Innexin

Overview
NameInnexin
Smed IDSMED30014488
Length (bp)1559
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30014488) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30014488) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30014488) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30014488) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014488

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30014488SMESG000080788.1 dd_Smed_v4_692_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30014488SMESG000080788.1 dd_Smed_v6_692_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014488SMESG000080788.1 dd_Smed_v6_692_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30014488SMESG000080788.1 dd_Smed_v6_692_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 232.261 bits (591), Expect = 3.830e-71
Identity = 127/375 (33.87%), Postives = 211/375 (56.27%), Query Frame = 1
Query:  205 EDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGED-IPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKEN 1326
            +D  DKL++ ++  ++ +  ++V+ K Y+  P+ C+   A      E Y ENYCWV  T  FLP  D IP N  +     + R+I YYQWVPF+L L+ ++FY+P I+W+++ + +SG +++S+V  A  +       R   ++ IA  +E+ L        GN  KL        N  + ++  G  +   YI +K LY +N++GQ+F++  FLG  N +  +G  VL+++++G+EW ++G FPRVT C    +K +G  +++  QC L +NM NEKI++FLWFW  L+   T  S+  W Y     SR+  F+ ++L   + Y+  D   +  F+  FLR DGVFL+RM+  +AG++   ++   L   Y +N
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVP-ATFTEPMEQYTENYCWVQNTY-FLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSW-QSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKL-------LNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLG--NRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFE-VKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDN 378          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 223.016 bits (567), Expect = 1.885e-67
Identity = 124/367 (33.79%), Postives = 205/367 (55.86%), Query Frame = 1
Query:  205 EDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMM---HQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIV 1296
            +DF DKL++ ++ T+L    ++V+ K Y+  P+ C+   A      E Y ENYCWV  T      EDIP+       +   R+I YYQWVPFIL ++ ++FY+P I+W+ + Y  SG NL+ +V  A  A       +   +  +AR ++D +      RQG+       +    N C   +H G ++ + YI IK LY  NV+ Q F++   LG N+   ++G+++L +++   EW QTG+FPRVT C    ++ +G  +++  QC L +NM NEKI++FLWFW +  GIVT  +   W   M   S+   F++++L +   H     +D   +  F   FLR DGVF++RM+  +AG++++++++
Sbjct:   19 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVP-ATFTDAMEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN-C--GRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLCDFE-VRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELI 374          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 223.016 bits (567), Expect = 6.977e-67
Identity = 123/368 (33.42%), Postives = 205/368 (55.71%), Query Frame = 1
Query:  205 EDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV-FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMM---HQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIV 1296
            +DF DKL++ ++ T+L    ++V+ K Y+  P+ C+   A      E Y ENYCWV  T      EDIP+       +   R+I YYQWVPFIL ++ ++FY+P I+W+ + Y  SG NL+ +V  A  A       +   +  +AR ++D +      RQG+     R  ++         +H G ++ + YI IK LY  NV+ Q F++   LG N+   ++G+++L +++   EW QTG+FPRVT C    ++ +G  +++  QC L +NM NEKI++FLWFW +  GIVT  +   W   M   S+   F++++L +   H     +D   +  F   FLR DGVF++RM+  +AG++++++++
Sbjct:   71 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVP-ATFTDAMEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGH----SRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLCDFE-VRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELI 426          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 222.631 bits (566), Expect = 1.386e-66
Identity = 123/368 (33.42%), Postives = 205/368 (55.71%), Query Frame = 1
