Aldehyde dehydrogenase

Overview
NameAldehyde dehydrogenase
Smed IDSMED30014491
Length (bp)1788
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Aldehyde dehydrogenase (SMED30014491) t-SNE clustered cells

Violin plots show distribution of expression levels for Aldehyde dehydrogenase (SMED30014491) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Aldehyde dehydrogenase (SMED30014491) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Aldehyde dehydrogenase (SMED30014491) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014491

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30014491h1SMcG0020550 dd_Smed_v4_1680_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014491h1SMcG0020550 dd_Smed_v4_1680_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014491h1SMcG0020550 dd_Smed_v4_1680_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014491h1SMcG0020550 dd_Smed_v4_1680_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014491h1SMcG0020550 dd_Smed_v4_1680_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Aldehyde dehydrogenase vs. Ensembl Human
Match: ALDH3B1 (aldehyde dehydrogenase 3 family member B1 [Source:HGNC Symbol;Acc:HGNC:410])

HSP 1 Score: 417.927 bits (1073), Expect = 1.024e-140
Identity = 214/447 (47.87%), Postives = 291/447 (65.10%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKK 1421
            + L  LR++F +G TR   FR  QL  L   L+E+++   + L +DLHKSA E+++SE+ + + E++  L+N+  W+ +E+VPK   T  D  +I+++PFG+ L I  WNYP+ L L+PL+G LAAGNCVVLKPSEI+ N EK+L E++P+YVDQ    V LG  + TG+LL+ +FDYI FTG+  V KIV+ AAAKHLTPV LELGGK+P Y+D +   +  A R+   +  NAGQTC+APDYVLC   ++E  L A    I  FY  D  +S N  RIIN K + RL  ++    G+VA GG   E   YIAPT+++     + +M+ EIFGP+LPI+ V S DEAIE IN  EKPLA Y FSN+ +V+ +   +T+SG    ND  +H  +  LPFGGVG SGMG YHGKFS D+FSH R  L +       N LRYPP + ++
Sbjct:    6 DTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSEISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGC--GRVAIGGQSDESDRYIAPTVLVDVQEMEPVMQEEIFGPILPIVNVQSLDEAIEFINRREKPLALYAFSNSSQVVKRVLTQTSSGGFCGNDGFMHMTLASLPFGGVGASGMGRYHGKFSFDTFSHHRACLLRSPGMEKLNALRYPPQSPRR 450          
BLAST of Aldehyde dehydrogenase vs. Ensembl Human
Match: ALDH3B1 (aldehyde dehydrogenase 3 family member B1 [Source:HGNC Symbol;Acc:HGNC:410])

HSP 1 Score: 417.927 bits (1073), Expect = 1.024e-140
Identity = 214/447 (47.87%), Postives = 291/447 (65.10%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKK 1421
            + L  LR++F +G TR   FR  QL  L   L+E+++   + L +DLHKSA E+++SE+ + + E++  L+N+  W+ +E+VPK   T  D  +I+++PFG+ L I  WNYP+ L L+PL+G LAAGNCVVLKPSEI+ N EK+L E++P+YVDQ    V LG  + TG+LL+ +FDYI FTG+  V KIV+ AAAKHLTPV LELGGK+P Y+D +   +  A R+   +  NAGQTC+APDYVLC   ++E  L A    I  FY  D  +S N  RIIN K + RL  ++    G+VA GG   E   YIAPT+++     + +M+ EIFGP+LPI+ V S DEAIE IN  EKPLA Y FSN+ +V+ +   +T+SG    ND  +H  +  LPFGGVG SGMG YHGKFS D+FSH R  L +       N LRYPP + ++
Sbjct:    6 DTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSEISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGC--GRVAIGGQSDESDRYIAPTVLVDVQEMEPVMQEEIFGPILPIVNVQSLDEAIEFINRREKPLALYAFSNSSQVVKRVLTQTSSGGFCGNDGFMHMTLASLPFGGVGASGMGRYHGKFSFDTFSHHRACLLRSPGMEKLNALRYPPQSPRR 450          
BLAST of Aldehyde dehydrogenase vs. Ensembl Human
Match: ALDH3A2 (aldehyde dehydrogenase 3 family member A2 [Source:HGNC Symbol;Acc:HGNC:403])

HSP 1 Score: 417.927 bits (1073), Expect = 2.175e-140
Identity = 213/450 (47.33%), Postives = 295/450 (65.56%), Query Frame = 3
Query:   96 LRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWAL 1445
            +RQ+F SG +R L FR +QL AL  M++E EKD +  +  DL KS       E++    EI ++L+N+  W+  + V K  LT+ D  +IQ QP GV L IG WNYP  L + PLIG +AAGN V++KPSE++ NT K+L +L+P+Y+DQ +  V  G  + T ELLK +FD+I +TGN+AV KIV+EAAAKHLTPV LELGGKSP Y+DKD  + +  RRI   K MN GQTCIAPDY+LC  +++   +    E ++EFY  +   S +Y RIIN +H+ R++ +++    K+A+GG+  E   YIAPT++     +  +M+ EIFGP+LPI+ V + DEAI  IN  EKPLA YVFS+N +++ +   ET+SG +  ND ++H  +   PFGGVG SGMG+YHGK S D+FSH+R  L K  K    N LRYPP ++ K  W  + L
Sbjct:    8 VRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQ--KIAFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFL 455          
BLAST of Aldehyde dehydrogenase vs. Ensembl Human
Match: ALDH3A2 (aldehyde dehydrogenase 3 family member A2 [Source:HGNC Symbol;Acc:HGNC:403])

HSP 1 Score: 417.927 bits (1073), Expect = 2.175e-140
Identity = 213/450 (47.33%), Postives = 295/450 (65.56%), Query Frame = 3
Query:   96 LRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWAL 1445
            +RQ+F SG +R L FR +QL AL  M++E EKD +  +  DL KS       E++    EI ++L+N+  W+  + V K  LT+ D  +IQ QP GV L IG WNYP  L + PLIG +AAGN V++KPSE++ NT K+L +L+P+Y+DQ +  V  G  + T ELLK +FD+I +TGN+AV KIV+EAAAKHLTPV LELGGKSP Y+DKD  + +  RRI   K MN GQTCIAPDY+LC  +++   +    E ++EFY  +   S +Y RIIN +H+ R++ +++    K+A+GG+  E   YIAPT++     +  +M+ EIFGP+LPI+ V + DEAI  IN  EKPLA YVFS+N +++ +   ET+SG +  ND ++H  +   PFGGVG SGMG+YHGK S D+FSH+R  L K  K    N LRYPP ++ K  W  + L
Sbjct:    8 VRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQ--KIAFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFL 455          
BLAST of Aldehyde dehydrogenase vs. Ensembl Human
Match: ALDH3A2 (aldehyde dehydrogenase 3 family member A2 [Source:HGNC Symbol;Acc:HGNC:403])

HSP 1 Score: 417.927 bits (1073), Expect = 2.175e-140
Identity = 213/450 (47.33%), Postives = 295/450 (65.56%), Query Frame = 3
Query:   96 LRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWAL 1445
            +RQ+F SG +R L FR +QL AL  M++E EKD +  +  DL KS       E++    EI ++L+N+  W+  + V K  LT+ D  +IQ QP GV L IG WNYP  L + PLIG +AAGN V++KPSE++ NT K+L +L+P+Y+DQ +  V  G  + T ELLK +FD+I +TGN+AV KIV+EAAAKHLTPV LELGGKSP Y+DKD  + +  RRI   K MN GQTCIAPDY+LC  +++   +    E ++EFY  +   S +Y RIIN +H+ R++ +++    K+A+GG+  E   YIAPT++     +  +M+ EIFGP+LPI+ V + DEAI  IN  EKPLA YVFS+N +++ +   ET+SG +  ND ++H  +   PFGGVG SGMG+YHGK S D+FSH+R  L K  K    N LRYPP ++ K  W  + L
Sbjct:    8 VRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQ--KIAFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFL 455          
BLAST of Aldehyde dehydrogenase vs. Ensembl Celegans
Match: alh-4 (Aldehyde dehydrogenase [Source:UniProtKB/TrEMBL;Acc:O16518])

HSP 1 Score: 373.244 bits (957), Expect = 2.551e-123
Identity = 190/447 (42.51%), Postives = 277/447 (61.97%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKK 1421
            E +E  R+ F++G T+ + FRK+QL+ L   +EE+ +   E + KDL +     ++ E+ +  QEI Y LKN+D W+    V KTF T  D   I++ P GV L I  WNYPV + L+P++  +AAGN VV+KPSE++ N      +LIPKY +     V  G    T +LLK +FD+I++TG   VAKI++ AAAKHLTPV LELGGK P  ++ D  + ++A+RI   K +N GQTC+APDY+L +  VK   + A  + + EFY  D   S++Y R+IN +H+ R+  ++ +T+G V  GG+     LYI PT++ ++   D  M  EIFGPVLPI+ V S  E++E I +GEKPLA Y+F+ N   + +   ET+SG +  ND ++H  V  LPFGGVG SGMG Y GK+  D+F+H++ VL +          RYPP +++K
Sbjct:    5 ELVETQRKYFRTGETKPVKFRKQQLLKLKKFIEENREALSEAVWKDLRRRHESTEILEIGMTIQEIDYFLKNIDDWVKPTHVEKTFTTALDKPVIEKDPKGVVLIISPWNYPVSMILLPMVPAIAAGNTVVIKPSELSENVAATFEKLIPKYFESKYVTVVNGGIPETTDLLKERFDHILYTGCPPVAKIIMTAAAKHLTPVTLELGGKCPVVVEDDADIDISAKRIAWGKWLNCGQTCLAPDYILVNSTVKPKLVAAIRKYVNEFYGEDVKASKDYARMINQRHFDRISGLLDKTQGAVLIGGERDRADLYIPPTVLDVEK-SDPFMHDEIFGPVLPIITVQSFSESLEYIADGEKPLAAYIFTRNEAKVKRLLNETSSGGVTVNDVLMHITVDTLPFGGVGVSGMGRYRGKYGFDTFTHEKSVLHRGFFGESLLAARYPPLSQQK 450          
BLAST of Aldehyde dehydrogenase vs. Ensembl Celegans
Match: alh-4 (Aldehyde dehydrogenase [Source:UniProtKB/TrEMBL;Acc:O16518])

HSP 1 Score: 373.244 bits (957), Expect = 2.551e-123
Identity = 190/447 (42.51%), Postives = 277/447 (61.97%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKK 1421
            E +E  R+ F++G T+ + FRK+QL+ L   +EE+ +   E + KDL +     ++ E+ +  QEI Y LKN+D W+    V KTF T  D   I++ P GV L I  WNYPV + L+P++  +AAGN VV+KPSE++ N      +LIPKY +     V  G    T +LLK +FD+I++TG   VAKI++ AAAKHLTPV LELGGK P  ++ D  + ++A+RI   K +N GQTC+APDY+L +  VK   + A  + + EFY  D   S++Y R+IN +H+ R+  ++ +T+G V  GG+     LYI PT++ ++   D  M  EIFGPVLPI+ V S  E++E I +GEKPLA Y+F+ N   + +   ET+SG +  ND ++H  V  LPFGGVG SGMG Y GK+  D+F+H++ VL +          RYPP +++K
Sbjct:    5 ELVETQRKYFRTGETKPVKFRKQQLLKLKKFIEENREALSEAVWKDLRRRHESTEILEIGMTIQEIDYFLKNIDDWVKPTHVEKTFTTALDKPVIEKDPKGVVLIISPWNYPVSMILLPMVPAIAAGNTVVIKPSELSENVAATFEKLIPKYFESKYVTVVNGGIPETTDLLKERFDHILYTGCPPVAKIIMTAAAKHLTPVTLELGGKCPVVVEDDADIDISAKRIAWGKWLNCGQTCLAPDYILVNSTVKPKLVAAIRKYVNEFYGEDVKASKDYARMINQRHFDRISGLLDKTQGAVLIGGERDRADLYIPPTVLDVEK-SDPFMHDEIFGPVLPIITVQSFSESLEYIADGEKPLAAYIFTRNEAKVKRLLNETSSGGVTVNDVLMHITVDTLPFGGVGVSGMGRYRGKYGFDTFTHEKSVLHRGFFGESLLAARYPPLSQQK 450          
BLAST of Aldehyde dehydrogenase vs. Ensembl Celegans
Match: alh-4 (Aldehyde dehydrogenase [Source:UniProtKB/TrEMBL;Acc:O16518])

HSP 1 Score: 373.244 bits (957), Expect = 2.579e-123
Identity = 190/447 (42.51%), Postives = 277/447 (61.97%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKK 1421
            E +E  R+ F++G T+ + FRK+QL+ L   +EE+ +   E + KDL +     ++ E+ +  QEI Y LKN+D W+    V KTF T  D   I++ P GV L I  WNYPV + L+P++  +AAGN VV+KPSE++ N      +LIPKY +     V  G    T +LLK +FD+I++TG   VAKI++ AAAKHLTPV LELGGK P  ++ D  + ++A+RI   K +N GQTC+APDY+L +  VK   + A  + + EFY  D   S++Y R+IN +H+ R+  ++ +T+G V  GG+     LYI PT++ ++   D  M  EIFGPVLPI+ V S  E++E I +GEKPLA Y+F+ N   + +   ET+SG +  ND ++H  V  LPFGGVG SGMG Y GK+  D+F+H++ VL +          RYPP +++K
Sbjct:    5 ELVETQRKYFRTGETKPVKFRKQQLLKLKKFIEENREALSEAVWKDLRRRHESTEILEIGMTIQEIDYFLKNIDDWVKPTHVEKTFTTALDKPVIEKDPKGVVLIISPWNYPVSMILLPMVPAIAAGNTVVIKPSELSENVAATFEKLIPKYFESKYVTVVNGGIPETTDLLKERFDHILYTGCPPVAKIIMTAAAKHLTPVTLELGGKCPVVVEDDADIDISAKRIAWGKWLNCGQTCLAPDYILVNSTVKPKLVAAIRKYVNEFYGEDVKASKDYARMINQRHFDRISGLLDKTQGAVLIGGERDRADLYIPPTVLDVEK-SDPFMHDEIFGPVLPIITVQSFSESLEYIADGEKPLAAYIFTRNEAKVKRLLNETSSGGVTVNDVLMHITVDTLPFGGVGVSGMGRYRGKYGFDTFTHEKSVLHRGFFGESLLAARYPPLSQQK 450          
BLAST of Aldehyde dehydrogenase vs. Ensembl Celegans
Match: alh-4 (Aldehyde dehydrogenase [Source:UniProtKB/TrEMBL;Acc:O16518])

HSP 1 Score: 373.244 bits (957), Expect = 2.579e-123
Identity = 190/447 (42.51%), Postives = 277/447 (61.97%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKK 1421
            E +E  R+ F++G T+ + FRK+QL+ L   +EE+ +   E + KDL +     ++ E+ +  QEI Y LKN+D W+    V KTF T  D   I++ P GV L I  WNYPV + L+P++  +AAGN VV+KPSE++ N      +LIPKY +     V  G    T +LLK +FD+I++TG   VAKI++ AAAKHLTPV LELGGK P  ++ D  + ++A+RI   K +N GQTC+APDY+L +  VK   + A  + + EFY  D   S++Y R+IN +H+ R+  ++ +T+G V  GG+     LYI PT++ ++   D  M  EIFGPVLPI+ V S  E++E I +GEKPLA Y+F+ N   + +   ET+SG +  ND ++H  V  LPFGGVG SGMG Y GK+  D+F+H++ VL +          RYPP +++K
Sbjct:    5 ELVETQRKYFRTGETKPVKFRKQQLLKLKKFIEENREALSEAVWKDLRRRHESTEILEIGMTIQEIDYFLKNIDDWVKPTHVEKTFTTALDKPVIEKDPKGVVLIISPWNYPVSMILLPMVPAIAAGNTVVIKPSELSENVAATFEKLIPKYFESKYVTVVNGGIPETTDLLKERFDHILYTGCPPVAKIIMTAAAKHLTPVTLELGGKCPVVVEDDADIDISAKRIAWGKWLNCGQTCLAPDYILVNSTVKPKLVAAIRKYVNEFYGEDVKASKDYARMINQRHFDRISGLLDKTQGAVLIGGERDRADLYIPPTVLDVEK-SDPFMHDEIFGPVLPIITVQSFSESLEYIADGEKPLAAYIFTRNEAKVKRLLNETSSGGVTVNDVLMHITVDTLPFGGVGVSGMGRYRGKYGFDTFTHEKSVLHRGFFGESLLAARYPPLSQQK 450          
BLAST of Aldehyde dehydrogenase vs. Ensembl Celegans
Match: alh-4 (Aldehyde dehydrogenase [Source:UniProtKB/TrEMBL;Acc:O16518])

HSP 1 Score: 372.859 bits (956), Expect = 3.446e-123
Identity = 190/447 (42.51%), Postives = 277/447 (61.97%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKK 1421
            E +E  R+ F++G T+ + FRK+QL+ L   +EE+ +   E + KDL +     ++ E+ +  QEI Y LKN+D W+    V KTF T  D   I++ P GV L I  WNYPV + L+P++  +AAGN VV+KPSE++ N      +LIPKY +     V  G    T +LLK +FD+I++TG   VAKI++ AAAKHLTPV LELGGK P  ++ D  + ++A+RI   K +N GQTC+APDY+L +  VK   + A  + + EFY  D   S++Y R+IN +H+ R+  ++ +T+G V  GG+     LYI PT++ ++   D  M  EIFGPVLPI+ V S  E++E I +GEKPLA Y+F+ N   + +   ET+SG +  ND ++H  V  LPFGGVG SGMG Y GK+  D+F+H++ VL +          RYPP +++K
Sbjct:    5 ELVETQRKYFRTGETKPVKFRKQQLLKLKKFIEENREALSEAVWKDLRRRHESTEILEIGMTIQEIDYFLKNIDDWVKPTHVEKTFTTALDKPVIEKDPKGVVLIISPWNYPVSMILLPMVPAIAAGNTVVIKPSELSENVAATFEKLIPKYFESKYVTVVNGGIPETTDLLKERFDHILYTGCPPVAKIIMTAAAKHLTPVTLELGGKCPVVVEDDADIDISAKRIAWGKWLNCGQTCLAPDYILVNSTVKPKLVAAIRKYVNEFYGEDVKASKDYARMINQRHFDRISGLLDKTQGAVLIGGERDRADLYIPPTVLDVEK-SDPFMHDEIFGPVLPIITVQSFSESLEYIADGEKPLAAYIFTRNEAKVKRLLNETSSGGVTVNDVLMHITVDTLPFGGVGVSGMGRYRGKYGFDTFTHEKSVLHRGFFGESLLAARYPPLSQQK 450          
BLAST of Aldehyde dehydrogenase vs. Ensembl Fly
Match: Aldh-III (gene:FBgn0010548 transcript:FBtr0088996)

HSP 1 Score: 414.075 bits (1063), Expect = 5.299e-139
Identity = 207/458 (45.20%), Postives = 293/458 (63.97%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNM--LRYPPYNKKKESWADWALK 1448
            + L+  R +F SG TR+++FR+KQL  L    EEHE + I  L  DL +   E+ + E    K +I +IL  +D W+ +EK PK+F+ + D   I   PFGV L IG WNYP+QL L+P+   +AAGNCVV+KPSEIA N  K + ++IPKY+D     V  G    T ELL  +FDYI +TG++ V KI+  AA K+LTP  LELGGKSP Y+DK V M+ A +RI+  KL+N GQTCIAPDY+LC + V+E F+  A + ++E+Y  +  +S +  R+IN  ++ RL+ ++K   G+VA GG+    + +I PTI++     D +M+ EIFGP+LPI  V S  +AI+ IN  EKPL  YVFSN+ +++ +F   TTSG    N+ ++HC V  LPFGGVG SGMG YHGK+  ++F+HK+  L KD   +   +   RYPPY+ +K S   + L+
Sbjct:    6 DTLQRARLAFSSGKTRNVSFRRKQLENLLRCYEEHENEIISALEADLRRPKQESLIVETEFMKNDIRHILFQLDEWVQSEKPPKSFVNMMDDVQIYNDPFGVVLVIGAWNYPLQLLLVPVASAIAAGNCVVIKPSEIAANCAKFIADVIPKYLDNDCYPVVCGGPSETAELLNQRFDYIFYTGSTRVGKIIHAAANKYLTPTTLELGGKSPCYIDKSVDMRTAVKRILWGKLINCGQTCIAPDYILCSKEVQEKFIVEAKDVLKEWYGENIQSSPDLSRVINANNFQRLLGLMKS--GRVAVGGNYDASERFIEPTILVDVKETDPIMEEEIFGPILPIFNVESAYDAIKFINAREKPLVIYVFSNSNKLVKEFRRSTTSGGFSSNETIMHCGVDVLPFGGVGMSGMGRYHGKYGFETFTHKKSCLGKDLSPLGEKLSSARYPPYSDRKGSLLSFLLR 461          
BLAST of Aldehyde dehydrogenase vs. Ensembl Fly
Match: Aldh-III (gene:FBgn0010548 transcript:FBtr0336912)

