TAATCTCAAGCACCATAATTTTGATCTTCAGTGTTTAGCAGCAGAAACCT
TGGCTAAACTAGCAGTGTTTAAACGTGCTCGGTCTAACATTCGTAGATTT
GATGGAATAAGTCATTTAGTATATTTACTAGATGTTGATGATTCGATAGC
CGAAAAGAAACTTTCAATTTCTTCAACAAATCGACCTAGTGTTATTCAAA
GGGATACAATGCAATTTTCTGTCACACAAAATGCCGCTACCGCTTTGTGG
AAGGTTAGCAAATCTAAAAGAAATAGAGTTTGCATGAGAAGAGCTGGAGT
TATTCCATTGTTAGCTAAACTATTGAGGAAAAATAACCAAAATATTTTAA
TTCCAGTAATTGGCACTCTCCAGCAATGCGCCTCTGAATTGTATTATCGA
ATTTCTATAAGAACAGAAGGAATGATGCCAATTTTAATAAAACATCTCAA
TAGTCAAAATCTCTGGCTGAGAACTCAAAGTGCTCTGACTATTTTCAAAT
GCGCTGTGGACGCTGATACTCGGACTTTGGTAAGAAATTTAGGTGGAATT
GATGTTTTAATAATGCATGTCGATCCAGAAGGGGATCAAAAGTTGCTTTA
TGCCATTACTGGTGCTATTTGGAAGTGTTGTCTCTGTCCAATAAATGCGG
TAGAAGTTAATAATAAAAATGGAACAAATGTCTTATTAAAGATTCTTGAT
GAGTTGCCAAAATCCTTTCAAATTTATTTAAGACCACAAATATCAGCTTC
TCATAAACTGAACCGATTAGAAAAGGCAGAGAAAATTATGATAAACGTAA
CCGGTGCTTTGTACGAAATTTCTAAGCTCGAAGAAGGTCGAAAATTAATC
AAACTTCACAATTCTACAGAAAAGTTTATATCCCTTTTACAGATGGATGA
TGAAAATTTATTATTCAATACAATTGGAGTATTGAAAGAGTGTGCAAAAG
CCCCAGACTGCATGGAGGAGATTAACAGACTAGATGGAGTTCCGATTTTA
TTTGCTATAACAAAGCGTAGTGCAACATTTGTAGTGGCAGCTGCTTTAGA
AGCTTTGAAATCATGCTTTGCTAATACCGAAAATTCCGCAAGTCTTATTA
AATCTCTTGTTGGAAGTTTAGAACTAACTGTAAATCAGCTTGAATCAGTC
AATGAGGATGTTTTATCAGCTACTTGTTCGTTAATAGCTGAAATAGGAAA
AGATAGTGACAATGTGGCCATTCTATCTGACTTTGGAGTCGTGAGACTTT
TATCGCGATTAGTAAAGACAGATAATGATAAACTAAGACGAACATTATCA
GAAGCGATAGCTGTTTGTTCGGATTATAAAGACAACAGAGAACAATTCGG
AAGAGCTAATGTGATAACACCCATAGTAAACTTTCTACGTTCTAGTGATA
TTCATGTTCACGTCTCGGCGGCAAGAGCGTTGTTTAAGTTAAGTCAAGAT
CCCAATAATAGTCATGAAATGAATCAAGCTGGAGTATCACATCTCTTGAT
TAACATGATTGGATCGGAAAATAAGGATTTACAGATAGCTGCTGCTGGAG
CTATTGGAAATCTCCGGAAGATTGGTATTGAACACGAAAAACAAAGTATG
ATGAAAAAGATGGAAAAGATTCACAAAAAGAATGCAAGAAGTTGACATTA
TCAATTATTAATCAAATTTCGATTGACGTGATTTATTTTATACGTAAATT
ATTTGTAAATTTGATTAATAACAATATATGCAATTGGAAAACTTAAA
back to top

protein sequence of SMED30014492-orf-1

>SMED30014492-orf-1 ID=SMED30014492-orf-1|Name=SMED30014492-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=822bp
MPTYQSNVIVDDEEYEEEEEEDENKELEERRQIMFNKIDDFIDEKLNRNY
VKFSSDSANQSNQIIANSPRQINLSSSSKFQKFNTSLYSNTEPNKSLQCR
ENTFKSYEKIMKKVKRKYNAGYYSDVVTRMKNIHKRLNKHHSSQQTYEDA
DSSSESEDEEAKHLDFLESIIYQKSDVQISPLYWQLTKVLRYIRIGNVHA
TLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKIL
RELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRA
RSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQ
NAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQC
ASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTL
VRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTN
VLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKL
EEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINR
LDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELT
VNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDND
KLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARA
LFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGI
EHEKQSMMKKMEKIHKKNARS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0005930axoneme
GO:0042995cell projection
GO:0097546ciliary base
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR000225Armadillo
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0003341cilium movement
GO:0003356regulation of cilium beat frequency
GO:0007368determination of left/right symmetry
GO:0007507heart development
GO:0021591ventricular system development
GO:0030030cell projection organization
GO:0036158outer dynein arm assembly
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 10..44
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..27
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 10..25
NoneNo IPR availablePANTHERPTHR46241FAMILY NOT NAMEDcoord: 82..805
IPR000225ArmadilloSMARTSM00185arm_5coord: 757..797
e-value: 2.9
score: 16.9
coord: 632..674
e-value: 270.0
score: 2.1
coord: 675..715
e-value: 290.0
score: 1.9
coord: 362..402
e-value: 0.71
score: 18.9
coord: 444..485
e-value: 52.0
score: 7.7
coord: 215..255
e-value: 35.0
score: 9.1
coord: 297..361
e-value: 330.0
score: 1.5
coord: 716..756
e-value: 6.8
score: 14.5
coord: 550..590
e-value: 110.0
score: 5.2
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 331..519
e-value: 3.1E-22
score: 80.9
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 531..813
e-value: 1.8E-31
score: 111.2
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 189..330
e-value: 2.7E-12
score: 48.5
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 540..805
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 201..507