Query:  205 EDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV-FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMM---HQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIV 1296
            +DF DKL++ ++ T+L    ++V+ K Y+  P+ C+   A      E Y ENYCWV  T      EDIP+       +   R+I YYQWVPFIL ++ ++FY+P I+W+ + Y  SG NL+ +V  A  A       +   +  +AR ++D +      RQG+     R  ++         +H G ++ + YI IK LY  NV+ Q F++   LG N+   ++G+++L +++   EW QTG+FPRVT C    ++ +G  +++  QC L +NM NEKI++FLWFW +  GIVT  +   W   M   S+   F++++L +   H     +D   +  F   FLR DGVF++RM+  +AG++++++++
Sbjct:   80 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVP-ATFTDAMEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGH----SRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLCDFE-VRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELI 435          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 222.631 bits (566), Expect = 1.733e-66
Identity = 123/368 (33.42%), Postives = 205/368 (55.71%), Query Frame = 1
Query:  205 EDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV-FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMM---HQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIV 1296
            +DF DKL++ ++ T+L    ++V+ K Y+  P+ C+   A      E Y ENYCWV  T      EDIP+       +   R+I YYQWVPFIL ++ ++FY+P I+W+ + Y  SG NL+ +V  A  A       +   +  +AR ++D +      RQG+     R  ++         +H G ++ + YI IK LY  NV+ Q F++   LG N+   ++G+++L +++   EW QTG+FPRVT C    ++ +G  +++  QC L +NM NEKI++FLWFW +  GIVT  +   W   M   S+   F++++L +   H     +D   +  F   FLR DGVF++RM+  +AG++++++++
Sbjct:   93 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVP-ATFTDAMEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGH----SRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELI 448          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 114.005 bits (284), Expect = 1.992e-27
Identity = 96/335 (28.66%), Postives = 158/335 (47.16%), Query Frame = 1
Query:  157 FLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGT------ITFLPGEDIPQNDVDW--ARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS-NMISGKEW--HQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLS 1128
            F ++ G  KI   V I++   ++ +  +V +LI   ++VT + Y+  P+ C     P G      ++ YCW++ T      +T + G D+ Q  V       D+ +   YYQWV F+L  Q I+FY+P+ +W+    +  G  L+ +V D N    +P V  + K +R    +        DY  GN         N  NF  F           + + + L  +NVIGQ++ +  FL  +   S++G  VL    +   E       +FP+VT C        G    +   C LP+N++NEKIYVFLWFW +++ I++ IS+    YR+A ++
Sbjct:    5 FGSVKGLLKIDQ-VCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN----SPIVNDECKNDRKKILV--------DYFIGNL--------NRHNFYAFR----------FFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVA 294          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 114.005 bits (284), Expect = 1.992e-27
Identity = 96/335 (28.66%), Postives = 158/335 (47.16%), Query Frame = 1
Query:  157 FLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGT------ITFLPGEDIPQNDVDW--ARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS-NMISGKEW--HQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLS 1128
            F ++ G  KI   V I++   ++ +  +V +LI   ++VT + Y+  P+ C     P G      ++ YCW++ T      +T + G D+ Q  V       D+ +   YYQWV F+L  Q I+FY+P+ +W+    +  G  L+ +V D N    +P V  + K +R    +        DY  GN         N  NF  F           + + + L  +NVIGQ++ +  FL  +   S++G  VL    +   E       +FP+VT C        G    +   C LP+N++NEKIYVFLWFW +++ I++ IS+    YR+A ++
Sbjct:    5 FGSVKGLLKIDQ-VCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN----SPIVNDECKNDRKKILV--------DYFIGNL--------NRHNFYAFR----------FFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVA 294          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 114.005 bits (284), Expect = 1.992e-27
Identity = 96/335 (28.66%), Postives = 158/335 (47.16%), Query Frame = 1