HSP 1 Score: 414.075 bits (1063), Expect = 5.591e-139
Identity = 207/458 (45.20%), Postives = 293/458 (63.97%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNM--LRYPPYNKKKESWADWALK 1448
            + L+  R +F SG TR+++FR+KQL  L    EEHE + I  L  DL +   E+ + E    K +I +IL  +D W+ +EK PK+F+ + D   I   PFGV L IG WNYP+QL L+P+   +AAGNCVV+KPSEIA N  K + ++IPKY+D     V  G    T ELL  +FDYI +TG++ V KI+  AA K+LTP  LELGGKSP Y+DK V M+ A +RI+  KL+N GQTCIAPDY+LC + V+E F+  A + ++E+Y  +  +S +  R+IN  ++ RL+ ++K   G+VA GG+    + +I PTI++     D +M+ EIFGP+LPI  V S  +AI+ IN  EKPL  YVFSN+ +++ +F   TTSG    N+ ++HC V  LPFGGVG SGMG YHGK+  ++F+HK+  L KD   +   +   RYPPY+ +K S   + L+
Sbjct:    6 DTLQRARLAFSSGKTRNVSFRRKQLENLLRCYEEHENEIISALEADLRRPKQESLIVETEFMKNDIRHILFQLDEWVQSEKPPKSFVNMMDDVQIYNDPFGVVLVIGAWNYPLQLLLVPVASAIAAGNCVVIKPSEIAANCAKFIADVIPKYLDNDCYPVVCGGPSETAELLNQRFDYIFYTGSTRVGKIIHAAANKYLTPTTLELGGKSPCYIDKSVDMRTAVKRILWGKLINCGQTCIAPDYILCSKEVQEKFIVEAKDVLKEWYGENIQSSPDLSRVINANNFQRLLGLMKS--GRVAVGGNYDASERFIEPTILVDVKETDPIMEEEIFGPILPIFNVESAYDAIKFINAREKPLVIYVFSNSNKLVKEFRRSTTSGGFSSNETIMHCGVDVLPFGGVGMSGMGRYHGKYGFETFTHKKSCLGKDLSPLGEKLSSARYPPYSDRKGSLLSFLLR 461          
BLAST of Aldehyde dehydrogenase vs. Ensembl Fly
Match: Aldh-III (gene:FBgn0010548 transcript:FBtr0310676)

HSP 1 Score: 413.69 bits (1062), Expect = 6.099e-139
Identity = 207/458 (45.20%), Postives = 293/458 (63.97%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNM--LRYPPYNKKKESWADWALK 1448
            + L+  R +F SG TR+++FR+KQL  L    EEHE + I  L  DL +   E+ + E    K +I +IL  +D W+ +EK PK+F+ + D   I   PFGV L IG WNYP+QL L+P+   +AAGNCVV+KPSEIA N  K + ++IPKY+D     V  G    T ELL  +FDYI +TG++ V KI+  AA K+LTP  LELGGKSP Y+DK V M+ A +RI+  KL+N GQTCIAPDY+LC + V+E F+  A + ++E+Y  +  +S +  R+IN  ++ RL+ ++K   G+VA GG+    + +I PTI++     D +M+ EIFGP+LPI  V S  +AI+ IN  EKPL  YVFSN+ +++ +F   TTSG    N+ ++HC V  LPFGGVG SGMG YHGK+  ++F+HK+  L KD   +   +   RYPPY+ +K S   + L+
Sbjct:    6 DTLQRARLAFSSGKTRNVSFRRKQLENLLRCYEEHENEIISALEADLRRPKQESLIVETEFMKNDIRHILFQLDEWVQSEKPPKSFVNMMDDVQIYNDPFGVVLVIGAWNYPLQLLLVPVASAIAAGNCVVIKPSEIAANCAKFIADVIPKYLDNDCYPVVCGGPSETAELLNQRFDYIFYTGSTRVGKIIHAAANKYLTPTTLELGGKSPCYIDKSVDMRTAVKRILWGKLINCGQTCIAPDYILCSKEVQEKFIVEAKDVLKEWYGENIQSSPDLSRVINANNFQRLLGLMKS--GRVAVGGNYDASERFIEPTILVDVKETDPIMEEEIFGPILPIFNVESAYDAIKFINAREKPLVIYVFSNSNKLVKEFRRSTTSGGFSSNETIMHCGVDVLPFGGVGMSGMGRYHGKYGFETFTHKKSCLGKDLSPLGEKLSSARYPPYSDRKGSLLSFLLR 461          
BLAST of Aldehyde dehydrogenase vs. Ensembl Fly
Match: Aldh-III (gene:FBgn0010548 transcript:FBtr0308198)

HSP 1 Score: 414.461 bits (1064), Expect = 2.822e-138
Identity = 207/458 (45.20%), Postives = 293/458 (63.97%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNM--LRYPPYNKKKESWADWALK 1448
            + L+  R +F SG TR+++FR+KQL  L    EEHE + I  L  DL +   E+ + E    K +I +IL  +D W+ +EK PK+F+ + D   I   PFGV L IG WNYP+QL L+P+   +AAGNCVV+KPSEIA N  K + ++IPKY+D     V  G    T ELL  +FDYI +TG++ V KI+  AA K+LTP  LELGGKSP Y+DK V M+ A +RI+  KL+N GQTCIAPDY+LC + V+E F+  A + ++E+Y  +  +S +  R+IN  ++ RL+ ++K   G+VA GG+    + +I PTI++     D +M+ EIFGP+LPI  V S  +AI+ IN  EKPL  YVFSN+ +++ +F   TTSG    N+ ++HC V  LPFGGVG SGMG YHGK+  ++F+HK+  L KD   +   +   RYPPY+ +K S   + L+
Sbjct:   72 DTLQRARLAFSSGKTRNVSFRRKQLENLLRCYEEHENEIISALEADLRRPKQESLIVETEFMKNDIRHILFQLDEWVQSEKPPKSFVNMMDDVQIYNDPFGVVLVIGAWNYPLQLLLVPVASAIAAGNCVVIKPSEIAANCAKFIADVIPKYLDNDCYPVVCGGPSETAELLNQRFDYIFYTGSTRVGKIIHAAANKYLTPTTLELGGKSPCYIDKSVDMRTAVKRILWGKLINCGQTCIAPDYILCSKEVQEKFIVEAKDVLKEWYGENIQSSPDLSRVINANNFQRLLGLMKS--GRVAVGGNYDASERFIEPTILVDVKETDPIMEEEIFGPILPIFNVESAYDAIKFINAREKPLVIYVFSNSNKLVKEFRRSTTSGGFSSNETIMHCGVDVLPFGGVGMSGMGRYHGKYGFETFTHKKSCLGKDLSPLGEKLSSARYPPYSDRKGSLLSFLLR 527          
BLAST of Aldehyde dehydrogenase vs. Ensembl Fly
Match: Aldh-III (gene:FBgn0010548 transcript:FBtr0300481)

HSP 1 Score: 414.075 bits (1063), Expect = 3.992e-138
Identity = 207/458 (45.20%), Postives = 293/458 (63.97%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNM--LRYPPYNKKKESWADWALK 1448
            + L+  R +F SG TR+++FR+KQL  L    EEHE + I  L  DL +   E+ + E    K +I +IL  +D W+ +EK PK+F+ + D   I   PFGV L IG WNYP+QL L+P+   +AAGNCVV+KPSEIA N  K + ++IPKY+D     V  G    T ELL  +FDYI +TG++ V KI+  AA K+LTP  LELGGKSP Y+DK V M+ A +RI+  KL+N GQTCIAPDY+LC + V+E F+  A + ++E+Y  +  +S +  R+IN  ++ RL+ ++K   G+VA GG+    + +I PTI++     D +M+ EIFGP+LPI  V S  +AI+ IN  EKPL  YVFSN+ +++ +F   TTSG    N+ ++HC V  LPFGGVG SGMG YHGK+  ++F+HK+  L KD   +   +   RYPPY+ +K S   + L+
Sbjct:   71 DTLQRARLAFSSGKTRNVSFRRKQLENLLRCYEEHENEIISALEADLRRPKQESLIVETEFMKNDIRHILFQLDEWVQSEKPPKSFVNMMDDVQIYNDPFGVVLVIGAWNYPLQLLLVPVASAIAAGNCVVIKPSEIAANCAKFIADVIPKYLDNDCYPVVCGGPSETAELLNQRFDYIFYTGSTRVGKIIHAAANKYLTPTTLELGGKSPCYIDKSVDMRTAVKRILWGKLINCGQTCIAPDYILCSKEVQEKFIVEAKDVLKEWYGENIQSSPDLSRVINANNFQRLLGLMKS--GRVAVGGNYDASERFIEPTILVDVKETDPIMEEEIFGPILPIFNVESAYDAIKFINAREKPLVIYVFSNSNKLVKEFRRSTTSGGFSSNETIMHCGVDVLPFGGVGMSGMGRYHGKYGFETFTHKKSCLGKDLSPLGEKLSSARYPPYSDRKGSLLSFLLR 526          
BLAST of Aldehyde dehydrogenase vs. Ensembl Zebrafish
Match: aldh3b1 (aldehyde dehydrogenase 3 family, member B1 [Source:ZFIN;Acc:ZDB-GENE-021120-3])

HSP 1 Score: 427.172 bits (1097), Expect = 1.997e-144
Identity = 216/469 (46.06%), Postives = 305/469 (65.03%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALKSDAKDSSGFCSIL 1487
            + LE LR +F+SG+T  + FR  QL A+ ++ E++E   +E LH+DL K   E  LSE+ +   +I Y + N+ TW+    V     T  D  +++R+P GV L IG WNYP+QL L PLIG +AAGNC +LKPSEI+  TEKLL ELIPKY+ Q    V  G A+ T  LL+ +FD+I +TG+ +VA+ VL+AAA HLTPV LELGGK P  +   + MK AA+R++ +K  N+GQ+C+APDYVLC   VKE  L    EA+E FY ++   S +Y RI+ ++H++RL++++K++ GK+  GG+  ++  YIAPT+++     D LM+ EIFGP+LPIL + S DE I  IN  EK LA Y FS+  +V++     T+SG    ND +VH  + GLPFGGVG SGMG+YHG++  ++FSHKRG + +       N+LRYPPY +   SW  WA  +  K   G CS++
Sbjct:    6 QVLERLRGAFRSGVTLPVHFRLTQLEAMMSLFEDNETQILEALHEDLAKPKFETVLSEIDIVVNDICYNISNLQTWMQPSYVGTNLATKLDDCFVRREPLGVVLIIGAWNYPIQLILSPLIGAIAAGNCAILKPSEISKATEKLLAELIPKYLSQECYAVVCGGAEETKTLLENRFDHIFYTGSQSVARCVLQAAAVHLTPVTLELGGKCPCLIYGRLDMKAAAKRLVWAKFFNSGQSCVAPDYVLCTDEVKEMLLPFMKEALESFYGSEPQESPDYGRIVTDRHWNRLIELMKKSEGKIVIGGESVKETRYIAPTVIVDVKGTDALMQEEIFGPILPILTIKSLDEGINFINEKEKALALYAFSDESQVVTTVLERTSSGGFCSNDGIVHMTLPGLPFGGVGASGMGNYHGRWGFETFSHKRGCMLRGWGLERVNVLRYPPYTESNLSWLRWATTAKKKGWGG-CSLM 473          
BLAST of Aldehyde dehydrogenase vs. Ensembl Zebrafish
Match: aldh3b1 (aldehyde dehydrogenase 3 family, member B1 [Source:ZFIN;Acc:ZDB-GENE-021120-3])

HSP 1 Score: 427.172 bits (1097), Expect = 1.997e-144
Identity = 216/469 (46.06%), Postives = 305/469 (65.03%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALKSDAKDSSGFCSIL 1487
            + LE LR +F+SG+T  + FR  QL A+ ++ E++E   +E LH+DL K   E  LSE+ +   +I Y + N+ TW+    V     T  D  +++R+P GV L IG WNYP+QL L PLIG +AAGNC +LKPSEI+  TEKLL ELIPKY+ Q    V  G A+ T  LL+ +FD+I +TG+ +VA+ VL+AAA HLTPV LELGGK P  +   + MK AA+R++ +K  N+GQ+C+APDYVLC   VKE  L    EA+E FY ++   S +Y RI+ ++H++RL++++K++ GK+  GG+  ++  YIAPT+++     D LM+ EIFGP+LPIL + S DE I  IN  EK LA Y FS+  +V++     T+SG    ND +VH  + GLPFGGVG SGMG+YHG++  ++FSHKRG + +       N+LRYPPY +   SW  WA  +  K   G CS++
Sbjct:    6 QVLERLRGAFRSGVTLPVHFRLTQLEAMMSLFEDNETQILEALHEDLAKPKFETVLSEIDIVVNDICYNISNLQTWMQPSYVGTNLATKLDDCFVRREPLGVVLIIGAWNYPIQLILSPLIGAIAAGNCAILKPSEISKATEKLLAELIPKYLSQECYAVVCGGAEETKTLLENRFDHIFYTGSQSVARCVLQAAAVHLTPVTLELGGKCPCLIYGRLDMKAAAKRLVWAKFFNSGQSCVAPDYVLCTDEVKEMLLPFMKEALESFYGSEPQESPDYGRIVTDRHWNRLIELMKKSEGKIVIGGESVKETRYIAPTVIVDVKGTDALMQEEIFGPILPILTIKSLDEGINFINEKEKALALYAFSDESQVVTTVLERTSSGGFCSNDGIVHMTLPGLPFGGVGASGMGNYHGRWGFETFSHKRGCMLRGWGLERVNVLRYPPYTESNLSWLRWATTAKKKGWGG-CSLM 473          
BLAST of Aldehyde dehydrogenase vs. Ensembl Zebrafish
Match: aldh3a2b (aldehyde dehydrogenase 3 family, member A2b [Source:ZFIN;Acc:ZDB-GENE-040912-103])

HSP 1 Score: 406.757 bits (1044), Expect = 3.428e-136
Identity = 205/451 (45.45%), Postives = 294/451 (65.19%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWA 1433
            +A+E  R++F +G ++SL +R  QL  L   ++E +K+  E L KDL +S     L E L  + EI+  LK +  W A   V K+ +T++D  +IQ +P GV L IG WNYP  + + PL+G +AAGN  V+KPSE++ +T K++ E +P Y+D+ +  V  G  K T ELLK +FD+I +TGN  V KI++EAAAKHLTP  LELGGKSP Y+DKD  + +A RRI   K  N GQTCIAPDY+LC  ++++  +    + I+EFY+ +     +Y RIIN +H+ RLM +++ +   +A  G+  E + YIAPT++     +  +M+ EIFGP+LPI+ VNS DEAI+ IN  +KPLA Y+FS++++++ +   ET+SG L+ NDC++H +V  LPFGGVG SGMG YHGK   D+ SH RGVL K  K    N +RYPP+   K  WA
Sbjct:    6 KAVERARKAFFTGRSKSLEYRISQLKNLQRFMQERQKEIAEALKKDLKRSEFGTSLYETLGVESEINLALKKLKEWAAPRPVNKSLMTISDQVYIQPEPLGVVLIIGAWNYPWAVTVGPLVGAIAAGNAAVIKPSEVSAHTSKVMEEFLPLYLDKELYPVVTGGVKETQELLKQRFDHIFYTGNGMVGKIIMEAAAKHLTPTTLELGGKSPCYIDKDCDLTIACRRIAWGKYSNCGQTCIAPDYILCDPSIQDRVIEEIKKNIKEFYTENPQKCPDYGRIINQRHFKRLMSLMEGS--SIAVSGEHNEAECYIAPTVLRDVKPDAKVMQEEIFGPLLPIVTVNSVDEAIKFINQRDKPLALYIFSSDKKLIDRMIAETSSGGLMANDCLMHFSVSSLPFGGVGDSGMGRYHGKHGFDNLSHMRGVLLKQLKMEAVNKMRYPPHTADKLGWA 454          
BLAST of Aldehyde dehydrogenase vs. Ensembl Zebrafish
Match: aldh3a2a (aldehyde dehydrogenase 3 family, member A2a [Source:ZFIN;Acc:ZDB-GENE-040718-74])

HSP 1 Score: 399.438 bits (1025), Expect = 2.510e-133
Identity = 207/450 (46.00%), Postives = 295/450 (65.56%), Query Frame = 3
Query:   84 ALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWA 1433
            A++  R++F +G ++SL +R KQL  L   ++E   D    L KDL+KSA   +L E+L  + EI+  +  +  W A   V K  LT++D  ++Q +P GV L IG WNYP+ + L PL+G +AAGN VV+KPSE++ +T  ++ EL+  Y+D  + +V  G    T ELLK +FD+I +TGNS V K+V+EAA+ HLTPV LELGGKSP Y+DK+  +++A RRI   K +N GQTCIAPDY+LC  ++++  +    + I+EFY+ D  T E+Y RIIN +H+ R+M +++ +   VA GGD  E + YIAPT++        +M+ EIFGP+LPI+ VN   EAIE IN+ EKPLA YVFS++++V+ +   ET+SG+L+ NDC+VH  +  LPFGGVG SG G YHGK+S D  SH R  L K       N +RYPP+  +K  WA
Sbjct:    7 AVQQARKAFLTGRSKSLDYRIKQLKNLSRFIKERAADITNALRKDLYKSANSTQLFEILGLEGEINLAVSKLAEWAAPRPVNKNLLTISDDVFLQPEPLGVVLIIGAWNYPIAVTLQPLVGAIAAGNAVVVKPSEVSSHTASVM-ELMSLYLDSEMYQVVTGGVPETQELLKQRFDHIFYTGNSTVGKLVMEAASHHLTPVTLELGGKSPCYIDKNCDIRIACRRITWGKYLNCGQTCIAPDYILCESSIQDRVIDEIQKCIKEFYTIDPKTFEDYGRIINRRHFKRIMALLEGS--TVAIGGDCDESECYIAPTVLRDVKPASKVMQEEIFGPILPIVTVNGLKEAIEFINDREKPLALYVFSSSKKVIKQMISETSSGALLANDCMVHFTLSDLPFGGVGYSGTGRYHGKYSFDQVSHLRSCLIKKLNMEAVNQMRYPPHTTEKLRWA 453          
BLAST of Aldehyde dehydrogenase vs. Ensembl Zebrafish
Match: aldh3a2a (aldehyde dehydrogenase 3 family, member A2a [Source:ZFIN;Acc:ZDB-GENE-040718-74])