Query:  157 FLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGT------ITFLPGEDIPQNDVDW--ARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS-NMISGKEW--HQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLS 1128
            F ++ G  KI   V I++   ++ +  +V +LI   ++VT + Y+  P+ C     P G      ++ YCW++ T      +T + G D+ Q  V       D+ +   YYQWV F+L  Q I+FY+P+ +W+    +  G  L+ +V D N    +P V  + K +R    +        DY  GN         N  NF  F           + + + L  +NVIGQ++ +  FL  +   S++G  VL    +   E       +FP+VT C        G    +   C LP+N++NEKIYVFLWFW +++ I++ IS+    YR+A ++
Sbjct:    5 FGSVKGLLKIDQ-VCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN----SPIVNDECKNDRKKILV--------DYFIGNL--------NRHNFYAFR----------FFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVA 294          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 114.005 bits (284), Expect = 1.992e-27
Identity = 96/335 (28.66%), Postives = 158/335 (47.16%), Query Frame = 1
Query:  157 FLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGT------ITFLPGEDIPQNDVDW--ARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS-NMISGKEW--HQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLS 1128
            F ++ G  KI   V I++   ++ +  +V +LI   ++VT + Y+  P+ C     P G      ++ YCW++ T      +T + G D+ Q  V       D+ +   YYQWV F+L  Q I+FY+P+ +W+    +  G  L+ +V D N    +P V  + K +R    +        DY  GN         N  NF  F           + + + L  +NVIGQ++ +  FL  +   S++G  VL    +   E       +FP+VT C        G    +   C LP+N++NEKIYVFLWFW +++ I++ IS+    YR+A ++
Sbjct:    5 FGSVKGLLKIDQ-VCIDNNVFRMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLG-----VMDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWK----SWEGGRLKMLVMDLN----SPIVNDECKNDRKKILV--------DYFIGNL--------NRHNFYAFR----------FFVCEALNFVNVIGQIYFVDFFL--DGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIAVVA 294          
BLAST of Innexin vs. Ensembl Fly
Match: shakB (gene:FBgn0085387 transcript:FBtr0112570)

HSP 1 Score: 107.457 bits (267), Expect = 3.011e-25
Identity = 83/303 (27.39%), Postives = 138/303 (45.54%), Query Frame = 1
Query:  190 TYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLAC-YTATAPGGSNFENYLENYCWVHGTITFL------PGEDIPQNDVDWARADDT---RRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTG---IFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFW 1059
            ++V I+    +L    +V LLI   + VT + Y+  P+ C +T   P     E+ L  YCW+H T T +       G ++P   V  ++       +   YYQWV F L  Q I+FY P+ +W+    +  G  + +++ D +       +  + + ++  + + D L+++  Y                           W    Y + + L  +NVIGQ+F+M +F  F+    +FG  V+  M + +E        IFPR+T C        G   K+ A C LP+N++NEKIY+FLWFW
Sbjct:    3 SHVKIDSPVFRLHTNATVILLITFSIAVTTRQYVGNPIDCVHTRDIP-----EDVLNTYCWIHSTYTVVDAFMKKQGSEVPFPGVHNSQGRGPLTIKHTKYYQWVAFTLFFQAILFYTPRWLWK----SWEGGKIHALIMDLDIG-----ICSEAEKKQKKKLLLDYLWENLRYHN-------------------------WWAYRYYVCELLALINVIGQMFLMNRF--FDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEKHDAICILPLNVVNEKIYIFLWFW 264          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 4.872e-70
Identity = 127/375 (33.87%), Postives = 211/375 (56.27%), Query Frame = 1
Query:  205 EDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGED-IPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKEN 1326
            +D  DKL++ ++  ++ +  ++V+ K Y+  P+ C+   A      E Y ENYCWV  T  FLP  D IP N  +     + R+I YYQWVPF+L L+ ++FY+P I+W+++ + +SG +++S+V  A  +       R   ++ IA  +E+ L        GN  KL        N  + ++  G  +   YI +K LY +N++GQ+F++  FLG  N +  +G  VL+++++G+EW ++G FPRVT C    +K +G  +++  QC L +NM NEKI++FLWFW  L+   T  S+  W Y     SR+  F+ ++L   + Y+  D   +  F+  FLR DGVFL+RM+  +AG++   ++   L   Y +N
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVP-ATFTEPMEQYTENYCWVQNTY-FLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSW-QSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKL-------LNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLG--NRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFE-VKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDN 378          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 7.407e-65