HSP 1 Score: 399.438 bits (1025), Expect = 2.510e-133
Identity = 207/450 (46.00%), Postives = 295/450 (65.56%), Query Frame = 3
Query:   84 ALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWA 1433
            A++  R++F +G ++SL +R KQL  L   ++E   D    L KDL+KSA   +L E+L  + EI+  +  +  W A   V K  LT++D  ++Q +P GV L IG WNYP+ + L PL+G +AAGN VV+KPSE++ +T  ++ EL+  Y+D  + +V  G    T ELLK +FD+I +TGNS V K+V+EAA+ HLTPV LELGGKSP Y+DK+  +++A RRI   K +N GQTCIAPDY+LC  ++++  +    + I+EFY+ D  T E+Y RIIN +H+ R+M +++ +   VA GGD  E + YIAPT++        +M+ EIFGP+LPI+ VN   EAIE IN+ EKPLA YVFS++++V+ +   ET+SG+L+ NDC+VH  +  LPFGGVG SG G YHGK+S D  SH R  L K       N +RYPP+  +K  WA
Sbjct:    7 AVQQARKAFLTGRSKSLDYRIKQLKNLSRFIKERAADITNALRKDLYKSANSTQLFEILGLEGEINLAVSKLAEWAAPRPVNKNLLTISDDVFLQPEPLGVVLIIGAWNYPIAVTLQPLVGAIAAGNAVVVKPSEVSSHTASVM-ELMSLYLDSEMYQVVTGGVPETQELLKQRFDHIFYTGNSTVGKLVMEAASHHLTPVTLELGGKSPCYIDKNCDIRIACRRITWGKYLNCGQTCIAPDYILCESSIQDRVIDEIQKCIKEFYTIDPKTFEDYGRIINRRHFKRIMALLEGS--TVAIGGDCDESECYIAPTVLRDVKPASKVMQEEIFGPILPIVTVNGLKEAIEFINDREKPLALYVFSSSKKVIKQMISETSSGALLANDCMVHFTLSDLPFGGVGYSGTGRYHGKYSFDQVSHLRSCLIKKLNMEAVNQMRYPPHTTEKLRWA 453          
BLAST of Aldehyde dehydrogenase vs. Ensembl Xenopus
Match: mprip (myosin phosphatase Rho interacting protein [Source:Xenbase;Acc:XB-GENE-5933375])

HSP 1 Score: 411.764 bits (1057), Expect = 4.230e-138
Identity = 216/457 (47.26%), Postives = 295/457 (64.55%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRG-VLDKDTKEIVNNMLRYPPYNKKKESWADWALK 1448
            E L  LR SF +G TR   FR  QL AL   LEE++K+  + L  DL K   E +LSEL L + EI+  L ++  W+ +E V K   T  D  +I++ PFGV L IG WNYPV L L+PL+G +AAGNCV++KPSEI+ NTE+LL E +P+Y+D+    V    A+ T  LL+ KFDYI FTGN+ V KIV+ AAAKHLTPV LELGGK+P Y+D++  +  AARRI  S+  NAGQTC+APDYVLC    ++  + A    + EFY  D   S +  RIIN++H+ R+  ++  + G +  GG   E + YIAPTI+I     D +M+ EIFGPVLP++ +   D A+E IN  E+PLA YV+S+  +V+ +F   T+SG    ND ++H  +  LPFGG+G SGMG YHGKFS D+FSH R  +L  D +E +N  +RYPPY ++    A +A++
Sbjct:   20 ETLRRLRSSFLAGRTRGAKFRFAQLEALARFLEENKKEISQSLKMDLSKPQFETELSELSLVRSEINLALSSLGAWMKDEFVAKNLATTFDTAFIRKDPFGVVLIIGPWNYPVHLTLLPLVGAIAAGNCVIIKPSEISQNTERLLAEHLPRYLDKDCFAVLCAGAEDTSRLLENKFDYIFFTGNAHVGKIVMAAAAKHLTPVTLELGGKNPCYVDEECDISNAARRISWSRYFNAGQTCLAPDYVLCTERTRDRLVKALKATVREFYGQDPKQSPDLGRIINDRHFRRVSALL--SSGTIVTGGQTDEAEKYIAPTILIDVKESDPVMQEEIFGPVLPVMTIGGLDAALEFINKRERPLAAYVYSSKSQVVDRFLEGTSSGGFCANDGLLHSTLISLPFGGIGHSGMGKYHGKFSFDTFSHHRACLLRSDGREKLNE-IRYPPYTEQHLGMAVYAME 473          
BLAST of Aldehyde dehydrogenase vs. Ensembl Xenopus
Match: mprip (myosin phosphatase Rho interacting protein [Source:Xenbase;Acc:XB-GENE-5933375])

HSP 1 Score: 411.764 bits (1057), Expect = 7.182e-138
Identity = 216/457 (47.26%), Postives = 295/457 (64.55%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRG-VLDKDTKEIVNNMLRYPPYNKKKESWADWALK 1448
            E L  LR SF +G TR   FR  QL AL   LEE++K+  + L  DL K   E +LSEL L + EI+  L ++  W+ +E V K   T  D  +I++ PFGV L IG WNYPV L L+PL+G +AAGNCV++KPSEI+ NTE+LL E +P+Y+D+    V    A+ T  LL+ KFDYI FTGN+ V KIV+ AAAKHLTPV LELGGK+P Y+D++  +  AARRI  S+  NAGQTC+APDYVLC    ++  + A    + EFY  D   S +  RIIN++H+ R+  ++  + G +  GG   E + YIAPTI+I     D +M+ EIFGPVLP++ +   D A+E IN  E+PLA YV+S+  +V+ +F   T+SG    ND ++H  +  LPFGG+G SGMG YHGKFS D+FSH R  +L  D +E +N  +RYPPY ++    A +A++
Sbjct:    6 ETLRRLRSSFLAGRTRGAKFRFAQLEALARFLEENKKEISQSLKMDLSKPQFETELSELSLVRSEINLALSSLGAWMKDEFVAKNLATTFDTAFIRKDPFGVVLIIGPWNYPVHLTLLPLVGAIAAGNCVIIKPSEISQNTERLLAEHLPRYLDKDCFAVLCAGAEDTSRLLENKFDYIFFTGNAHVGKIVMAAAAKHLTPVTLELGGKNPCYVDEECDISNAARRISWSRYFNAGQTCLAPDYVLCTERTRDRLVKALKATVREFYGQDPKQSPDLGRIINDRHFRRVSALL--SSGTIVTGGQTDEAEKYIAPTILIDVKESDPVMQEEIFGPVLPVMTIGGLDAALEFINKRERPLAAYVYSSKSQVVDRFLEGTSSGGFCANDGLLHSTLISLPFGGIGHSGMGKYHGKFSFDTFSHHRACLLRSDGREKLNE-IRYPPYTEQHLGMAVYAME 459          
BLAST of Aldehyde dehydrogenase vs. Ensembl Xenopus
Match: mprip (myosin phosphatase Rho interacting protein [Source:Xenbase;Acc:XB-GENE-5933375])

HSP 1 Score: 410.994 bits (1055), Expect = 1.039e-137
Identity = 216/457 (47.26%), Postives = 295/457 (64.55%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRG-VLDKDTKEIVNNMLRYPPYNKKKESWADWALK 1448
            E L  LR SF +G TR   FR  QL AL   LEE++K+  + L  DL K   E +LSEL L + EI+  L ++  W+ +E V K   T  D  +I++ PFGV L IG WNYPV L L+PL+G +AAGNCV++KPSEI+ NTE+LL E +P+Y+D+    V    A+ T  LL+ KFDYI FTGN+ V KIV+ AAAKHLTPV LELGGK+P Y+D++  +  AARRI  S+  NAGQTC+APDYVLC    ++  + A    + EFY  D   S +  RIIN++H+ R+  ++  + G +  GG   E + YIAPTI+I     D +M+ EIFGPVLP++ +   D A+E IN  E+PLA YV+S+  +V+ +F   T+SG    ND ++H  +  LPFGG+G SGMG YHGKFS D+FSH R  +L  D +E +N  +RYPPY ++    A +A++
Sbjct:   23 ETLRRLRSSFLAGRTRGAKFRFAQLEALARFLEENKKEISQSLKMDLSKPQFETELSELSLVRSEINLALSSLGAWMKDEFVAKNLATTFDTAFIRKDPFGVVLIIGPWNYPVHLTLLPLVGAIAAGNCVIIKPSEISQNTERLLAEHLPRYLDKDCFAVLCAGAEDTSRLLENKFDYIFFTGNAHVGKIVMAAAAKHLTPVTLELGGKNPCYVDEECDISNAARRISWSRYFNAGQTCLAPDYVLCTERTRDRLVKALKATVREFYGQDPKQSPDLGRIINDRHFRRVSALL--SSGTIVTGGQTDEAEKYIAPTILIDVKESDPVMQEEIFGPVLPVMTIGGLDAALEFINKRERPLAAYVYSSKSQVVDRFLEGTSSGGFCANDGLLHSTLISLPFGGIGHSGMGKYHGKFSFDTFSHHRACLLRSDGREKLNE-IRYPPYTEQHLGMAVYAME 476          
BLAST of Aldehyde dehydrogenase vs. Ensembl Xenopus
Match: mprip (myosin phosphatase Rho interacting protein [Source:Xenbase;Acc:XB-GENE-5933375])

HSP 1 Score: 410.223 bits (1053), Expect = 2.547e-137
Identity = 216/457 (47.26%), Postives = 295/457 (64.55%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRG-VLDKDTKEIVNNMLRYPPYNKKKESWADWALK 1448
            E L  LR SF +G TR   FR  QL AL   LEE++K+  + L  DL K   E +LSEL L + EI+  L ++  W+ +E V K   T  D  +I++ PFGV L IG WNYPV L L+PL+G +AAGNCV++KPSEI+ NTE+LL E +P+Y+D+    V    A+ T  LL+ KFDYI FTGN+ V KIV+ AAAKHLTPV LELGGK+P Y+D++  +  AARRI  S+  NAGQTC+APDYVLC    ++  + A    + EFY  D   S +  RIIN++H+ R+  ++  + G +  GG   E + YIAPTI+I     D +M+ EIFGPVLP++ +   D A+E IN  E+PLA YV+S+  +V+ +F   T+SG    ND ++H  +  LPFGG+G SGMG YHGKFS D+FSH R  +L  D +E +N  +RYPPY ++    A +A++
Sbjct:   32 ETLRRLRSSFLAGRTRGAKFRFAQLEALARFLEENKKEISQSLKMDLSKPQFETELSELSLVRSEINLALSSLGAWMKDEFVAKNLATTFDTAFIRKDPFGVVLIIGPWNYPVHLTLLPLVGAIAAGNCVIIKPSEISQNTERLLAEHLPRYLDKDCFAVLCAGAEDTSRLLENKFDYIFFTGNAHVGKIVMAAAAKHLTPVTLELGGKNPCYVDEECDISNAARRISWSRYFNAGQTCLAPDYVLCTERTRDRLVKALKATVREFYGQDPKQSPDLGRIINDRHFRRVSALL--SSGTIVTGGQTDEAEKYIAPTILIDVKESDPVMQEEIFGPVLPVMTIGGLDAALEFINKRERPLAAYVYSSKSQVVDRFLEGTSSGGFCANDGLLHSTLISLPFGGIGHSGMGKYHGKFSFDTFSHHRACLLRSDGREKLNE-IRYPPYTEQHLGMAVYAME 485          
BLAST of Aldehyde dehydrogenase vs. Ensembl Xenopus
Match: aldh3a2 (aldehyde dehydrogenase 3 family member A2 [Source:NCBI gene;Acc:549291])

HSP 1 Score: 393.66 bits (1010), Expect = 6.256e-131
Identity = 206/459 (44.88%), Postives = 300/459 (65.36%), Query Frame = 3
Query:   99 RQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALKSD--AKDSS 1469
            R++F +G T+S+ FR +QL A+  ML E+E  F+E L  DLHK+   A   E++    EI   + N+  W   + V K  +T+ D  +I+ +P GV L IG WNYPV + L P++G +AAGN VV+KPSE++ NT KLL  LIP+Y+D+ +  +  G    T +LL+ +FD+I +TG++ V KI++ AAAK LTPV LELGGKSP Y+DK+  + +A+RR+   K +N GQTCIAPDY+LC +++++  +    E ++EFY  D   S +Y RIIN +H+ R++++++    ++ +GG   E   YI PT++   + E  +M+ EIFGPVLPI+ V + DEAI+ IN  EKPLA YVFS +++V+ +   ET+SG +  ND ++H  V  LPFGGVG SGMG+YHGK + D+FSHKR  L K       N +RYPPY+ KK  WA + L +   A+D S
Sbjct:   12 RKAFLTGKTQSIDFRIQQLQAMERMLTENEAGFVEALKADLHKNECTAYSYEIMGLLGEIHLAIDNLTKWTEPKHVKKNIMTMRDEVYIKYEPLGVVLVIGAWNYPVVVLLQPVVGAIAAGNAVVIKPSEVSENTAKLLERLIPRYLDKELYPIVNGGIPETTQLLEQRFDHIFYTGSTGVGKIIMSAAAKFLTPVTLELGGKSPCYIDKNCDIDIASRRVTWGKFVNCGQTCIAPDYILCDKSIQDKVVEKIKETLKEFYGEDVKKSPDYERIINKRHFKRILELMEGQ--QIVHGGSYDEKTCYIEPTVLADVNPESKVMQEEIFGPVLPIVSVRNLDEAIQFINQREKPLALYVFSKDKQVIKRMISETSSGGVTANDVIMHFTVTELPFGGVGHSGMGAYHGKHTFDTFSHKRACLIKSLAMEGVNKIRYPPYSMKKVEWAKFLLTTKLIARDKS 468          
BLAST of Aldehyde dehydrogenase vs. Ensembl Mouse
Match: Aldh3b3 (aldehyde dehydrogenase 3 family, member B3 [Source:MGI Symbol;Acc:MGI:1920708])

HSP 1 Score: 422.55 bits (1085), Expect = 1.684e-142
Identity = 215/459 (46.84%), Postives = 301/459 (65.58%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALKSDA 1457
            E L+ L+++F +G T++  FR +QL +L   L+++ K   + L  DL KS  E+ +SE++LC+ E+   LKN+ TW+ +E V    LT     +I+++PFG+ L I  WNYPV L +IPL+G +AAGNCVVLKPSEI+ NTEK+L EL+P+Y+DQ    V LG  + TG+LL+ KFDYI FTG+  V KIV+ AAAKHLTP+ LELGGK+P Y+D +   +  A R+   +  NAGQTC+APDY+LC + ++E  + A   AI  FY  +  TS N  RIIN KH+ RL  ++    G+VA GG   E + YIAPT+++     + +M+ EIFGP+LP++ V S DEAIE +N  EKPLA Y +SNN EV+ +    T+SG    ND  ++  +  LPFGGVG SGMG YHGKFS D+FS++R  L         N LRYPPY+ +++    WA+ S++
Sbjct:   19 EKLQRLKEAFNTGKTKTAKFRAEQLQSLGRFLQDNSKQLHDALDGDLGKSGFESDMSEIILCENEVDLALKNLQTWMKDEPVSTNLLTKLSTAFIRKEPFGLVLIIAPWNYPVNLMIIPLVGAIAAGNCVVLKPSEISKNTEKVLAELLPQYLDQSCFAVMLGGPEETGQLLEHKFDYIFFTGSPRVGKIVMTAAAKHLTPITLELGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYILCSQEMQEQLVPALQNAITRFYGDNPQTSPNLGRIINQKHFKRLQGLLGC--GRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPILPLVTVRSLDEAIEFMNQREKPLALYAYSNNAEVIKQVLARTSSGGFCGNDGFMYMTLSSLPFGGVGSSGMGRYHGKFSFDTFSNQRACLLSCPGMEKLNGLRYPPYSPRRQQLLRWAIGSES 475          
BLAST of Aldehyde dehydrogenase vs. Ensembl Mouse
Match: Aldh3b1 (aldehyde dehydrogenase 3 family, member B1 [Source:MGI Symbol;Acc:MGI:1914939])

HSP 1 Score: 419.468 bits (1077), Expect = 2.183e-141
Identity = 213/446 (47.76%), Postives = 295/446 (66.14%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKK 1418
            + L+ LR++FK G TRS  FR  QL  L   L ++++   E L +DLHKSA EA++SE+ + + E+   L+N+ +W+ +EKV K   T  D  +I+++PFG+ L I  WNYP+ L L+PL+G +AAGNCVVLKPSEI+  TEK+L E++P+Y+DQ    V LG  + TG+LL+ KFDYI FTGN+ V KIV+ AAAKHLTP+ LELGGK+P Y+D +   ++ A R+   +  NAGQTC+APDY+LC + ++E  + A   AI  FY  +  TS N  RIIN KH+ RL  ++    G+VA GG   E + YIAPT+++     + +M+ EIFGP+LP++ V S DEAIE +N  EKPLA Y FS   +V+ +    T+SG    ND  +H  +  LPFGGVG SGMG YHGKFS D+FS++R  L +       N LRYPPY+ +
Sbjct:    6 DKLQQLREAFKEGRTRSAEFRAAQLQGLSHFLRDNKQQLQEALAQDLHKSAFEAEVSEIAISQAEVDLALRNLRSWMKDEKVSKNLATQLDSAFIRKEPFGLVLIIVPWNYPINLTLVPLVGAIAAGNCVVLKPSEISKATEKILAEVLPRYLDQSCFTVVLGGRQETGQLLEHKFDYIFFTGNAYVGKIVMAAAAKHLTPITLELGGKNPCYVDDNCDPQIVANRVAWFRYFNAGQTCVAPDYILCSQEMQERLVPALQNAITRFYGDNPQTSPNLGRIINQKHFKRLQGLLGC--GRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPILPLVTVRSLDEAIEFMNRREKPLALYAFSKRSQVIKQVLARTSSGGFCGNDGFMHMTLSSLPFGGVGTSGMGRYHGKFSFDTFSNQRACLLRSPGMEKINDLRYPPYSSR 449          
BLAST of Aldehyde dehydrogenase vs. Ensembl Mouse
Match: Aldh3b2 (aldehyde dehydrogenase 3 family, member B2 [Source:MGI Symbol;Acc:MGI:2147613])

HSP 1 Score: 415.231 bits (1066), Expect = 1.480e-139
Identity = 215/455 (47.25%), Postives = 293/455 (64.40%), Query Frame = 3
Query:   87 LEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALKS 1451
            L  LR++F +G TR   FR  QL +L   L+E+++   + L KD+ KS  E+ +SE++LC+ E+   LKN+ TW+ +E V    LT     +I+++PFG+ L I  WNYPV L +IPL+G +AAGNCVVLKPSEI+ NTEK+L EL+P+Y+DQ    V LG  + T +LL+ KFDYI FTG+  V KIV+ AAAKHLTP+ LELGGK+P Y+D +   +  A R+   +  NAGQTC+APDY+LC + ++E  + A   +I  FY  +  TS N  RIIN KH+ RL  ++    G+VA GG   E + YIAPT+++     + +M+ EIFGP+LP++ V S DEAIE IN  EKPLA Y FSNN +V+++    T+SG    ND  ++  +  LP GGVG SGMG YHGKFS D+FSH R  L +       N LRYPPY    +    WA+ S
Sbjct:   21 LHSLREAFNAGRTRPTEFRTAQLRSLGRFLQENKELLQDALAKDVGKSGFESDMSEIILCENEVDLALKNLQTWMKDEPVSTNLLTKLSSAFIRKEPFGLVLIIAPWNYPVNLMIIPLVGAIAAGNCVVLKPSEISKNTEKVLAELLPQYLDQSCFAVMLGGPEETRQLLEHKFDYIFFTGSPRVGKIVMTAAAKHLTPITLELGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYILCSQEMQERLVPALQNSITRFYGDNPQTSPNLGRIINQKHFKRLQGLLGC--GRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPILPLVTVRSLDEAIEFINRREKPLALYAFSNNNQVVNQMLERTSSGGFGGNDGFLYLTLPALPLGGVGNSGMGRYHGKFSFDTFSHHRACLLRSPGMEKLNDLRYPPYGPWNQQLISWAIGS 473          
BLAST of Aldehyde dehydrogenase vs. Ensembl Mouse
Match: Aldh3a1 (aldehyde dehydrogenase family 3, subfamily A1 [Source:MGI Symbol;Acc:MGI:1353451])

HSP 1 Score: 404.06 bits (1037), Expect = 1.486e-135
Identity = 208/440 (47.27%), Postives = 284/440 (64.55%), Query Frame = 3
Query:   99 RQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKK 1418
            R +F SG TR L FR +QL AL  M+ E+ K   + L  +L K+   +   E+     EI + +K +  W  +E V KT  T  D  +I  +P GV L IG WNYP  L + P++G +AAGN VVLKPSE++ +   LL  LIP+Y+D+ +  V  G    T ELLK KFD+I++TG++AV KIV+ AAAKHLTPV LELGGKSP Y+DKD  + +A RRI   K MN+GQTC+APDY+LC  +++   +    +++++FY  DA  S +Y RIIN++H+ R++++I     KVA+GG   +   YIAPTI++    +  +M+ EIFGPV+PI+ V S DEAI+ IN  EKPLA YVFSNN +V+ K   ET+SG +  ND +VH  V  LPFGGVG SGMG+YHGK S ++FSH+R  L +  +    N  RYPP   K
Sbjct:   12 RDAFNSGKTRPLQFRVEQLEALQRMINENLKGISKALASNLRKNEWTSYYEEVAHVLDEIDFTIKGLSDWAEDEPVAKTRQTQEDDLYIHSEPLGVVLVIGAWNYPFNLTIQPMVGAIAAGNAVVLKPSEVSDHMADLLSTLIPQYMDKDLYPVIKGGVPETTELLKEKFDHIMYTGSTAVGKIVMAAAAKHLTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKFMNSGQTCVAPDYILCDPSIQNEIVEKLKKSLKDFYGEDAKQSHDYGRIINDRHFQRVINLIDSK--KVAHGGTWDQPSRYIAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLDEAIKFINQREKPLALYVFSNNDKVIKKMIAETSSGGVTANDVIVHITVPTLPFGGVGNSGMGAYHGKKSFETFSHRRSCLVRSLRNEEANKARYPPSPAK 449          
BLAST of Aldehyde dehydrogenase vs. Ensembl Mouse
Match: Aldh3a1 (aldehyde dehydrogenase family 3, subfamily A1 [Source:MGI Symbol;Acc:MGI:1353451])

HSP 1 Score: 404.06 bits (1037), Expect = 1.486e-135
Identity = 208/440 (47.27%), Postives = 284/440 (64.55%), Query Frame = 3
Query:   99 RQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKK 1418
            R +F SG TR L FR +QL AL  M+ E+ K   + L  +L K+   +   E+     EI + +K +  W  +E V KT  T  D  +I  +P GV L IG WNYP  L + P++G +AAGN VVLKPSE++ +   LL  LIP+Y+D+ +  V  G    T ELLK KFD+I++TG++AV KIV+ AAAKHLTPV LELGGKSP Y+DKD  + +A RRI   K MN+GQTC+APDY+LC  +++   +    +++++FY  DA  S +Y RIIN++H+ R++++I     KVA+GG   +   YIAPTI++    +  +M+ EIFGPV+PI+ V S DEAI+ IN  EKPLA YVFSNN +V+ K   ET+SG +  ND +VH  V  LPFGGVG SGMG+YHGK S ++FSH+R  L +  +    N  RYPP   K
Sbjct:   12 RDAFNSGKTRPLQFRVEQLEALQRMINENLKGISKALASNLRKNEWTSYYEEVAHVLDEIDFTIKGLSDWAEDEPVAKTRQTQEDDLYIHSEPLGVVLVIGAWNYPFNLTIQPMVGAIAAGNAVVLKPSEVSDHMADLLSTLIPQYMDKDLYPVIKGGVPETTELLKEKFDHIMYTGSTAVGKIVMAAAAKHLTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKFMNSGQTCVAPDYILCDPSIQNEIVEKLKKSLKDFYGEDAKQSHDYGRIINDRHFQRVINLIDSK--KVAHGGTWDQPSRYIAPTILVDVDPQSPVMQEEIFGPVMPIVCVRSLDEAIKFINQREKPLALYVFSNNDKVIKKMIAETSSGGVTANDVIVHITVPTLPFGGVGNSGMGAYHGKKSFETFSHRRSCLVRSLRNEEANKARYPPSPAK 449          
BLAST of Aldehyde dehydrogenase vs. UniProt/SwissProt
Match: sp|J3QMK6|AL3B3_MOUSE (Aldehyde dehydrogenase family 3 member B3 OS=Mus musculus OX=10090 GN=Aldh3b3 PE=1 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 1.178e-141
Identity = 215/459 (46.84%), Postives = 301/459 (65.58%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALKSDA 1457
            E L+ L+++F +G T++  FR +QL +L   L+++ K   + L  DL KS  E+ +SE++LC+ E+   LKN+ TW+ +E V    LT     +I+++PFG+ L I  WNYPV L +IPL+G +AAGNCVVLKPSEI+ NTEK+L EL+P+Y+DQ    V LG  + TG+LL+ KFDYI FTG+  V KIV+ AAAKHLTP+ LELGGK+P Y+D +   +  A R+   +  NAGQTC+APDY+LC + ++E  + A   AI  FY  +  TS N  RIIN KH+ RL  ++    G+VA GG   E + YIAPT+++     + +M+ EIFGP+LP++ V S DEAIE +N  EKPLA Y +SNN EV+ +    T+SG    ND  ++  +  LPFGGVG SGMG YHGKFS D+FS++R  L         N LRYPPY+ +++    WA+ S++
Sbjct:   19 EKLQRLKEAFNTGKTKTAKFRAEQLQSLGRFLQDNSKQLHDALDGDLGKSGFESDMSEIILCENEVDLALKNLQTWMKDEPVSTNLLTKLSTAFIRKEPFGLVLIIAPWNYPVNLMIIPLVGAIAAGNCVVLKPSEISKNTEKVLAELLPQYLDQSCFAVMLGGPEETGQLLEHKFDYIFFTGSPRVGKIVMTAAAKHLTPITLELGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYILCSQEMQEQLVPALQNAITRFYGDNPQTSPNLGRIINQKHFKRLQGLLGC--GRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPILPLVTVRSLDEAIEFMNQREKPLALYAYSNNAEVIKQVLARTSSGGFCGNDGFMYMTLSSLPFGGVGSSGMGRYHGKFSFDTFSNQRACLLSCPGMEKLNGLRYPPYSPRRQQLLRWAIGSES 475          
BLAST of Aldehyde dehydrogenase vs. UniProt/SwissProt
Match: sp|Q80VQ0|AL3B1_MOUSE (Aldehyde dehydrogenase family 3 member B1 OS=Mus musculus OX=10090 GN=Aldh3b1 PE=1 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 1.527e-140
Identity = 213/446 (47.76%), Postives = 295/446 (66.14%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKK 1418
            + L+ LR++FK G TRS  FR  QL  L   L ++++   E L +DLHKSA EA++SE+ + + E+   L+N+ +W+ +EKV K   T  D  +I+++PFG+ L I  WNYP+ L L+PL+G +AAGNCVVLKPSEI+  TEK+L E++P+Y+DQ    V LG  + TG+LL+ KFDYI FTGN+ V KIV+ AAAKHLTP+ LELGGK+P Y+D +   ++ A R+   +  NAGQTC+APDY+LC + ++E  + A   AI  FY  +  TS N  RIIN KH+ RL  ++    G+VA GG   E + YIAPT+++     + +M+ EIFGP+LP++ V S DEAIE +N  EKPLA Y FS   +V+ +    T+SG    ND  +H  +  LPFGGVG SGMG YHGKFS D+FS++R  L +       N LRYPPY+ +
Sbjct:    6 DKLQQLREAFKEGRTRSAEFRAAQLQGLSHFLRDNKQQLQEALAQDLHKSAFEAEVSEIAISQAEVDLALRNLRSWMKDEKVSKNLATQLDSAFIRKEPFGLVLIIVPWNYPINLTLVPLVGAIAAGNCVVLKPSEISKATEKILAEVLPRYLDQSCFTVVLGGRQETGQLLEHKFDYIFFTGNAYVGKIVMAAAAKHLTPITLELGGKNPCYVDDNCDPQIVANRVAWFRYFNAGQTCVAPDYILCSQEMQERLVPALQNAITRFYGDNPQTSPNLGRIINQKHFKRLQGLLGC--GRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPILPLVTVRSLDEAIEFMNRREKPLALYAFSKRSQVIKQVLARTSSGGFCGNDGFMHMTLSSLPFGGVGTSGMGRYHGKFSFDTFSNQRACLLRSPGMEKINDLRYPPYSSR 449          
BLAST of Aldehyde dehydrogenase vs. UniProt/SwissProt
Match: sp|P43353|AL3B1_HUMAN (Aldehyde dehydrogenase family 3 member B1 OS=Homo sapiens OX=9606 GN=ALDH3B1 PE=1 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 4.920e-140
Identity = 214/447 (47.87%), Postives = 291/447 (65.10%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKK 1421
            + L  LR++F +G TR   FR  QL  L   L+E+++   + L +DLHKSA E+++SE+ + + E++  L+N+  W+ +E+VPK   T  D  +I+++PFG+ L I  WNYP+ L L+PL+G LAAGNCVVLKPSEI+ N EK+L E++P+YVDQ    V LG  + TG+LL+ +FDYI FTG+  V KIV+ AAAKHLTPV LELGGK+P Y+D +   +  A R+   +  NAGQTC+APDYVLC   ++E  L A    I  FY  D  +S N  RIIN K + RL  ++    G+VA GG   E   YIAPT+++     + +M+ EIFGP+LPI+ V S DEAIE IN  EKPLA Y FSN+ +V+ +   +T+SG    ND  +H  +  LPFGGVG SGMG YHGKFS D+FSH R  L +       N LRYPP + ++
Sbjct:    6 DTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSEISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHLTPVTLELGGKNPCYVDDNCDPQTVANRVAWFRYFNAGQTCVAPDYVLCSPEMQERLLPALQSTITRFYGDDPQSSPNLGRIINQKQFQRLRALLGC--GRVAIGGQSDESDRYIAPTVLVDVQEMEPVMQEEIFGPILPIVNVQSLDEAIEFINRREKPLALYAFSNSSQVVKRVLTQTSSGGFCGNDGFMHMTLASLPFGGVGASGMGRYHGKFSFDTFSHHRACLLRSPGMEKLNALRYPPQSPRR 450          
BLAST of Aldehyde dehydrogenase vs. UniProt/SwissProt
Match: sp|Q5RF60|AL3A2_PONAB (Aldehyde dehydrogenase family 3 member A2 OS=Pongo abelii OX=9601 GN=ALDH3A2 PE=2 SV=1)

HSP 1 Score: 418.313 bits (1074), Expect = 8.142e-140
Identity = 213/450 (47.33%), Postives = 295/450 (65.56%), Query Frame = 3
Query:   96 LRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWAL 1445
            +RQ+F SG +R L FR +QL AL  M++E EKD +  +  DL KS       E++    EI ++L+N+  W+  + V K  LT+ D  +IQ QP GV L IG WNYP  L + PLIG +AAGN V++KPSE++ NT K+L +L+P+Y+DQ +  V  G  + T ELLK +FD+I +TGN+AV KIV+EAAAKHLTPV LELGGKSP Y+DKD  + +  RRI   K MN GQTCIAPDY+LC  +++   +    E ++EFY  +   S +Y RIIN +H+ R++ +++    K+A+GG+  E   YIAPT++     +  +M+ EIFGP+LPI+ V + DEAI  IN  EKPLA YVFS+N +++ +   ET+SG +  ND ++H  +   PFGGVG SGMG+YHGK S D+FSH+R  L K  K    N LRYPP ++ K  W  + L
Sbjct:    8 VRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILAAIAADLCKSEFNVYSQEVITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIKPSELSENTAKMLAKLLPQYLDQDLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQ--KIAFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFMLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFL 455          
BLAST of Aldehyde dehydrogenase vs. UniProt/SwissProt
Match: sp|P51648|AL3A2_HUMAN (Aldehyde dehydrogenase family 3 member A2 OS=Homo sapiens OX=9606 GN=ALDH3A2 PE=1 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 1.044e-139
Identity = 213/450 (47.33%), Postives = 295/450 (65.56%), Query Frame = 3
Query:   96 LRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWAL 1445
            +RQ+F SG +R L FR +QL AL  M++E EKD +  +  DL KS       E++    EI ++L+N+  W+  + V K  LT+ D  +IQ QP GV L IG WNYP  L + PLIG +AAGN V++KPSE++ NT K+L +L+P+Y+DQ +  V  G  + T ELLK +FD+I +TGN+AV KIV+EAAAKHLTPV LELGGKSP Y+DKD  + +  RRI   K MN GQTCIAPDY+LC  +++   +    E ++EFY  +   S +Y RIIN +H+ R++ +++    K+A+GG+  E   YIAPT++     +  +M+ EIFGP+LPI+ V + DEAI  IN  EKPLA YVFS+N +++ +   ET+SG +  ND ++H  +   PFGGVG SGMG+YHGK S D+FSH+R  L K  K    N LRYPP ++ K  W  + L
Sbjct:    8 VRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQEVITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQPLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQ--KIAFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFL 455          
BLAST of Aldehyde dehydrogenase vs. TrEMBL
Match: A0A267EP41 (Aldehyde dehydrogenase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011433g3 PE=3 SV=1)

HSP 1 Score: 448.743 bits (1153), Expect = 5.314e-149
Identity = 223/466 (47.85%), Postives = 314/466 (67.38%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKD---TKEIVNNMLRYPPYNKKKESWADWALKSDAKDSS 1469
            +++  LR +F SG TR L++R+KQL AL+ +L + E    E L +DL K   EA  +ELL+ K +I+ + +++       KV KTF+++ D   +Q+QP+GVAL IG WNYP QL L+PL G +AAGNC ++KPSEIA  +  LL EL+PKY+DQ   RV  G AK T ELL+ +FDYI +TG+S V ++V+ AA+KHLTPV LELGGKSP Y+ + V +   ++R++  K +NAGQTCIAPDYV+C   + +P   A    I EFY  D   S +Y RI++++ + R++ +++ ++   A GGD   D  YIAPT+      +D LM+ EIFGP++PI+ V+  +EA+  IN  EKPLA YVF+++  V  +FE +T+SG+LVFND V+H  ++ LPFGGVG SGMG YHG+F+ D+FSH+R +L K    T E+VNN  RYPPYN  K +W +WAL S  K  S
Sbjct:   38 DSVNALRSTFLSGQTRPLSWRRKQLEALYALLTDQEDRIAEALWQDLRKCRQEAAAAELLILKADIAKLNRDLPQLTDIHKVKKTFISMMDNLGLQQQPYGVALIIGAWNYPFQLTLMPLAGAIAAGNCALVKPSEIASASAALLAELVPKYLDQSCIRVVCGGAKETQELLEQRFDYIFYTGSSRVGRLVMAAASKHLTPVTLELGGKSPVYVSEGVDLGQVSKRLVWGKFLNAGQTCIAPDYVMCPPELAQPLADAVAAQIAEFYGQDPKASPDYGRIVSDRMFDRIVGLMQASKADRATGGDTDRDARYIAPTVYTNVRADDALMREEIFGPLMPIMPVSGVEEAVYFINKCEKPLAIYVFTHDGSVKRRFEEQTSSGALVFNDVVIHAGMETLPFGGVGHSGMGKYHGRFTFDTFSHQRALLYKSSSATSEMVNNKFRYPPYNDSKLAWVNWALSSSVKKGS 503          
BLAST of Aldehyde dehydrogenase vs. TrEMBL
Match: A0A267F0G7 (Aldehyde dehydrogenase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011433g1 PE=3 SV=1)

HSP 1 Score: 447.973 bits (1151), Expect = 1.307e-148
Identity = 223/466 (47.85%), Postives = 313/466 (67.17%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKD---TKEIVNNMLRYPPYNKKKESWADWALKSDAKDSS 1469
            +++  LR +F SG TR L++R+KQL AL+ +L + E    E L +DL K   EA  +ELL+ K +I+ + +++       KV KTF+++ D   +Q+QP+GVAL IG WNYP QL L+PL G +AAGNC ++KPSEIA  +  LL EL+PKY+DQ   RV  G AK T ELL+ +FDYI +TG+S V ++V+ AA+KHLTPV LELGGKSP Y+ + V +   ++R+   K +NAGQTCIAPDYV+C   + +P   A    I EFY  D   S +Y RI++++ + R++ +++ ++   A GGD   D  YIAPT+      +D LM+ EIFGP++PI+ V+  +EA+  IN  EKPLA YVF+++  V  +FE +T+SG+LVFND V+H  ++ LPFGGVG SGMG YHG+F+ D+FSH+R +L K    T E+VNN  RYPPYN  K +W +WAL S  K  S
Sbjct:   38 DSVNALRSTFLSGQTRPLSWRRKQLEALYALLTDQEDRIAEALWQDLRKCRQEAAAAELLILKADIAKLNRDLPQLTDIHKVKKTFISMMDNLGLQQQPYGVALIIGAWNYPFQLTLMPLAGAIAAGNCALVKPSEIASASAALLAELVPKYLDQSCIRVVCGGAKETQELLEQRFDYIFYTGSSRVGRLVMAAASKHLTPVTLELGGKSPVYVSEGVDLGQVSKRLAWGKFLNAGQTCIAPDYVMCPPELAQPLADAVAAQIAEFYGQDPKASPDYGRIVSDRMFDRIVGLMQASKADRATGGDTDRDARYIAPTVYTNVRADDALMREEIFGPLMPIMPVSGVEEAVYFINKCEKPLAIYVFTHDGSVKRRFEEQTSSGALVFNDVVIHAGMETLPFGGVGHSGMGKYHGRFTFDTFSHQRALLYKSSSATSEMVNNKFRYPPYNDSKLAWVNWALSSSVKKGS 503          
BLAST of Aldehyde dehydrogenase vs. TrEMBL
Match: A0A267E1J8 (Aldehyde dehydrogenase OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011433g4 PE=3 SV=1)

HSP 1 Score: 445.662 bits (1145), Expect = 8.714e-148
Identity = 222/466 (47.64%), Postives = 313/466 (67.17%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKD---TKEIVNNMLRYPPYNKKKESWADWALKSDAKDSS 1469
            +++  LR +F SG TR L++R+KQL AL+ +L + E    E L +DL K   EA  +ELL+ K +I+ + +++       KV KTF+++ D   +Q+QP+GVAL IG WNYP QL L+PL G +AAGNC ++KPSEIA  +  LL EL+PKY+DQ   RV  G AK T ELL+ +FDYI +TG+S V ++V+ AA+KHLTPV LELGGKSP Y+ + V +   ++R++  K +NAGQTCIAPDYV+C   + +P   A    I EFY  D   S +Y RI++++ + R++ +++ ++   A GGD   D  YIAPT+      +D LM+ EIFGP++PI+ V+  +EA+  IN  EKPLA YVF+++  V  +FE +T+SG+LVFND V+H  ++ L FGGVG SGMG YHG+F+ D+FSH+R +L K    T E+VNN  RYPPYN  K +W +WAL S  K  S
Sbjct:   38 DSVNALRSTFLSGQTRPLSWRRKQLEALYALLTDQEDRIAEALWQDLRKCRQEAAAAELLILKADIAKLNRDLPQLTDIHKVKKTFISMMDNLGLQQQPYGVALIIGAWNYPFQLTLMPLAGAIAAGNCALVKPSEIASASAALLAELVPKYLDQSCIRVVCGGAKETQELLEQRFDYIFYTGSSRVGRLVMAAASKHLTPVTLELGGKSPVYVSEGVDLGQVSKRLVWGKFLNAGQTCIAPDYVMCPPELAQPLADAVAAQIAEFYGQDPKASPDYGRIVSDRMFDRIVGLMQASKADRATGGDTDRDARYIAPTVYTNVRADDALMREEIFGPLMPIMPVSGVEEAVYFINKCEKPLAIYVFTHDGSVKRRFEEQTSSGALVFNDVVIHAGMETLSFGGVGHSGMGKYHGRFTFDTFSHQRALLYKSSSATSEMVNNKFRYPPYNDSKLAWVNWALSSSVKKGS 503          
BLAST of Aldehyde dehydrogenase vs. TrEMBL
Match: A0A0B7BWN9 (Aldehyde dehydrogenase OS=Arion vulgaris OX=1028688 GN=ORF212602 PE=3 SV=1)