Identity = 123/368 (33.42%), Postives = 205/368 (55.71%), Query Frame = 1
Query:  205 EDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV-FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMM---HQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIV 1296
            +DF DKL++ ++ T+L    ++V+ K Y+  P+ C+   A      E Y ENYCWV  T      EDIP+       +   R+I YYQWVPFIL ++ ++FY+P I+W+ + Y  SG NL+ +V  A  A       +   +  +AR ++D +      RQG+     R  ++         +H G ++ + YI IK LY  NV+ Q F++   LG N+   ++G+++L +++   EW QTG+FPRVT C    ++ +G  +++  QC L +NM NEKI++FLWFW +  GIVT  +   W   M   S+   F++++L +   H     +D   +  F   FLR DGVF++RM+  +AG++++++++
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVP-ATFTDAMEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGH----SRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELI 494          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 218.779 bits (556), Expect = 1.780e-64
Identity = 127/386 (32.90%), Postives = 203/386 (52.59%), Query Frame = 1
Query:  178 FKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKH 1335
            FK  T+   +D  D+LS++ + TLL    ++V+ K Y+   + C+      G  +E Y E+YC++  T       +IP +  D  +A+    I YYQWVP +L +Q  MFY+P  IW  + Y + G +  S++++A A  +     R   + ++   I D+L        G F   R           F K +G+   + YI IK +Y  NV  Q  I+ KFLG  N T  +G+   +++ +G+EW  +G+FPRVT C   +++ +   ++Y  QC L +NM NEKIY+F+WFW V V I T I+     YR++F S R  +I+  L    N  + +K MI +F    L+ DGV L+R +  +AG ++T +I   L + + EN +H
Sbjct:   15 FKPKTF---DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAE----IGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYR-----------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLG--NETFLWGFHTFADLYAGREWQDSGVFPRVTLCDF-SVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGENLQH 377          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 3.894e-57
Identity = 122/403 (30.27%), Postives = 203/403 (50.37%), Query Frame = 1
Query:  184 ISTYVGI---------EDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMG--TWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMM------HQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLD 1341
            I T++G+         +D++D+L++L +  +L+   ++++ K +  +P+ C       GS +E Y ENYCW   T    P +D+     +  R    R+++YYQWVPF L LQ   F  P  +W+    N SG  +  +V  A  + N     R+  I  + R +   L       Q N  + + +V+ T  F  F    G  +W+   Y+  K LY LNV  QL++M  FLG  N    +G+ V+ +++ G+ W ++G FPR   C    ++ V    +Y  QC L +N+ NEKI+V LWFW V++ + + +S+  WF  + F      F+K+ L +      +Q   R +   ++ F+ ++L  DGVF++RM+  +AG I   D+V  L E Y    K+ D
Sbjct:    4 IETFLGMAKYLSPREDDDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPGS-WEQYAENYCWSQDTYFVEPTQDVSLLKKE-ERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFS-NHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSAL-----RFQANMERKKVQVHKTVTFLNFQYSSGFISWI---YLFTKVLYFLNVFAQLYLMNYFLG-TNRHHWYGFGVVQDIVQGEPWERSGYFPRAAVCDFE-VRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAYDFQDKNKD 393          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|A8WVX4|INX19_CAEBR (Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=inx-19 PE=3 SV=3)

HSP 1 Score: 192.2 bits (487), Expect = 3.415e-54
Identity = 117/408 (28.68%), Postives = 218/408 (53.43%), Query Frame = 1
Query:  199 GIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDA-NAANNTPPVERKDKIERIARTIEDML-FQHRDYR---QGNFAKLRRKVYNTCNFCVFSKHM-GTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQN--YERSDK------------------PMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKE-NYKHLD 1341
            G +D  D+L++ ++  +L +  +V++ K Y   P+ C+        + E Y+E+YCW+  T      E++P +      A + ++I YYQWVPFIL  + +MF +P I W++ C  +SG N+++++N A +A       +R+  +E I     D L  Q  + R   +G  A+++           FS+ + G  + + Y   K LY +NV+ Q FI+   L  ++    FG+ VLS++ +G+ W +TG FPRVT C    ++++   N+Y  QCAL +N++NEK++ FLW W +++ I+T  S   W       S +  ++ +F+ + ++  Y++  K                   ++++F+ +FL+ DG+ ++RM+  +AGD+I   +V  L + Y+E N++  +