HSP 1 Score: 445.277 bits (1144), Expect = 8.979e-148
Identity = 222/469 (47.33%), Postives = 309/469 (65.88%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALKSDAKDSSGFCSIL 1487
            E ++ LR SF +G TR+  +R  QL A+  ++ E+E    EVL KDLHKS  E+++ E +LC  +   ++ N+  W+  +KV K+ + + D  ++ ++P GV L IG WNYP+QL L+PLIG +AAGNCVV+KPSE++  + K   E++PKY+D+   RV  G    T  LLK +FD I +TGNS V KIV++AAA++LTPV+LELGGKSP Y+DKD  + + ARR+   K  NAGQTCIAPDYV+C   +++  +      I+EFY+ D   SE+Y RI+N+KHY RL  + K+    +A GG+  E   YIAPT++      D +M+ EIFGP+LPI+ +    EAIEIINN EKPLA YVF+NN+ V+  F+  T+SG L+ ND VVH  +  LPFGGVG SG+GSYHGK+S D+FSH + VL+K       N +RYPPY + K  W +W ++   K  +GF S  
Sbjct:    6 ETMKDLRASFATGKTRTYEWRAAQLKAVLKLVHENEDKIAEVLTKDLHKSRIESEIMETILCVNDAVDMINNVQDWMKGQKVSKSSIYIMDTAYVVKEPLGVVLVIGAWNYPIQLVLLPLIGAIAAGNCVVIKPSEVSEASAKFFEEVVPKYLDKDCFRVVNGGVPETTALLKERFDLIFYTGNSFVGKIVMKAAAEYLTPVVLELGGKSPVYVDKDTNLTVVARRLTWGKFCNAGQTCIAPDYVMCAPELQDELVSKIKLVIDEFYTTDPKQSESYGRIVNDKHYQRLQKL-KEEGSVIAIGGEDDEKDKYIAPTVIKDVKFTDKVMQEEIFGPILPIIPIKDHQEAIEIINNREKPLAIYVFTNNKTVVQDFKTRTSSGGLLINDTVVHAGLTSLPFGGVGNSGIGSYHGKYSFDAFSHSKPVLEKSLAIDQVNNVRYPPYTENKRGWINWIMRKKVK-RTGFFSFF 472          
BLAST of Aldehyde dehydrogenase vs. TrEMBL
Match: A0A1I8G7N8 (Aldehyde dehydrogenase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 443.351 bits (1139), Expect = 1.191e-146
Identity = 221/458 (48.25%), Postives = 308/458 (67.25%), Query Frame = 3
Query:  105 SFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKD---TKEIVNNMLRYPPYNKKKESWADWALKSDAKDSS 1469
            +F SG TR L++R+KQL AL+ +L + E    E L +DL K   EA  +ELL+ K +I+ + +++       KV KTF+++ D   +Q+QP+GVAL IG WNYP QL L+PL G +AAGNC ++KPSEIA  +  LL EL+PKY+DQ   RV  G AK T ELL+ +FDYI +TG+S V ++V+ AA+KHLTPV LELGGKSP Y+ + V +   ++R+   K +NAGQTCIAPDYV+C   + +P   A    I EFY  D   S +Y RI++++ + R++ +++ ++   A GGD   D  YIAPT+      +D LM+ EIFGP++PI+ V+  +EA+  IN  EKPLA YVF+++  V  +FE +T+SG+LVFND V+H  ++ LPFGGVG SGMG YHG+F+ D+FSH+R +L K    T E+VNN  RYPPYN  K +W +WAL S  K  S
Sbjct:   57 TFLSGQTRPLSWRRKQLEALYALLTDQEDRIAEALWQDLRKCRQEAAAAELLILKADIAKLNRDLPQLTDIHKVKKTFISMMDNLGLQQQPYGVALIIGAWNYPFQLTLMPLAGAIAAGNCALVKPSEIASASAALLAELVPKYLDQSCIRVVCGGAKETQELLEQRFDYIFYTGSSRVGRLVMAAASKHLTPVTLELGGKSPVYVSEGVDLGQVSKRLAWGKFLNAGQTCIAPDYVMCPPELAQPLADAVAAQIAEFYGQDPKASPDYGRIVSDRMFDRIVGLMQASKADRATGGDTDRDARYIAPTVYTNVRADDALMREEIFGPLMPIMPVSGVEEAVYFINKCEKPLAIYVFTHDGSVKRRFEEQTSSGALVFNDVVIHAGMETLPFGGVGHSGMGKYHGRFTFDTFSHQRALLYKSSSATSEMVNNKFRYPPYNDSKLAWVNWALSSSVKKGS 514          
BLAST of Aldehyde dehydrogenase vs. Ensembl Cavefish
Match: aldh3a2b (fatty aldehyde dehydrogenase-like [Source:NCBI gene;Acc:103043579])

HSP 1 Score: 409.838 bits (1052), Expect = 1.903e-137
Identity = 207/455 (45.49%), Postives = 297/455 (65.27%), Query Frame = 3
Query:   75 KMEALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADW 1439
            + +A+E  R++F +G ++ L +R  QL  L   + E +K+  + L KDLHKS     L E L  + EI+  +  +  W A     K  LTL+D  +IQ +P GV L IG WNYP  + + PL+G +AAGN  V+KPSE+ V+T K++ +L+P Y+D+ +  V +G    T ELLK +FD+I +TGN AV K+++EAAAKHLTPV LELGGKSP Y+DK+  + +A RRI   K  N GQTCIAPDY+LC  ++++  +    +++++FY+ +     +Y RIIN +H+ R+M +I+ +   VA GG+  E Q YIAPT++     +  +M+ EIFGP+LPIL V+S +EAI+ IN  EKPLA Y+F+ + +++ +   ET+SG ++ NDC+VH +V  LPFGGVG SGMGSYHGKFS D  SH RG L K  K    N +RYPP+  KK  WA +
Sbjct:    4 EQKAVERARKAFSTGRSKPLEYRIAQLKNLQRFVTERQKEIADALQKDLHKSEFCTPLHETLGLEGEINLAVSKLAEWAAPRPATKNLLTLSDQVYIQPEPLGVVLIIGAWNYPWAVTIQPLVGAIAAGNAAVIKPSEVCVHTSKVMEDLLPLYIDKEMYPVVVGGVPETQELLKQRFDHIFYTGNCAVGKVIMEAAAKHLTPVTLELGGKSPCYIDKNCDLAVACRRIAWGKYTNCGQTCIAPDYILCDPSIQDRVVKEIRKSVKDFYTENPKNCPDYGRIINQRHFKRVMALIEGS--TVAVGGENDESQCYIAPTVLRDVKPQAKVMQEEIFGPLLPILSVSSVEEAIKFINEREKPLALYIFTQDNKLIQRMIAETSSGGVLANDCLVHFSVSSLPFGGVGNSGMGSYHGKFSFDQLSHLRGCLIKQLKMEGMNQVRYPPHTAKKIGWARF 456          
BLAST of Aldehyde dehydrogenase vs. Ensembl Cavefish
Match: aldh3a2b (fatty aldehyde dehydrogenase-like [Source:NCBI gene;Acc:103043579])

HSP 1 Score: 409.453 bits (1051), Expect = 3.838e-137
Identity = 207/455 (45.49%), Postives = 297/455 (65.27%), Query Frame = 3
Query:   75 KMEALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADW 1439
            + +A+E  R++F +G ++ L +R  QL  L   + E +K+  + L KDLHKS     L E L  + EI+  +  +  W A     K  LTL+D  +IQ +P GV L IG WNYP  + + PL+G +AAGN  V+KPSE+ V+T K++ +L+P Y+D+ +  V +G    T ELLK +FD+I +TGN AV K+++EAAAKHLTPV LELGGKSP Y+DK+  + +A RRI   K  N GQTCIAPDY+LC  ++++  +    +++++FY+ +     +Y RIIN +H+ R+M +I+ +   VA GG+  E Q YIAPT++     +  +M+ EIFGP+LPIL V+S +EAI+ IN  EKPLA Y+F+ + +++ +   ET+SG ++ NDC+VH +V  LPFGGVG SGMGSYHGKFS D  SH RG L K  K    N +RYPP+  KK  WA +
Sbjct:   14 EQKAVERARKAFSTGRSKPLEYRIAQLKNLQRFVTERQKEIADALQKDLHKSEFCTPLHETLGLEGEINLAVSKLAEWAAPRPATKNLLTLSDQVYIQPEPLGVVLIIGAWNYPWAVTIQPLVGAIAAGNAAVIKPSEVCVHTSKVMEDLLPLYIDKEMYPVVVGGVPETQELLKQRFDHIFYTGNCAVGKVIMEAAAKHLTPVTLELGGKSPCYIDKNCDLAVACRRIAWGKYTNCGQTCIAPDYILCDPSIQDRVVKEIRKSVKDFYTENPKNCPDYGRIINQRHFKRVMALIEGS--TVAVGGENDESQCYIAPTVLRDVKPQAKVMQEEIFGPLLPILSVSSVEEAIKFINEREKPLALYIFTQDNKLIQRMIAETSSGGVLANDCLVHFSVSSLPFGGVGNSGMGSYHGKFSFDQLSHLRGCLIKQLKMEGMNQVRYPPHTAKKIGWARF 466          
BLAST of Aldehyde dehydrogenase vs. Ensembl Cavefish
Match: aldh3b1 (aldehyde dehydrogenase family 3 member B1-like [Source:NCBI gene;Acc:103038420])

HSP 1 Score: 401.364 bits (1030), Expect = 2.616e-134
Identity = 210/467 (44.97%), Postives = 306/467 (65.52%), Query Frame = 3
Query:   87 LEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALKSDAKDSSGFCSIL 1487
            +E LR +F+SG+T    FR  QL AL ++LEE+E   +E +HKDL K   EA LSE+ L   ++ + + N+ +W+    V     T  D  +++R+P GV L IG WNYP+QL L+PLIG +AAGNC ++KPSEI+  TEKLL +LIP+Y+ Q    V  G A+ T +LL+ +FD+I +TG+ AVA+ +L+AAA HLTPV LELGGK P  +   + +K AA+R++ +K  NAGQ+C+APDYVLC   +++  L A  +AIE+FY +    S +Y RI+ ++H+ RL+D++ ++ GKV  GG+  +++ Y APT++I     D LM+ EIFGP+LPI+ + S ++ I  IN  EKPLA Y FS+  ++++     T+SG    ND +VH  + GLPFGGVG SGMGSYHG+++ ++FSH+RG + +         LRYPPY +   SW  WA  +  K   G CS+L
Sbjct:    8 IERLRAAFRSGVTIPQHFRLTQLKALLSLLEENETQILEAMHKDLAKPKFEAVLSEIDLVVNDVCFAINNLHSWMQPNYVGTNLATKLDECFVRREPLGVVLIIGAWNYPLQLILLPLIGAIAAGNCALMKPSEISAATEKLLADLIPRYLSQECFAVMCGGAEETKQLLENRFDHIFYTGSQAVARSILQAAAVHLTPVTLELGGKCPCLIYGRLDIKAAAKRLVWAKYFNAGQSCVAPDYVLCTVEMRDALLPAITQAIEQFYGSQIQKSVDYGRIVTDRHWDRLIDLLGKSEGKVVIGGEIDKEEKYFAPTVIIDLQESDALMQEEIFGPILPIITIESLEQGINFINQREKPLALYAFSDEPQIVTTVLERTSSGGFCSNDGIVHMTLPGLPFGGVGASGMGSYHGRWTFETFSHRRGCMFRGWGLERIGALRYPPYKESNLSWLRWATTAK-KKGWGECSVL 473          
BLAST of Aldehyde dehydrogenase vs. Ensembl Cavefish
Match: aldh3a2a (fatty aldehyde dehydrogenase-like [Source:NCBI gene;Acc:103026903])

HSP 1 Score: 398.282 bits (1022), Expect = 5.942e-133
Identity = 204/445 (45.84%), Postives = 291/445 (65.39%), Query Frame = 3
Query:   99 RQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWA 1433
            R++F++G ++ L +R +QL  L   + E +K   + L KDL+KS    K  ELL  + EI+  +  +  W +   V K  LT++D  ++  +P GV L IG WNYP  +   PL+G +AAGN  V+KPSE++ +T K++ EL+P Y+D  +  V  G    T ELLK +FDYI +TGNS V K+++EAAA+HLTPV LELGGKSP Y+DK+  + +A RRI   K +N GQTCIAPDY+LC  ++++  +    + I+EFY+ D  T  +Y RIIN +H+ R+M ++  +  KVA GG+  E Q YIAPT++   + +  +M+ EIFGPVLPI+ VN  +EAI+ IN  EKPLA YVFS++ +V+ +   ET+SG LV NDC++H  +  LPFGGVG SGMG YHGK++ D  SH RG L K       N +RYPP++ +K +WA
Sbjct:   12 RRAFQTGRSKPLDYRIQQLKKLKCFIAEKQKSITDALKKDLNKSENGTKFYELLGLEGEINLAISKLSEWASPRPVDKNLLTISDEVYVLPEPLGVVLIIGAWNYPFAVTFQPLVGAIAAGNAAVIKPSEVSAHTAKVM-ELLPLYLDPEMYPVVTGGVPETQELLKQRFDYIFYTGNSTVGKLIMEAAAQHLTPVTLELGGKSPCYIDKNCDLAVACRRITWGKYVNCGQTCIAPDYILCEPSIQDKVVEEIQKCIKEFYTDDPKTFTDYGRIINQRHFKRIMALLDGS--KVAIGGENDESQCYIAPTVLRDVTPDSKVMQEEIFGPVLPIIPVNGLNEAIQFINEREKPLALYVFSSSNKVIKQMIKETSSGGLVANDCLIHFTLSDLPFGGVGNSGMGHYHGKYTFDQLSHLRGCLIKKLNMERVNQMRYPPHSDRKLNWA 453          
BLAST of Aldehyde dehydrogenase vs. Ensembl Cavefish
Match: aldh3a1 (aldehyde dehydrogenase 3 family, member A1 [Source:ZFIN;Acc:ZDB-GENE-120823-1])

HSP 1 Score: 365.155 bits (936), Expect = 3.548e-120
Identity = 202/461 (43.82%), Postives = 283/461 (61.39%), Query Frame = 3
Query:   75 KMEALEI--LRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALKS 1451
            +ME L +   +++F SG +R L +RK+QL AL  ++ EH+ D    L +DL++S  +  L           + L  +D W + +   K+ +T+ D  +IQ +P GV L IG WNYP  L L PLIG +AAGN  V+KPSE++ N+  LL +L+P Y+D+ +  V  G    T ELL+ +FD+I +TGNS V K+++EAAA+HLTPV LELGGKSP Y+DK+  + +A RRI   K  N GQTCIAPDY+LCH +++   +      + EFY  +  TS +Y RIIN +H+ R++ +++     VA GG   + Q YIAPTI+        +M+ EIFGPVLPI+ ++   EAI  IN  EKPLA YVFS++++V+S+   ETTSG +V ND ++H  V  LPFGGVG SGMG YHGK + D  SH R  L K       N  RYPP    +   A + + S
Sbjct:    5 EMEKLAVDEAQKAFSSGRSRPLQYRKQQLRALLRLITEHQADIAAALKQDLNRSEFDTPL-----------FELIGLDDWASPQPARKSLVTINDDVYIQAEPLGVVLIIGAWNYPWALTLQPLIGAIAAGNAAVVKPSELSQNSSSLLKQLLPHYLDKEMYPVVTGGVPETQELLRQRFDHIFYTGNSTVGKLIMEAAARHLTPVTLELGGKSPCYIDKNCDIAVACRRITWGKFANCGQTCIAPDYILCHPSIQNKVIEELRLTLLEFYGEEPQTSPDYGRIINQRHFERVLTLMEGC--TVAVGGGSDKTQCYIAPTILRDVLPHARIMQEEIFGPVLPIISISDVSEAIHFINEREKPLALYVFSSDKKVISRMLNETTSGGVVVNDVMMHYTVTSLPFGGVGNSGMGRYHGKHTFDQLSHHRACLIKSLAMESLNKARYPPLTPSRLRRAKFFMTS 452          
BLAST of Aldehyde dehydrogenase vs. Ensembl Sea Lamprey
Match: aldh3a1 (aldehyde dehydrogenase 3 family, member A1 [Source:ZFIN;Acc:ZDB-GENE-120823-1])

HSP 1 Score: 419.468 bits (1077), Expect = 6.931e-142
Identity = 214/455 (47.03%), Postives = 306/455 (67.25%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWAL 1445
            E +   RQ+F++G +R +AFR++QL AL  ++EE+EK+  + L++DLHK   E  L EL+  K ++++I+ N+  W+  + V ++ +TL D  +I+ QP GV L +G WNYP  L   PL G +AAGN  V+KPSE++ NT KLL +L P+Y+D+ + +V LG    T ELLK +FD+I +TG   VA+IV+ AAA HLTPVLLELGGKSP ++ +D  +++AARRI   + +N+GQTCIAPDYVLC  +V+EP + A    ++E+Y  D   S +Y RI+N +H+ R+  ++     KVA GG+  E +LYIAPT++         M+ EIFGP+LPI+ VN  D+AI  IN+ EKPLA YVF+ +++V+ +   ET+SG    ND + + AV+G+PFGGVG SGMGSYHGK S +SFSH R V  +       N +RYPPY+ KK SW  WA+
Sbjct:    3 EVVSRARQAFRTGRSRDIAFREEQLRALNQLMEENEKELCQSLYEDLHKCKFEVILHELVPAKNDMAFIVSNLREWMKPQPVSRSLITLADTVYIEPQPLGVCLIMGAWNYPGGLVFQPLAGAIAAGNAAVIKPSELSENTAKLLAKLFPRYLDKDMYQVVLGGPAETTELLKQRFDHIFYTGGPTVARIVMAAAAPHLTPVLLELGGKSPCFVHRDSNLQLAARRITWGRFINSGQTCIAPDYVLCEPSVQEPLVEAIRVTLKEYYGEDPKKSLDYGRIVNKRHFDRVKGLM--AGAKVAIGGETDEAELYIAPTVLTDVDASSAAMQEEIFGPILPIMTVNGVDDAITFINDREKPLAIYVFALDKQVVKRLVDETSSGGFTSNDTLFNYAVEGMPFGGVGNSGMGSYHGKHSFNSFSHMRAVGLRGQSMESANTIRYPPYSDKKLSWCQWAI 455          
BLAST of Aldehyde dehydrogenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004609.1 (pep scaffold:Pmarinus_7.0:GL479321:13801:23388:1 gene:ENSPMAG00000004155.1 transcript:ENSPMAT00000004609.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.939 bits (302), Expect = 2.152e-29
Identity = 96/347 (27.67%), Postives = 162/347 (46.69%), Query Frame = 3
Query:  360 WIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKY-VDQGVCRVELGDAKRTGELLKLKFDY--IVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADAST-SENYPRIINNKHYHRLMDMIK---QTRGKVAYGGDG--KED-----QLYIAPTIVILDSVEDI-LMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGV 1355
            + +R+P GV + IG WN+P Q+        LA GN +V KPS +   T   L E+  +  +  G+  +  GD + TG+LL    D   +  TG+      VL+  A  + PV LELGGKSP  +  D  +  A +  +    ++ GQ C     V   R+V E FL   ++ +      D    S     +I+  H  R++  ++   Q   K+  GG     ED       ++ P  V+ +  +D+  ++ EIFGPV+ +L  ++E+E ++  N  +  LA  VF+ +     +      +GS   N+   +  +  +PFGG   SG G  +G  ++D ++  + V
Sbjct:  172 YSRREPLGVCVGIGAWNFPFQIACWKSAPALACGNAMVFKPSPLTPLTAVALAEIYTEAGLPPGLFNIVQGDGE-TGQLLCSHNDVAKVSCTGSVGTGVKVLQQTAPRIKPVTLELGGKSPLIVFSDCDLDNAVKAALMGNFLSQGQVCSNATRVFVQRSVCERFLERLLDRVSAIRIGDPQRDSTTMGALISQSHLDRVLAYVQRAVQEGAKLVCGGKKYVPEDPSLKGGFFMTP-CVLAECRDDMQAVREEIFGPVMAVLAFDTEEEVLQRANATDFGLAAGVFTKDLTRAHRVIAALQAGSCYINN--YNVVLMEMPFGGYKMSGFGRENGMATVDYYTQLKTV 514          
BLAST of Aldehyde dehydrogenase vs. Ensembl Sea Lamprey
Match: aldh5a1 (aldehyde dehydrogenase 5 family, member A1 (succinate-semialdehyde dehydrogenase) [Source:ZFIN;Acc:ZDB-GENE-070228-2])

HSP 1 Score: 110.153 bits (274), Expect = 2.782e-26
Identity = 93/339 (27.43%), Postives = 153/339 (45.13%), Query Frame = 3
Query:  372 QPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQG-------VCRVELGDAKRTGELL--KLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEE--FYSADASTSENYPRIIN----NKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSH 1343
            QP GVA  I  WN+PV +    +   LAAG   V+KP+E   +T    L L    V+ G       V      +    GELL        I FTG++A  K+++  A   +  V +ELGG +P  + +   +  A R +++SK   +GQTC+ P+ +L   +V + F+     A+         A T      +IN     K    ++D + Q    V  G        +  PT++   +   +  + E FGP+ PI+   +E+EAI + N+    LA Y FS +   + +       G +  N+ ++  AV+  PFGG+ +SG+G    +  +  + H
Sbjct:   76 QPVGVAAMITPWNFPVAMITRKVGAALAAGCTAVVKPAE---DTPLSALALAQLAVEAGLPPGVLNVVPCSRANVAAVGELLCTHPSVSKISFTGSTATGKVLMAHAVGTVKRVSMELGGHAPFIVFESADLDAAVRGLLSSKFRFSGQTCVCPNRMLVQESVHDAFVSRLAHAVSTQLRVGPGADTGNTLGPLINEHALEKVERHVVDAVSQGARVVVGGARHALGGSFFQPTVLADVTPNMLCAREETFGPLAPIIKFKTEEEAIALANSTAMGLAGYFFSRDVAQVWRVSEALEVGMVGANEGLL-SAVEA-PFGGIKQSGLGREGAQQGMLEYMH 409          
BLAST of Aldehyde dehydrogenase vs. Ensembl Sea Lamprey
Match: aldh1l2 (aldehyde dehydrogenase 1 family, member L2 [Source:ZFIN;Acc:ZDB-GENE-100426-6])

HSP 1 Score: 95.5153 bits (236), Expect = 6.833e-21
Identity = 103/426 (24.18%), Postives = 184/426 (43.19%), Query Frame = 3
Query:  141 RKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMD-----TWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKY-VDQGVCRVELGD-----AKRTGELLKLKFDYIVFTGNSAVAKIVLEA-AAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADA-STSENYPRIINNKHYHRLMDM----IKQTRGKVAYGGDGKEDQLYIAPTIVILDSVED--ILMKSEIFGPVLPI--LIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGV 1355
            R + L  L  ++EEH+++   +   D       A  + + +  Q   Y     D     T   N+  P   LT T     +R+P GV   +  WNYP+ +        LAAGN +VLKP+++   T     EL  K    +GV  +  G       +R  E   ++   + FTG++ + K ++++ A  +L  V LELGGKSP  +  D  +  A R  +++   N G+ CIA   +    ++ + ++   +E I++    D    S ++    +  H  +L++     +K+    V  G      +++  P+  +   VED   + + E FGP++ I        D  +   NN E  LA  VF+ +         +  +G++  N    +      PFGG  +SG G   G+ +++ +   + V
Sbjct:  273 RGRLLYKLADLMEEHQEELATIETLDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIHGTTIPINQARPNRNLTFT-----KREPIGVCGIVIPWNYPLMMLAWKSAACLAAGNTLVLKPAQVTPLTALKFAELAAKAGFPKGVINIIPGSVGSIVGQRMSEHPHIR--KLGFTGSTPIGKQIMKSCATSNLKKVSLELGGKSPLIIFNDCDIDKAVRMGMSAVFFNKGENCIAAGRLFVEESIHDEYVRRVVEEIKKMKVGDPLDRSTDHGPQNHRAHMEKLVEYCEVGVKEGATLVHGGRQVPRPEVFANPS--VFTGVEDHMYIAQEESFGPIMVISKFPDGDIDGVLARANNTEFGLASGVFTRDISKALYVSDQLEAGTVFIN--TYNKTDVAAPFGGFKQSGFGKDLGEEALNEYLRTKAV 687          
BLAST of Aldehyde dehydrogenase vs. Ensembl Sea Lamprey
Match: aldh8a1 (aldehyde dehydrogenase 8 family, member A1 [Source:NCBI gene;Acc:447801])

HSP 1 Score: 89.3521 bits (220), Expect = 3.345e-19
Identity = 95/340 (27.94%), Postives = 150/340 (44.12%), Query Frame = 3
Query:  369 RQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPK-YVDQGVCRVELGDAKRTGELLKLKFDY--IVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMN-AGQTCIAPDYVLCHRAVKE-PFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIK--QTRGKVAYGGDGKEDQL---------YIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFS 1340
            R P GV   I  WN P+ L    +   +A GN VV KPSE+   T  +L  L+ +  V  GV  V LG  ++ G  L    D   I FTG++A A  +   +A H   + LELGGK+P  +  D  +       + S   N  G    +   +  H  V + P          +    D  TS   P +I+ +H  ++   ++  +  G     G+G +  L         ++APT++     +   M+ EIFGPV+ +     EDEA+   N     LA  V+S +   + +      +G +V+ +C +   +  LPFGG+  SG+G    K S + F+
Sbjct:  142 RSPVGVVGLISPWNLPLYLLTWKIAPAIALGNTVVAKPSELTSVTAWMLCMLLREAGVPPGVVNVVLGTGQKAGAALVGHPDVPAISFTGSTATACDITVRSALHCKRLSLELGGKNPAVIFADADLDACVATTVRSSFANQTGHVPSSLSAIFSHSVVVQCPRRFFRTTKAWKVGPPDDFTSNMGP-LISKEHLAKVRGYVELAERDGGQVLCGEGVDPLLLPPRCQGGYFLAPTVITGVPDDSPAMQEEIFGPVVCVSPFEDEDEAVTRSNGVRYGLAAVVWSRDVARVHRVAKRLQAG-IVWTNCWLIRELN-LPFGGMKASGIGREGAKDSFEFFT 478          
BLAST of Aldehyde dehydrogenase vs. Ensembl Yeast
Match: HFD1 (Dehydrogenase involved in ubiquinone and sphingolipid metabolism; oxidizes 4-hydroxybenzaldehyde into 4-hydroxybenzoic acid in ubiquinone biosynthesis; converts hexadecenal to hexadecenoic acid in sphingosine 1-phosphate breakdown pathway; located in the mitochondrial outer membrane and also in lipid particles; human homolog ALDH3A2, a fatty aldehyde dehydrogenase (FALDH) mutated in neurocutaneous disorder Sjogren-Larsson syndrome, can complement yeast hfd1 mutant [Source:SGD;Acc:S000004716])

HSP 1 Score: 206.068 bits (523), Expect = 1.120e-59
Identity = 154/458 (33.62%), Postives = 244/458 (53.28%), Query Frame = 3
Query:  126 RSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKV----PKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKY-VDQGVCRVELGDAKRTGELLKL-KFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVV---MKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFY-SADASTSENYPRIINNKHYHRLMDMIKQTRG------KVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAI-EIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALK 1448
            + L FR+ QL  L+  +++HE++ I+ ++KD H++  E+ L+E      +I ++++ +   +   +V    P      T    I R   G  L I  +N+P+ L   PL   LAAGN +VLKPSE+  +T  ++  L+       G+ +V  G    T  LL   KFD I +TG+  V  IV E AAK LTP +LELGGKSPT++ ++     +K+A +RI      N+GQ C++PDY+L H+++    +      + EFY S D  T  ++ R+I+   Y + +  I  T G      K++   D  ED   + PTIV     +D LMK E F PVLPI+     DE I +II   + PL +Y+FS+++  +++      SG  V  D V+H  +   PFGG+G SG G+Y G +  ++FSH+R +  +         +RYPP + +KE    +A++
Sbjct:   44 KDLEFRQLQLKKLYYAVKDHEEELIDAMYKDFHRNKIESVLNETTKLMNDILHLIEILPKLIKPRRVSDSSPPFMFGKTIVEKISR---GSVLIIAPFNFPLLLAFAPLAAALAAGNTIVLKPSELTPHTAVVMENLLTTAGFPDGLIQVVQGAIDETTRLLDCGKFDLIFYTGSPRVGSIVAEKAAKSLTPCVLELGGKSPTFITENFKASNIKIALKRIFFGAFGNSGQICVSPDYLLVHKSIYPKVIKECESVLNEFYPSFDEQT--DFTRMIHEPAYKKAVASINSTNGSKIVPSKISINSD-TEDLCLVPPTIVYNIGWDDPLMKQENFAPVLPIIEYEDLDETINKIIEEHDTPLVQYIFSDSQTEINRILTRLRSGDCVVGDTVIHVGITDAPFGGIGTSGYGNYGGYYGFNTFSHERTIFKQPYWNDFTLFMRYPPNSAQKEKLVRFAME 495          
BLAST of Aldehyde dehydrogenase vs. Ensembl Yeast
Match: ALD2 (Cytoplasmic aldehyde dehydrogenase; involved in ethanol oxidation and beta-alanine biosynthesis; uses NAD+ as the preferred coenzyme; expression is stress induced and glucose repressed; very similar to Ald3p [Source:SGD;Acc:S000004780])

HSP 1 Score: 124.405 bits (311), Expect = 7.392e-31
Identity = 121/451 (26.83%), Postives = 197/451 (43.68%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHK-DLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLL---ELIPKY-VDQGVCRVELGDAKRTGELLK--LKFDYIVFTGNSAVAKIVLEAAAK-HLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYP---------RIINNKHYHRLMDMIKQTRGKVAYGGD---------GKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGV 1355
            +A++  R +F +  +++ + ++   ++    L E E+D +  L   D  K        +L    Q   Y   + D +     +P   LT     +  + PFGV   I  WNYP+ +    L G LAAGN V++KP+E   NT   LL    LI K     GV  +  G     G+ L   +  D I FTG++ V   VLEA+ + +L  V LE GGKSP  + +D  +  A   I A    N+GQ C A   V    ++ + F    +E  +E    +   +  +           +I++  Y R+   I+  RGK     D         G     +I PTI         L++ EIFGPV+ +    + D+A+++ N+    LA  VF+ + +    F  +  +G++  N          +PFGG   SG+G   G+  +D++   + V
Sbjct:   62 KAVKAARAAFDNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPYHSNAKGDLAQILQLTRYFAGSADKFDKGATIP---LTFNKFAYTLKVPFGVVAQIVPWNYPLAMACWKLQGALAAGNTVIIKPAE---NTSLSLLYFATLIKKAGFPPGVVNIVPGYGSLVGQALASHMDIDKISFTGSTKVGGFVLEASGQSNLKDVTLECGGKSPALVFEDADLDKAIDWIAAGIFYNSGQNCTANSRVYVQSSIYDKF----VEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIE--RGKREEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPQTSKLLQDEIFGPVVVVSKFTNYDDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINSSNDEDVT--VPFGGFKMSGIGRELGQSGVDTYLQTKAV 498          
BLAST of Aldehyde dehydrogenase vs. Ensembl Yeast
Match: ALD4 (Mitochondrial aldehyde dehydrogenase; required for growth on ethanol and conversion of acetaldehyde to acetate; phosphorylated; activity is K+ dependent; utilizes NADP+ or NAD+ equally as coenzymes; expression is glucose repressed; can substitute for cytosolic NADP-dependent aldehyde dehydrogenase when directed to the cytosol; human homolog ALDH2 can complement yeast ald4 mutant [Source:SGD;Acc:S000005901])

HSP 1 Score: 122.479 bits (306), Expect = 3.634e-30
Identity = 106/348 (30.46%), Postives = 165/348 (47.41%), Query Frame = 3
Query:  348 TDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQ-----GVCRVELGDAKRTGELLK--LKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFL---CAAIEAIEEFYSADASTSE--NYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDI-LMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSL---VFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSH 1343
            T  ++ +RQP GV   I  WN+P+ +    +   L  GN VVLK +E    +  L    + KY+ Q     GV  +  G  K  GE +    K   + FTG++A  + + ++AA  L  V LELGGKSP  +  D  +K A + II     N+G+ C A   V    ++ + F+    AA E+I+     D ST +     ++  NK   + +D+ K     +  GG+    + Y     V  D  ED+ ++K EIFGPV+ +    S DE I + N+ E  LA  + ++N     K      +G++    +ND   H AV   PFGG   SG+G    + S+D+  +
Sbjct:  172 THFSYTKRQPLGVCGQIIPWNFPLLMWAWKIAPALVTGNTVVLKTAE----STPLSALYVSKYIPQAGIPPGVINIVSGFGKIVGEAITNHPKIKKVAFTGSTATGRHIYQSAAAGLKKVTLELGGKSPNIVFADAELKKAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASESIKVGDPFDESTFQGAQTSQMQLNK-ILKYVDIGKNEGATLITGGERLGSKGYFIKPTVFGDVKEDMRIVKEEIFGPVVTVTKFKSADEVINMANDSEYGLAAGIHTSNINTALKVADRVNAGTVWINTYND--FHHAV---PFGGFNASGLGR---EMSVDALQN 506          
BLAST of Aldehyde dehydrogenase vs. Ensembl Yeast
Match: ALD5 (Mitochondrial aldehyde dehydrogenase; involved in regulation or biosynthesis of electron transport chain components and acetate formation; activated by K+; utilizes NADP+ as the preferred coenzyme; constitutively expressed [Source:SGD;Acc:S000000875])

HSP 1 Score: 122.479 bits (306), Expect = 4.214e-30
Identity = 90/341 (26.39%), Postives = 158/341 (46.33%), Query Frame = 3
Query:  357 TWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKY-VDQGVCRVELGDAKRTGELLKLKFDY--IVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRI-INNKHYHRLMDMI---KQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDI-LMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGV 1355
            T+  ++P GV   I  WN+P+ +    +   LA GN VVLKP+E    +     +L  +  +  GV  +  G  +  GE L    D   I FTG++A  + +++ AA  +  V LELGGKSP  +  D  +  A + I      N+G+ C A   +     V E  L    +  E     D    E +     ++K  H+++D +   K    ++  GG     + Y     V  D  ED+ ++K E+FGP++ +   ++ DE I + N+ +  LA  + +N+            +G++  N    +   + +PFGG G+SG+G   G+ ++ +++  + V
Sbjct:  173 TYSIKEPLGVCGQIIPWNFPLLMWSWKIGPALATGNTVVLKPAETTPLSALFASQLCQEAGIPAGVVNILPGSGRVVGERLSAHPDVKKIAFTGSTATGRHIMKVAADTVKKVTLELGGKSPNIVFADADLDKAVKNIAFGIFYNSGEVCCAGSRIYIQDTVYEEVLQKLKDYTESLKVGDPFDEEVFQGAQTSDKQLHKILDYVDVAKSEGARLVTGGARHGSKGYFVKPTVFADVKEDMRIVKEEVFGPIVTVSKFSTVDEVIAMANDSQYGLAAGIHTNDINKAVDVSKRVKAGTVWIN--TYNNFHQNVPFGGFGQSGIGREMGEAALSNYTQTKSV 511          
BLAST of Aldehyde dehydrogenase vs. Ensembl Yeast
Match: ALD3 (Cytoplasmic aldehyde dehydrogenase; involved in beta-alanine synthesis; uses NAD+ as the preferred coenzyme; very similar to Ald2p; expression is induced by stress and repressed by glucose [Source:SGD;Acc:S000004779])

HSP 1 Score: 119.013 bits (297), Expect = 4.674e-29
Identity = 108/383 (28.20%), Postives = 169/383 (44.13%), Query Frame = 3
Query:  282 YILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLL---ELIPKY-VDQGVCRVELGDAKRTGELL--KLKFDYIVFTGNSAVAKIVLEAAAK-HLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYP---------RIINNKHYHRLMDMIKQTRGKVAYGGD---------GKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGV 1355
            Y    +D +   E +P   LT     +  + PFGV   I  WNYP+ +    + G LAAGN V++KP+E   NT   LL    LI K     GV  V  G     G+ L   +  D I FTG++ V   VLEA+ + +L  + LE GGKSP  + +D  +  A   +      N+GQ C A   V    ++ + F    +E  +E    +   +  +           +I++  Y R+   I+  RGK     D         G     +I PTI         L++ EIFGPV+ +    + D+A+++ N+    LA  VF+ + +    F  +  +G++  N      A   +PFGG   SG+G   G   +D++   + V
Sbjct:  130 YYAGAVDKFNMGETIP---LTFNKFAYTLKVPFGVVAQIVPWNYPLAMACRKMQGALAAGNTVIIKPAE---NTSLSLLYFATLIKKAGFPPGVVNVIPGYGSVVGKALGTHMDIDKISFTGSTKVGGSVLEASGQSNLKDITLECGGKSPALVFEDADLDKAIEWVANGIFFNSGQICTANSRVYVQSSIYDKF----VEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSYIE--RGKKEEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPETSKLLRDEIFGPVVVVSKFTNYDDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINQTNQEEA--KVPFGGFKMSGIGRESGDTGVDNYLQIKSV 498          
BLAST of Aldehyde dehydrogenase vs. Ensembl Nematostella
Match: EDO37493 (Aldehyde dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7SFM8])

HSP 1 Score: 390.578 bits (1002), Expect = 2.379e-130
Identity = 206/444 (46.40%), Postives = 289/444 (65.09%), Query Frame = 3
Query:   99 RQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESW 1430
            R  F+SG TR   FR++QL  +  +L++HE + +  L KDL K   E  ++E+LL K +    L+ +  W+  + V    +   D  +I+ +P GVAL I  WNYPVQL  +PL+G +A GNC VLKPSE+A  T +L+ +L+PKY+D     V  G    T +LL  KFD I +TG SAV K+V+ AAAK+LT V LELGGKSP Y+D+D  MK  ARRI   K  N+GQTC+APDYVLC+  ++  F+ +  E + EFY  D   S +Y RI+N+KHY+RL  ++  TRG +  GGD  + + YI+PTI+      D +M++EIFGP+LPI+ V+S D+AI+ IN+ +KPLA Y+FSN +E + + +  T+SG    ND V+H A++ LPFGGVG SGMG+YHGK S ++F+HK+G + K       N +RYPPY +K  SW
Sbjct:   16 RDEFRSGKTREYEFRRQQLKNMVQLLDKHEDEIVAALKKDLCKPRQETVIAEILLAKNDAILALEKLSEWMKPQPVETGIVNKMDTCYIKNEPLGVALIISAWNYPVQLIFLPLVGAIAGGNCAVLKPSEVASATAQLVADLVPKYLDPDCYPVVNGGVPETQQLLNQKFDKIFYTGGSAVGKLVMAAAAKNLTRVTLELGGKSPCYIDEDCDMKTVARRICWGKFTNSGQTCVAPDYVLCNPGIQSKFIKSMKETLYEFYGEDPHDSADYGRIVNDKHYNRLKALL--TRGTIVLGGDTDDKERYISPTILTGVKPSDPVMENEIFGPILPIVSVDSLDDAIDFINDRDKPLALYIFSNKQESIKRIQENTSSGGFCANDVVIHAALETLPFGGVGGSGMGAYHGKHSFEAFTHKKGCMVKKLSMEAMNSIRYPPYKEKNLSW 457          
BLAST of Aldehyde dehydrogenase vs. Ensembl Nematostella
Match: EDO29328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3Y4])

HSP 1 Score: 124.79 bits (312), Expect = 4.947e-31
Identity = 98/342 (28.65%), Postives = 168/342 (49.12%), Query Frame = 3
Query:  363 IQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLEL-IPKYVDQGVCRVELGDAKRTGELLKLKFDY--IVFTGNSAVAKIVLEAAAK-HLTPVLLELGGKSPTYLDKDVV-MKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADA-STSENYPRIINNKHYHRLMDMIKQTRGKVAY---GG-----DGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFN--DCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFS 1340
            I R+P GV  ++  WN+P+ L    L   LAAGN VVLKP+E +  +   L +L +   +  GV  V  G  +  G+ L L  D   + FTG++ V K  +  AA+ +L  V LE GGKS   +  D   + +AA +   +   N G+ C A   +L  R++ + F+   +   +++   D  + +     I++ +   R+M  I + + + A    GG     +G +   +I PTI    S +  L + E+FGPVL ++  +SE+EA+ + NN +  LA  +++++     +      +G++  N  D +  C    +PFGG  +SG G      + D +S
Sbjct:   59 ITREPLGVIGAVVPWNFPLDLAAWKLAPALAAGNSVVLKPAEQSPFSALRLGQLALEAGLPPGVLNVVPGMGETAGKALGLHMDVDCLAFTGSTEVGKYFMAYAAQSNLKQVWLECGGKSANLVFADCQDLDLAAEKAAFAIFFNQGEVCSANSRLLVERSIHDEFVQCLVAKAQQWLPGDPLNPASGAGAIVDARQAERIMGFIDRAQSQGATLVCGGQRLSINGSDS--FIQPTIFTNVSPDMQLAQEEVFGPVLAVIPFDSEEEAVRLANNSQYGLAASLWTDDLNRAHRVAKRLRAGTVSVNTVDALDVC----VPFGGCKQSGFGRDLSLHAFDKYS 394          
BLAST of Aldehyde dehydrogenase vs. Ensembl Nematostella
Match: EDO45538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSB4])

HSP 1 Score: 125.561 bits (314), Expect = 8.319e-31
Identity = 96/332 (28.92%), Postives = 153/332 (46.08%), Query Frame = 3
Query:  360 WIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKY-VDQGVCRVELGDAKRTGELLK--LKFDYIVFTGNSAVAKIVLEAAAK-HLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMI---KQTRGKVAYGGDGKEDQ-LYIAPTIVILDSVEDI-LMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSI 1328
            + + +P G+  +I  WN+P+ +  + +   LA GN V+LKP+E    T      L+ +     GV  V  G     G  +   L  D + FTG++ V +++ EA+AK +L  + LELGGKSP  +  D  M  A      +   N GQ C A         + + F+  +++  +     D   S      I+ + + ++MD+I   K+   K+  GG    ++  +I PT V  D  +D+ + K EIFGPV  ++   S DE IE  NN    LA  VF+ N +          +G++  N     C     PFGG   SG G   G++ +
Sbjct:  148 YTRHEPVGLVGAITPWNFPLNMASVKIAPALACGNVVILKPAEQTPLTALYFCALVKEAGFPAGVVNVIPGYGPTAGAAITTHLDIDKVSFTGSTEVGRLIQEASAKSNLKRLTLELGGKSPNIVFADSDMDYAVEMAHEALFFNQGQCCSAGSRTFVQDTIYDEFVKKSVKRAKARTVGDPFDSVEQGPQIDQEQFDKIMDLIESGKKEGAKMQCGGARHGNKGFFIQPT-VFSDVTDDMRIAKEEIFGPVQQLIKFKSVDEVIERANNTTYGLAAGVFTKNIDTAIAVSSGLRAGTVWIN--CYECGAPQAPFGGYKMSGYGREWGEYGV 476          
BLAST of Aldehyde dehydrogenase vs. Ensembl Nematostella
Match: EDO34362 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPJ4])

HSP 1 Score: 121.709 bits (304), Expect = 1.161e-29
Identity = 92/345 (26.67%), Postives = 159/345 (46.09%), Query Frame = 3
Query:  360 WIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIA-VNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDY--IVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADA-STSENYPRIINNKHYHRLMDMI---KQTRGKVAYGGDGKE------DQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGV 1355
            + +R+P GV   IG WNYP+Q     +   +A GN +V KPS +  +N   L   L    V  GV  +  G  + TGE+L    +   + FTG+    + ++ + A  +  V LELGGKSP  + KD  M  A    + +  ++ GQ C     V    ++K+ FL   +E  +     D  +       +I++ H ++++D +   K    KV  GG+            Y++P ++   + +  ++K EIFGPV+ +L   +E+EA+   NN    LA  +F+ +     +      +G+   N    +     +PFGG   SG G   G  +++ ++  + V
Sbjct:  113 YTRREPLGVVGGIGAWNYPIQTACWKIAPAIACGNTIVYKPSPLTPMNAVALADILTEAGVPPGVVNIIQGGGE-TGEMLSKDPNVAKVSFTGSVPTGQKIMASCADGIKHVTLELGGKSPLIIFKDADMANAVSGALMANFLSQGQVCSNGTRVFVEDSIKDEFLEKVVERTKNIRVGDPMAPDTQMGAMISSAHLNKVLDYVQIGKDEGAKVLCGGERLHLPEPLTSGYYMSPCVMAECTDDMTVVKEEIFGPVMTVLTFQTEEEAVTRANNTTFGLAGGIFTRDLNRAHRVIGSLQAGTCWINS--FNITPVEVPFGGYKMSGFGREGGTAAVEHYTQLKTV 454          
BLAST of Aldehyde dehydrogenase vs. Ensembl Nematostella
Match: EDO46151 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQR3])

HSP 1 Score: 108.612 bits (270), Expect = 1.229e-24
Identity = 110/440 (25.00%), Postives = 195/440 (44.32%), Query Frame = 3
Query:   81 EALEILRQSFKSGITRSLAFRKKQLIA--LFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMD-----TWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKY-VDQGVCRVELGDAKRTGELLKLKFDY--IVFTGNSAVAKIVLEA-AAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADA-STSENYPRIINNKHYHRLMDMIK---QTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILM-KSEIFGPVLPILIVNSED--EAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVK---GLPFGGVGKSGMGSYHGKFSIDSF 1337
            +A++  +++F +G   S+  R +  +   L  ++E+H+++   +   D       A  + + +    + Y     D     T   N   P   L  T     +R+P GV   I  WNYP+ +    +  LLAAGN VVLKP+++   T     EL  +    +GV  +  G     G  +    D   + FTG++ V K ++E+ A  +L    LELGGKSP  +  D  M+ A R+ + + L N G+ CIA   +    ++ + F+   ++ +++    D   T+ ++    +  H   L++ +K   +   K+ YGG   +   +     V  +  +D+ + K E FGPV+ I   +  D    +E  N  E  LA  VF+ +     +      +G+     C V+   K     PFGG  +SG G   G  +++ +
Sbjct:  435 DAVDAAKEAFYNGPWGSMNARDRATLMNRLADLMEQHKEELATIESLDSGAVYTLALKTHVGMSIDTVRYFAGWCDKIQGLTVPVNNAKPNRNLCYT-----KREPIGVCGLIVPWNYPLMMLAWKISPLLAAGNTVVLKPAQVTPMTALKFAELAARAGFPKGVINILPGSGSVVGNRICEHPDVRKLGFTGSTPVGKAIMESCATSNLKKCSLELGGKSPLIIFSDCDMERAVRQGMMACLFNKGENCIAAGRLFVEESIHDEFVNRLVDELKKLKIGDPLDTATDHGPQNHKAHLDSLVEYVKRGVEEGAKLVYGGRHLDRPGFFFEPAVFTNVEDDMFIAKEESFGPVVIISKFDDGDVEGVLESANGTEYGLASGVFTKDMSKALRVADALEAGT-----CFVNTYNKTDVAAPFGGCKQSGFGKDLGMEALNEY 864          
BLAST of Aldehyde dehydrogenase vs. Ensembl Medaka
Match: aldh3b1 (aldehyde dehydrogenase 3 family member B1 [Source:NCBI gene;Acc:101158531])

HSP 1 Score: 387.497 bits (994), Expect = 6.502e-129
Identity = 204/464 (43.97%), Postives = 295/464 (63.58%), Query Frame = 3
Query:   96 LRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALKSDAKDSSGFCSIL 1487
            LR +F+SG+T    FR+ QL  L +M++++E    + LH+DL K   EA LSE+ +   E+ + + N+  W+  E V K+  T  D  +I+R+P GV L IG WNYP+QL ++PLI  +AAGNCVV+KPSE++  TE L+ ELIPKY+ Q    V  G A+ T  LL+ +FD I +TG+ AVA+ V++AA+ HLTPV LELGGK P  +   + +  AARR++ +K  NAGQ+C+APDY+LC +A+++  + A  E +EEFY  +   S +  RI++++H+ RLM+++K+T G V  GG+   +  YIAPT+V+    +D LM  EIFGP+LPIL V + +E I+ IN  EKPLA YVFS+   V+      T+SG    ND ++H  +  LPFGGVG SG GSYHG++  + FSH+R  + +       N LRYPPY+ +K  W  W     +      CSI+
Sbjct:   20 LRATFRSGVTVPEEFRRTQLTGLMSMIKDNEDQITDALHRDLAKPKFEAVLSEIEIVLNELYHSISNLARWMQPEYVSKSLATKLDDCFIRREPLGVVLIIGPWNYPLQLLILPLISAIAAGNCVVIKPSEVSGATEGLVAELIPKYLSQDCYTVACGGAEETKALLENRFDRIFYTGSQAVARSVVQAASVHLTPVTLELGGKCPCLIYGRINITAAARRLVWAKYFNAGQSCVAPDYLLCTKAIRDALVPALREVLEEFYGKEPKESPDVSRIVSDRHWTRLMELLKKTAGTVVVGGEANREDKYIAPTVVVDLQEDDALMGQEIFGPILPILTVETLEEGIDFINRKEKPLALYVFSDESSVVKTVMENTSSGGFCSNDAIIHMTLPSLPFGGVGMSGWGSYHGRWGFEEFSHRRACMLRGWALERLNGLRYPPYSSEKLKWLRWTTSPHS------CSIM 477          
BLAST of Aldehyde dehydrogenase vs. Ensembl Medaka
Match: aldh3a2b (fatty aldehyde dehydrogenase [Source:NCBI gene;Acc:101156839])

HSP 1 Score: 383.259 bits (983), Expect = 4.698e-127
Identity = 209/458 (45.63%), Postives = 295/458 (64.41%), Query Frame = 3
Query:   75 KMEALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKD-TKEIVNNMLRYPPYNKKKESWADWAL 1445
            + +A+   R++F +G ++ L +R  QL  L  M  E +K   + + KDL+KS    +L E L  + EI   ++ +  W A   V K  LT++D  ++  +P GV L IG WNYP  + + PLIG +AAGN  V+KPSE+ V+T K++ +L+P Y+D+ +  V  G    T ELL+ +FD+I +TGNS V K+++EAAAK+LTPV LELGGKSP Y+DK+  + +A RR    K  N GQTCIAPDY+LC  ++++  +    +A++EFY+ +  T  +Y RIIN +H+ R+M+M+      +A GG+  E   YIAPT++     E  +M+ EIFGP+LPI+ V   DEAIE IN GEKPLA YVFS++ +V+ +   ET+SG  V NDC+VH ++  LPFGGVG SGMG YHGK+S D  SH RG L K    E VNN +RYPP+  KK SWA + L
Sbjct:    4 EQQAVARARKAFNTGRSKPLEYRIIQLKNLKRMFYEKQKMISDAIKKDLNKSVEVTQLHETLGIESEIDLTIRKLKDWAAPRPVEKNLLTMSDTVYVHPEPLGVVLIIGAWNYPWAVTVGPLIGAIAAGNAAVVKPSEVCVHTAKVMEDLLPIYIDKELYPVVTGGVPETQELLRQRFDHIFYTGNSMVGKLIMEAAAKNLTPVTLELGGKSPCYIDKNCDITIACRRTAWGKYTNCGQTCIAPDYILCEPSMQDRIIEEIKKALKEFYTDNPKTCADYGRIINQRHFKRIMNMLDDC--TIAAGGENDEANCYIAPTVLRDVKPEAKVMQEEIFGPLLPIITVGGVDEAIEFINKGEKPLALYVFSSDNKVIDRIRDETSSGGFVANDCLVHYSISSLPFGGVGNSGMGCYHGKYSFDQLSHLRGCLIKKLNMEGVNN-VRYPPHTPKKLSWARFIL 458          
BLAST of Aldehyde dehydrogenase vs. Ensembl Medaka
Match: aldh3a1 (fatty aldehyde dehydrogenase [Source:NCBI gene;Acc:101160930])

HSP 1 Score: 369.777 bits (948), Expect = 1.330e-121
Identity = 202/466 (43.35%), Postives = 294/466 (63.09%), Query Frame = 3
Query:   72 LKMEALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALKSDAKDSS 1469
            ++ + ++  +++F SG  R L FR +QL AL +M+ E E +    L +D+++S  +  L EL+  + EI   ++ +  W A   V K  LT++D  ++Q +P GV L IG WNYP  L L+PLIG +AAGN  V+KPSE++  +  LL  L+P+Y+D+ +  V +G A  T ELL+L+FD++ +TG+SAV K+V+EAAA+HLTPV LELGGKSP Y+DKD  +++A RRI   K +N GQTCIAPDY+LC   ++   +      + EFY AD   S +Y RIIN +H+ R+M +++     V  GG     Q YIAPT++        LM+ EIFGPVLPI+ V+  D+AI  IN  EKPLA Y+F +N++   +   ETTSG +  ND ++H ++  LPFGGVG+SGMGSYHGK + +  SH R  + +       N+ RYPP ++++   A  AL+S   D S
Sbjct:    1 MERQVVQRAKEAFLSGRARGLEFRLQQLHALQSMITEKETEICTALKQDINRSQYDTPLLELIGIENEIKLAIEKIAEWTAPRPVEKNLLTISDEVYVQPEPLGVVLIIGAWNYPWALTLLPLIGAIAAGNAAVVKPSELSECSSLLLRALLPRYLDKDLYPVVMGGAAETQELLRLRFDHVFYTGSSAVGKLVMEAAARHLTPVTLELGGKSPCYIDKDCDIRVACRRITWGKFVNCGQTCIAPDYILCEPCIQSRVIECIRRTLLEFYGADPKCSADYSRIINQRHFTRIMSLMEGYTPVV--GGQSDPSQCYIAPTVLKDVPPHSRLMQEEIFGPVLPIVTVSDMDDAINFINEREKPLALYIFCSNKKEAKRMIEETTSGGVTVNDVMMHYSLSSLPFGGVGQSGMGSYHGKHTFERLSHHRACMLRSLNMESVNLARYPPQDRRRARRAKMALRSPLIDMS 464          
BLAST of Aldehyde dehydrogenase vs. Ensembl Medaka
Match: aldh3a1 (fatty aldehyde dehydrogenase [Source:NCBI gene;Acc:101160930])

HSP 1 Score: 368.237 bits (944), Expect = 1.513e-121
Identity = 198/453 (43.71%), Postives = 287/453 (63.36%), Query Frame = 3
Query:   72 LKMEALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESW 1430
            ++ + ++  +++F SG  R L FR +QL AL +M+ E E +    L +D+++S  +  L EL+  + EI   ++ +  W A   V K  LT++D  ++Q +P GV L IG WNYP  L L+PLIG +AAGN  V+KPSE++  +  LL  L+P+Y+D+ +  V +G A  T ELL+L+FD++ +TG+SAV K+V+EAAA+HLTPV LELGGKSP Y+DKD  +++A RRI   K +N GQTCIAPDY+LC   ++   +      + EFY AD   S +Y RIIN +H+ R+M +++     V  GG     Q YIAPT++        LM+ EIFGPVLPI+ V+  D+AI  IN  EKPLA Y+F +N++   +   ETTSG +  ND ++H ++  LPFGGVG+SGMGSYHGK + +  SH R  + +       N+ RYPP  + + SW
Sbjct:    1 MERQVVQRAKEAFLSGRARGLEFRLQQLHALQSMITEKETEICTALKQDINRSQYDTPLLELIGIENEIKLAIEKIAEWTAPRPVEKNLLTISDEVYVQPEPLGVVLIIGAWNYPWALTLLPLIGAIAAGNAAVVKPSELSECSSLLLRALLPRYLDKDLYPVVMGGAAETQELLRLRFDHVFYTGSSAVGKLVMEAAARHLTPVTLELGGKSPCYIDKDCDIRVACRRITWGKFVNCGQTCIAPDYILCEPCIQSRVIECIRRTLLEFYGADPKCSADYSRIINQRHFTRIMSLMEGYTPVV--GGQSDPSQCYIAPTVLKDVPPHSRLMQEEIFGPVLPIVTVSDMDDAINFINEREKPLALYIFCSNKKEAKRMIEETTSGGVTVNDVMMHYSLSSLPFGGVGQSGMGSYHGKHTFERLSHHRACMLRSLNMESVNLARYPP--QDRVSW 449          
BLAST of Aldehyde dehydrogenase vs. Ensembl Medaka
Match: aldh3a2b (fatty aldehyde dehydrogenase [Source:NCBI gene;Acc:101156839])

HSP 1 Score: 362.073 bits (928), Expect = 9.382e-119
Identity = 189/394 (47.97%), Postives = 261/394 (66.24%), Query Frame = 3
Query:  267 KQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKD-TKEIVNNMLRYPPYNKKKESWADWAL 1445
            + EI   ++ +  W A   V K  LT++D  ++  +P GV L IG WNYP  + + PLIG +AAGN  V+KPSE+ V+T K++ +L+P Y+D+ +  V  G    T ELL+ +FD+I +TGNS V K+++EAAAK+LTPV LELGGKSP Y+DK+  + +A RR    K  N GQTCIAPDY+LC  ++++  +    +A++EFY+ +  T  +Y RIIN +H+ R+M+M+      +A GG+  E   YIAPT++     E  +M+ EIFGP+LPI+ V   DEAIE IN GEKPLA YVFS++ +V+ +   ET+SG  V NDC+VH ++  LPFGGVG SGMG YHGK+S D  SH RG L K    E VNN +RYPP+  KK SWA + L
Sbjct:   78 ESEIDLTIRKLKDWAAPRPVEKNLLTMSDTVYVHPEPLGVVLIIGAWNYPWAVTVGPLIGAIAAGNAAVVKPSEVCVHTAKVMEDLLPIYIDKELYPVVTGGVPETQELLRQRFDHIFYTGNSMVGKLIMEAAAKNLTPVTLELGGKSPCYIDKNCDITIACRRTAWGKYTNCGQTCIAPDYILCEPSMQDRIIEEIKKALKEFYTDNPKTCADYGRIINQRHFKRIMNMLDDC--TIAAGGENDEANCYIAPTVLRDVKPEAKVMQEEIFGPLLPIITVGGVDEAIEFINKGEKPLALYVFSSDNKVIDRIRDETSSGGFVANDCLVHYSISSLPFGGVGNSGMGCYHGKYSFDQLSHLRGCLIKKLNMEGVNN-VRYPPHTPKKLSWARFIL 468          
BLAST of Aldehyde dehydrogenase vs. Planmine SMEST
Match: SMESG000010552.1 (SMESG000010552.1)

HSP 1 Score: 941.799 bits (2433), Expect = 0.000e+0
Identity = 470/470 (100.00%), Postives = 470/470 (100.00%), Query Frame = 3
Query:   78 MEALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHXXXXXXXXXXXXXCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALKSDAKDSSGFCSIL 1487
            MEALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHKSAAEAKLSELLLCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALKSDAKDSSGFCSIL
Sbjct:    1 MEALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHKSAAEAKLSELLLCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGKVAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKESWADWALKSDAKDSSGFCSIL 470          
BLAST of Aldehyde dehydrogenase vs. Planmine SMEST
Match: SMESG000061955.1 (SMESG000061955.1)

HSP 1 Score: 121.709 bits (304), Expect = 3.293e-29
Identity = 92/344 (26.74%), Postives = 152/344 (44.19%), Query Frame = 3
Query:  369 RQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKY-VDQGVCRVELGDAKRTGELLKLKFD--YIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADASTSENY-PRIINNKHYHRLMDMIKQTRGKV--AYGGD------GKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKRGVLDK 1364
            R P GVA  I  WN P+ L    L   +  GN  V KPSE    T   +  LI K     GV  +  GD    G  L    D   I FTG++A  + +  A   H   +  ELGGK+   +  D  +  A    + S   N G+ C+    +     + E FL   +E        D    + +   +IN  H ++++D IK  +G++   YG D        +D L++ PT+      +D ++  E+FGPV  I+   ++DE ++ +N+ +  L   + + N+        +   G++  N C +   ++ + FGG  KSG+G+   + S D F+  + +  K
Sbjct:  138 RSPVGVAAVITPWNLPLYLLTFKLAPCIMYGNTCVCKPSEFTSLTAWKMCHLIKKAGFPNGVINIVFGDGPSVGNALVRYKDVSLITFTGSTATGEHIQRATVGHFKKLSFELGGKNAAIVFADADLDKALESCVTSSFTNQGEICLCTSRIYVQNDIYEKFLEGFVEKTRNIVVGDPLHPQTFMGPLINQIHMNKVLDYIKNCKGRMCCGYGMDQLKLPETNKDGLFLPPTVFTDIPEDDPILLEEVFGPVTCIVPFTTQDEVVKRVNSVQYGLCAVIHTKNQSTAISTAKKLEVGTVWIN-CWLIRDLR-MSFGGWKKSGIGNEGQEESRDFFTELKTICFK 479          
BLAST of Aldehyde dehydrogenase vs. Planmine SMEST
Match: SMESG000015620.1 (SMESG000015620.1)

HSP 1 Score: 121.709 bits (304), Expect = 3.443e-29
Identity = 91/344 (26.45%), Postives = 157/344 (45.64%), Query Frame = 3
Query:  363 IQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELIPKYVDQGVCRVELGDAKRTGELLKL-----KFDYIVFTGNSAVAKIVLEAAAKHLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEF-YSADASTSENYPRIINNKHYHRLMDMIK---QTRGKVAYGGDGKEDQLY-----IAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFND-CVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSFSHKR 1349
            I +QP GV   I  WN+P+ +    L  +LAAG   ++KP+E    +    +E+   ++  G+  V          + +      +   I FTG+S V KI+   +A+ +  +  ELGG +P  + +   + +A +  +  K  N+GQ CI+ + +L H ++ + F+   I    +           N   +IN     ++  +I    ++  +V  GG     + Y       PT++   S +  L K+EIFGPV  I  ++ E  A+ I N+    LA Y+FS +   + +   E   G +  N+  V HC     PF G  +SG+G+  G F ID +  K+
Sbjct:  155 ILQQPIGVVGMITPWNFPLAMVTRKLGAILAAGCAAIIKPAEDTPLSLLKFIEVSESFIPPGMINVVTSSKLSCPSVGRAFCNDSRIKSITFTGSSEVGKILYAQSAETMKRLSFELGGNAPFIVFESADLNLAVKCALICKFRNSGQACISANRILVHESIHDEFVKKLISETSKLKVGYGLEKDNNQGPLINQDAIRKVEQLINRSVESGAQVKLGGKRAILEKYPKGNFFQPTVITDCSTDHPLFKNEIFGPVCAITKISDEKSAVRIANSLNTGLAGYLFSEDHRQIFRVSEELQMGIIGVNEGAVSHCEA---PFSGWKESGLGTESGIFGIDEYLVKK 495          
BLAST of Aldehyde dehydrogenase vs. Planmine SMEST
Match: SMESG000005275.1 (SMESG000005275.1)

HSP 1 Score: 106.686 bits (265), Expect = 1.079e-23
Identity = 91/341 (26.69%), Postives = 155/341 (45.45%), Query Frame = 3
Query:  351 DCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLEL-IPKYVDQGVCRVELGDAKRTGELLKLKFDY--IVFTGNSAVAKIVLEAAAK-HLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADA--STSENYPRIINNKHYHRL-----MDMIKQTRGKVAYGGDGKEDQLY-IAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSF 1337
            + ++ +++P GV   I  WNYP+ +    +   LAAGN VVLKP+++         EL +      GV  V  G     G  +    D   + FTG++A+ + ++ + AK +L    LELGGKSP  +  D  M  A +   +S   N G+ CIA   +     + + FL   +E +++    D    + ++ P+   N   H L      D+  +   K+ +GG   + + Y + PTI    + +  + + E FGP++ I      DE I   N  E  LA  VF+N+     +      +G++  N    +      PFGG  +SG G   G+ +++ +
Sbjct:  568 NLSFTKKEPIGVCGIITPWNYPLMMLAWKVAACLAAGNTVVLKPAQVTPLASLKFCELSVEAGFPSGVINVLPGSGAIAGTAISEHPDIRKLGFTGSTAIGQTIMSSCAKSNLKKCSLELGGKSPLIIFSDCDMDKAVKSACSSVFFNKGENCIAAGRIFVDVRIHDVFLKLVVEDVKKMKIGDPLDRSVDHGPQ---NHEIHLLKLLEFCDIGVKEGAKLVFGGKRCDRKGYFMEPTIFTSVTDDMYIAREESFGPIMIISKFYDIDEVIVRANKTEYGLASGVFTNDISKALRVADAIDAGTVFIN--TYNKTDVAAPFGGFKQSGFGKDLGQEALNEY 903          
BLAST of Aldehyde dehydrogenase vs. Planmine SMEST
Match: SMESG000005275.1 (SMESG000005275.1)

HSP 1 Score: 106.301 bits (264), Expect = 1.303e-23
Identity = 91/341 (26.69%), Postives = 155/341 (45.45%), Query Frame = 3
Query:  351 DCTWIQRQPFGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLEL-IPKYVDQGVCRVELGDAKRTGELLKLKFDY--IVFTGNSAVAKIVLEAAAK-HLTPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHRAVKEPFLCAAIEAIEEFYSADA--STSENYPRIINNKHYHRL-----MDMIKQTRGKVAYGGDGKEDQLY-IAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAIEIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPFGGVGKSGMGSYHGKFSIDSF 1337
            + ++ +++P GV   I  WNYP+ +    +   LAAGN VVLKP+++         EL +      GV  V  G     G  +    D   + FTG++A+ + ++ + AK +L    LELGGKSP  +  D  M  A +   +S   N G+ CIA   +     + + FL   +E +++    D    + ++ P+   N   H L      D+  +   K+ +GG   + + Y + PTI    + +  + + E FGP++ I      DE I   N  E  LA  VF+N+     +      +G++  N    +      PFGG  +SG G   G+ +++ +
Sbjct:  542 NLSFTKKEPIGVCGIITPWNYPLMMLAWKVAACLAAGNTVVLKPAQVTPLASLKFCELSVEAGFPSGVINVLPGSGAIAGTAISEHPDIRKLGFTGSTAIGQTIMSSCAKSNLKKCSLELGGKSPLIIFSDCDMDKAVKSACSSVFFNKGENCIAAGRIFVDVRIHDVFLKLVVEDVKKMKIGDPLDRSVDHGPQ---NHEIHLLKLLEFCDIGVKEGAKLVFGGKRCDRKGYFMEPTIFTSVTDDMYIAREESFGPIMIISKFYDIDEVIVRANKTEYGLASGVFTNDISKALRVADAIDAGTVFIN--TYNKTDVAAPFGGFKQSGFGKDLGQEALNEY 877          
The following BLAST results are available for this feature:
BLAST of Aldehyde dehydrogenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ALDH3B11.024e-14047.87aldehyde dehydrogenase 3 family member B1 [Source:... [more]
ALDH3B11.024e-14047.87aldehyde dehydrogenase 3 family member B1 [Source:... [more]
ALDH3A22.175e-14047.33aldehyde dehydrogenase 3 family member A2 [Source:... [more]
ALDH3A22.175e-14047.33aldehyde dehydrogenase 3 family member A2 [Source:... [more]
ALDH3A22.175e-14047.33aldehyde dehydrogenase 3 family member A2 [Source:... [more]
back to top
BLAST of Aldehyde dehydrogenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alh-42.551e-12342.51Aldehyde dehydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-42.551e-12342.51Aldehyde dehydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-42.579e-12342.51Aldehyde dehydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-42.579e-12342.51Aldehyde dehydrogenase [Source:UniProtKB/TrEMBL;A... [more]
alh-43.446e-12342.51Aldehyde dehydrogenase [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Aldehyde dehydrogenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aldh-III5.299e-13945.20gene:FBgn0010548 transcript:FBtr0088996[more]
Aldh-III5.591e-13945.20gene:FBgn0010548 transcript:FBtr0336912[more]
Aldh-III6.099e-13945.20gene:FBgn0010548 transcript:FBtr0310676[more]
Aldh-III2.822e-13845.20gene:FBgn0010548 transcript:FBtr0308198[more]
Aldh-III3.992e-13845.20gene:FBgn0010548 transcript:FBtr0300481[more]
back to top
BLAST of Aldehyde dehydrogenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh3b11.997e-14446.06aldehyde dehydrogenase 3 family, member B1 [Source... [more]
aldh3b11.997e-14446.06aldehyde dehydrogenase 3 family, member B1 [Source... [more]
aldh3a2b3.428e-13645.45aldehyde dehydrogenase 3 family, member A2b [Sourc... [more]
aldh3a2a2.510e-13346.00aldehyde dehydrogenase 3 family, member A2a [Sourc... [more]
aldh3a2a2.510e-13346.00aldehyde dehydrogenase 3 family, member A2a [Sourc... [more]
back to top
BLAST of Aldehyde dehydrogenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mprip4.230e-13847.26myosin phosphatase Rho interacting protein [Source... [more]
mprip7.182e-13847.26myosin phosphatase Rho interacting protein [Source... [more]
mprip1.039e-13747.26myosin phosphatase Rho interacting protein [Source... [more]
mprip2.547e-13747.26myosin phosphatase Rho interacting protein [Source... [more]
aldh3a26.256e-13144.88aldehyde dehydrogenase 3 family member A2 [Source:... [more]
back to top
BLAST of Aldehyde dehydrogenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aldh3b31.684e-14246.84aldehyde dehydrogenase 3 family, member B3 [Source... [more]
Aldh3b12.183e-14147.76aldehyde dehydrogenase 3 family, member B1 [Source... [more]
Aldh3b21.480e-13947.25aldehyde dehydrogenase 3 family, member B2 [Source... [more]
Aldh3a11.486e-13547.27aldehyde dehydrogenase family 3, subfamily A1 [Sou... [more]
Aldh3a11.486e-13547.27aldehyde dehydrogenase family 3, subfamily A1 [Sou... [more]
back to top
BLAST of Aldehyde dehydrogenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|J3QMK6|AL3B3_MOUSE1.178e-14146.84Aldehyde dehydrogenase family 3 member B3 OS=Mus m... [more]
sp|Q80VQ0|AL3B1_MOUSE1.527e-14047.76Aldehyde dehydrogenase family 3 member B1 OS=Mus m... [more]
sp|P43353|AL3B1_HUMAN4.920e-14047.87Aldehyde dehydrogenase family 3 member B1 OS=Homo ... [more]
sp|Q5RF60|AL3A2_PONAB8.142e-14047.33Aldehyde dehydrogenase family 3 member A2 OS=Pongo... [more]
sp|P51648|AL3A2_HUMAN1.044e-13947.33Aldehyde dehydrogenase family 3 member A2 OS=Homo ... [more]
back to top
BLAST of Aldehyde dehydrogenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EP415.314e-14947.85Aldehyde dehydrogenase OS=Macrostomum lignano OX=2... [more]
A0A267F0G71.307e-14847.85Aldehyde dehydrogenase OS=Macrostomum lignano OX=2... [more]
A0A267E1J88.714e-14847.64Aldehyde dehydrogenase OS=Macrostomum lignano OX=2... [more]
A0A0B7BWN98.979e-14847.33Aldehyde dehydrogenase OS=Arion vulgaris OX=102868... [more]
A0A1I8G7N81.191e-14648.25Aldehyde dehydrogenase OS=Macrostomum lignano OX=2... [more]
back to top
BLAST of Aldehyde dehydrogenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh3a2b1.903e-13745.49fatty aldehyde dehydrogenase-like [Source:NCBI gen... [more]
aldh3a2b3.838e-13745.49fatty aldehyde dehydrogenase-like [Source:NCBI gen... [more]
aldh3b12.616e-13444.97aldehyde dehydrogenase family 3 member B1-like [So... [more]
aldh3a2a5.942e-13345.84fatty aldehyde dehydrogenase-like [Source:NCBI gen... [more]
aldh3a13.548e-12043.82aldehyde dehydrogenase 3 family, member A1 [Source... [more]
back to top
BLAST of Aldehyde dehydrogenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh3a16.931e-14247.03aldehyde dehydrogenase 3 family, member A1 [Source... [more]
ENSPMAT00000004609.12.152e-2927.67pep scaffold:Pmarinus_7.0:GL479321:13801:23388:1 g... [more]
aldh5a12.782e-2627.43aldehyde dehydrogenase 5 family, member A1 (succin... [more]
aldh1l26.833e-2124.18aldehyde dehydrogenase 1 family, member L2 [Source... [more]
aldh8a13.345e-1927.94aldehyde dehydrogenase 8 family, member A1 [Source... [more]
back to top
BLAST of Aldehyde dehydrogenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
HFD11.120e-5933.62Dehydrogenase involved in ubiquinone and sphingoli... [more]
ALD27.392e-3126.83Cytoplasmic aldehyde dehydrogenase; involved in et... [more]
ALD43.634e-3030.46Mitochondrial aldehyde dehydrogenase; required for... [more]
ALD54.214e-3026.39Mitochondrial aldehyde dehydrogenase; involved in ... [more]
ALD34.674e-2928.20Cytoplasmic aldehyde dehydrogenase; involved in be... [more]
back to top
BLAST of Aldehyde dehydrogenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO374932.379e-13046.40Aldehyde dehydrogenase [Source:UniProtKB/TrEMBL;A... [more]
EDO293284.947e-3128.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455388.319e-3128.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343621.161e-2926.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461511.229e-2425.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Aldehyde dehydrogenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aldh3b16.502e-12943.97aldehyde dehydrogenase 3 family member B1 [Source:... [more]
aldh3a2b4.698e-12745.63fatty aldehyde dehydrogenase [Source:NCBI gene;Acc... [more]
aldh3a11.330e-12143.35fatty aldehyde dehydrogenase [Source:NCBI gene;Acc... [more]
aldh3a11.513e-12143.71fatty aldehyde dehydrogenase [Source:NCBI gene;Acc... [more]
aldh3a2b9.382e-11947.97fatty aldehyde dehydrogenase [Source:NCBI gene;Acc... [more]
back to top
BLAST of Aldehyde dehydrogenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010552.10.000e+0100.00SMESG000010552.1[more]
SMESG000061955.13.293e-2926.74SMESG000061955.1[more]
SMESG000015620.13.443e-2926.45SMESG000015620.1[more]
SMESG000005275.11.079e-2326.69SMESG000005275.1[more]
SMESG000005275.11.303e-2326.69SMESG000005275.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014491 ID=SMED30014491|Name=Aldehyde dehydrogenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1788bp
AATTCCTTATTTAAAATTATTTAAACATATTTTTCCAACTGTATTTTTTA
TTCGTGTCGAAATTCTAATTTTTGAAAATGGAAGCTTTAGAAATTTTACG
CCAGTCTTTTAAAAGTGGAATTACCAGAAGTTTAGCATTTAGGAAAAAGC
AATTAATAGCTTTGTTCACGATGCTTGAGGAGCATGAAAAAGATTTTATT
GAAGTCTTACACAAAGACTTGCATAAATCGGCAGCTGAAGCTAAATTATC
AGAATTATTGCTATGTAAGCAGGAAATATCATATATTCTTAAAAACATGG
ATACTTGGTTGGCTAATGAGAAGGTTCCGAAAACATTTCTCACTCTCACA
GATTGTACATGGATCCAACGACAACCGTTTGGAGTAGCGCTGTCAATTGG
AACGTGGAATTATCCTGTACAATTAAACCTGATCCCGTTGATTGGTCTAC
TTGCCGCTGGCAATTGTGTCGTGTTGAAGCCGTCGGAAATCGCTGTCAAC
ACAGAGAAATTGCTGTTGGAGCTGATCCCGAAATATGTCGATCAAGGCGT
CTGCCGAGTCGAATTGGGCGATGCCAAGCGCACTGGAGAGCTGCTGAAAT
TGAAATTCGACTATATCGTATTCACTGGCAATTCCGCAGTTGCCAAAATC
GTGCTGGAAGCCGCCGCCAAACATTTGACTCCGGTCCTGCTTGAACTGGG
CGGCAAATCACCGACATATTTGGATAAAGATGTCGTGATGAAAATGGCAG
CTAGGAGAATTATTGCTAGCAAATTAATGAACGCCGGACAGACGTGCATA
GCACCGGATTATGTACTTTGTCACAGGGCAGTCAAGGAACCCTTTCTTTG
TGCTGCAATAGAGGCGATTGAGGAATTTTATTCTGCTGATGCGAGTACTT
CAGAGAATTACCCCCGTATCATTAACAATAAACATTACCATCGTTTAATG
GATATGATCAAACAAACTCGTGGCAAGGTTGCCTATGGTGGAGACGGCAA
GGAAGATCAATTGTATATTGCTCCGACTATTGTCATTCTTGACTCTGTTG
AGGATATTCTGATGAAAAGTGAGATATTCGGTCCAGTACTGCCAATACTG
ATAGTAAACTCTGAGGATGAAGCGATCGAAATCATCAACAACGGAGAGAA
ACCGCTGGCAGAGTACGTGTTCTCCAATAATCGAGAGGTGTTGAGTAAGT
TCGAACTGGAAACGACAAGTGGCAGTCTCGTATTTAATGACTGTGTTGTA
CATTGTGCAGTGAAAGGGTTACCGTTTGGAGGAGTCGGCAAGTCTGGAAT
GGGTTCTTACCATGGCAAATTTTCAATTGATAGCTTCTCTCACAAACGCG
GAGTTCTTGACAAAGATACAAAGGAGATTGTGAATAATATGTTGAGATAT
CCTCCTTACAATAAGAAGAAAGAAAGTTGGGCTGATTGGGCATTGAAGAG
TGATGCTAAAGATAGTTCCGGATTTTGTTCAATTTTATAATAAAATCGGA
ATTCGATTATCTGTTTGACAAATTGTATCAAAATGTTTTTTACATTTATC
GGGTGTTTTGTGATATGTTGCTTTGTGCGGATTATTTGCCATTTATCTCT
TATCTCACTCATGTTGGCCCGGTTGCTGTTCTCTCCATTCAACGGAATAA
GCGAAGGAATTATTTATTCCAAATAATTTACACAAAACATATTTAATAAT
TTTCATTGATTAATAAATTCAATACAATCGAAGTCATTTAAAATAATAAT
TCGATAAAAAATAATTCAAATATGTCGTATTAAAATTG
back to top

protein sequence of SMED30014491-orf-1

>SMED30014491-orf-1 ID=SMED30014491-orf-1|Name=SMED30014491-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=471bp
MEALEILRQSFKSGITRSLAFRKKQLIALFTMLEEHEKDFIEVLHKDLHK
SAAEAKLSELLLCKQEISYILKNMDTWLANEKVPKTFLTLTDCTWIQRQP
FGVALSIGTWNYPVQLNLIPLIGLLAAGNCVVLKPSEIAVNTEKLLLELI
PKYVDQGVCRVELGDAKRTGELLKLKFDYIVFTGNSAVAKIVLEAAAKHL
TPVLLELGGKSPTYLDKDVVMKMAARRIIASKLMNAGQTCIAPDYVLCHR
AVKEPFLCAAIEAIEEFYSADASTSENYPRIINNKHYHRLMDMIKQTRGK
VAYGGDGKEDQLYIAPTIVILDSVEDILMKSEIFGPVLPILIVNSEDEAI
EIINNGEKPLAEYVFSNNREVLSKFELETTSGSLVFNDCVVHCAVKGLPF
GGVGKSGMGSYHGKFSIDSFSHKRGVLDKDTKEIVNNMLRYPPYNKKKES
WADWALKSDAKDSSGFCSIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: biological process
TermDefinition
GO:0006081cellular aldehyde metabolic process
GO:0008152metabolic process
GO:0055114oxidation-reduction process
Vocabulary: molecular function
TermDefinition
GO:0016620oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0016491oxidoreductase activity
GO:0004030aldehyde dehydrogenase [NAD(P)+] activity
Vocabulary: INTERPRO
TermDefinition
IPR015590Aldehyde_DH_dom
IPR012394Aldehyde_DH_NAD(P)
IPR016163Ald_DH_C
IPR016162Ald_DH_N
IPR016160Ald_DH_CS_CYS
IPR029510Ald_DH_CS_GLU
IPR016161Ald_DH/histidinol_DH
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015590Aldehyde dehydrogenase domainPFAMPF00171Aldedhcoord: 10..422
e-value: 9.2E-77
score: 258.5
IPR012394Aldehyde dehydrogenase NAD(P)-dependentPIRSFPIRSF036492ALDHcoord: 1..467
e-value: 1.3E-173
score: 575.9
IPR016162Aldehyde dehydrogenase, N-terminalGENE3DG3DSA:3.40.605.10coord: 8..426
e-value: 4.1E-158
score: 528.6
IPR016163Aldehyde dehydrogenase, C-terminalGENE3DG3DSA:3.40.309.10coord: 209..406
e-value: 4.1E-158
score: 528.6
NoneNo IPR availablePANTHERPTHR43570:SF16ALDEHYDE DEHYDROGENASE TYPE III, ISOFORM Qcoord: 3..460
NoneNo IPR availablePANTHERPTHR43570FAMILY NOT NAMEDcoord: 3..460
IPR029510Aldehyde dehydrogenase, glutamic acid active sitePROSITEPS00687ALDEHYDE_DEHYDR_GLUcoord: 205..212
IPR016160Aldehyde dehydrogenase, cysteine active sitePROSITEPS00070ALDEHYDE_DEHYDR_CYScoord: 233..244
IPR016161Aldehyde/histidinol dehydrogenaseSUPERFAMILYSSF53720ALDH-likecoord: 2..434