Sbjct:   19 GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWV-NPHSRESMEEYIESYCWIQNTYWIPMYENVPDDHT----AREEKQIGYYQWVPFILIAEALMFSLPCIFWRL-CSFQSGLNIQTLINAACDAQALLDYSDRQKAVEAITCNFVDNLDLQSPNGRIRARGWIARIK-----------FSRFLSGQCISIVYSFTKLLYSVNVVAQFFILNACLK-SSEFVFFGFQVLSDIWAGRPWTETGHFPRVTLCDF-EVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEYKKLQKFEKDATVERLYTVIAFAPHLLDSFVSDFLKSDGILMLRMISNHAGDMIVVQLVRNLWQEYRERNWREFE 407          
BLAST of Innexin vs. TrEMBL
Match: Q2L6M6 (Innexin OS=Dugesia japonica OX=6161 GN=inx9 PE=2 SV=1)

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 330/439 (75.17%), Postives = 392/439 (89.29%), Query Frame = 1
Query:  142 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV 1458
            MVA+EFL+L+GQFK+++YVG+EDFADKL+FLFSV +LI+SMMVVT+KSY FKPLACY AT P GSNF+NYLENYCWVHGTI+ LPGE+IPQ D DWA  D T+RI YYQWVPFILGLQCIMFY+P++IWQ+ICYNK GTNLES+  DA+AA+++PP ERKDKIERI RTIEDMLFQHRDYRQG  A +RR +Y  CNFCVFSKHMGTWL+LSYIL+KF+YG+NVIGQLF+MKKFLGFN++ SSFGYT+LSN+  GKEWHQTGIFPRVTYCY+  IKH+G +NKYV QCALP+NMLNEKIYVFLWFW+ LVGI+TAISIP+WF+R+A LSRRS FIK+FLMMHQ Y RSDK +IN+FI EFLRHDGVFL+RM+ INAGDI+TADIVNRL EIYKENYK++DF N++AY K +D +  L RN+N+S+SD+SIKKE ++NFV
Sbjct:    1 MVAQEFLSLVGQFKLTSYVGVEDFADKLNFLFSVVILIISMMVVTVKSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDADWAIVDQTKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPSERKDKIERIVRTIEDMLFQHRDYRQGKMADMRRNIYKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSMSSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYVGQCALPINMLNEKIYVFLWFWVFLVGIITAISIPMWFFRIAILSRRSSFIKKFLMMHQAYNRSDKQLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKNMDFLNFSAYPKPMDMTTGLRRNQNISSSDESIKKENLDNFV 439          
BLAST of Innexin vs. TrEMBL
Match: Q2L6M7 (Innexin OS=Dugesia japonica OX=6161 GN=inx8 PE=2 SV=1)

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 275/409 (67.24%), Postives = 340/409 (83.13%), Query Frame = 1
Query:  142 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTK 1368
            MVAEEF +L+ +FK+S+YVG+EDFADK++F+FSV L+ILSMMVVT+KSY FKPL+CY AT P GS F+NY+ENYCWVHGTI  LPGE+IPQ   +WA  D  +RI YYQWVPFILGLQCIMFY PKIIWQIICYNK GTNLE++VN A  A+ +PP +RK  ++RI+RTIEDML+QHRDYRQG  A  RR +Y+ CNF VFSKH+GTWL+LSY  IK LYG+NVIGQL++MK FLGF+N+ + FGYT+L NM++GKEWHQTGIFPRV+YCY  +I+H+G  N YV+QC LP+NMLNEKIYVFLWFW++LVGI+T ISI  W  +M FLS+RS FIK+ L MHQ+Y+R+D+ ++N FI+E+LRHDGVFL+RM+ INAGDI+TA+I+  L EIYKE Y   DFRN+  Y K
Sbjct:    1 MVAEEFFSLLSEFKVSSYVGVEDFADKMNFMFSVVLIILSMMVVTVKSYFFKPLSCYIATTPSGSGFDNYIENYCWVHGTIPILPGENIPQKTNEWAEWDANKRITYYQWVPFILGLQCIMFYTPKIIWQIICYNKIGTNLENLVNGAEEASKSPPEDRKALLDRISRTIEDMLYQHRDYRQGKIANTRRALYSRCNFLVFSKHLGTWLVLSYFFIKVLYGINVIGQLYLMKSFLGFDNSLTYFGYTILENMLNGKEWHQTGIFPRVSYCYNADIRHLGSTNAYVSQCTLPINMLNEKIYVFLWFWVLLVGIITLISIISWLIKMVFLSKRSSFIKKLLKMHQSYKRTDQLLVNQFIKEYLRHDGVFLIRMICINAGDIVTAEILGTLWEIYKEKYIDSDFRNFNNYKK 409          
BLAST of Innexin vs. TrEMBL
Match: A0A564YPR7 (Innexin OS=Hymenolepis diminuta OX=6216 GN=inx PE=3 SV=1)

HSP 1 Score: 480.715 bits (1236), Expect = 1.177e-163
Identity = 205/398 (51.51%), Postives = 296/398 (74.37%), Query Frame = 1
Query:  142 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKH 1335
            MV  EF++ + + +++ ++G+EDFADK+SF++SV +L+L   ++ +K YL   +ACY  T P G +F+ +L+N+CWVHGTI  L GE IPQN  +W  AD   RINYYQWVPF+LGLQCI+FYIP++IWQIICYN++GT+LE++++ AN A+NT   +R+  ++ +A T+ +MLFQHRDYR G  A  RRK +  C   V SK +GTWLI +Y+ IK +Y  N IGQL++M+ FLGFN + ++FGY V   MI+GK+W +T IFPRV++CYV +++H+G  N+YVAQC LPVNMLNEK+Y+FLWFW  +V   TA+SIPLW  R+     +  FIK+FL + + Y   D+ +++NF  +FLRHDGVFL+RM+ +NAGD++TAD++ ++ +IYK  +K+
Sbjct:    1 MVGVEFIDYLTKLRVNDFLGLEDFADKMSFMYSVLILLLCTTIIAVKQYLLASIACYIPTVPSGKDFDKFLQNFCWVHGTIPLLEGEHIPQNFSEWDEADKNLRINYYQWVPFMLGLQCILFYIPRVIWQIICYNRTGTDLENLISIANKASNTIEGDRQSLVKHVAGTMAEMLFQHRDYRVGRVADARRKAFKFCGVFVASKRLGTWLIFTYLFIKCIYLANAIGQLYLMQTFLGFNKSMTNFGYEVAKYMINGKDWDETRIFPRVSFCYVEHVRHLGTTNRYVAQCVLPVNMLNEKLYIFLWFWTAIVAFCTAVSIPLWIMRLGRQKNKEHFIKKFLRLQEIYNTKDREILHNFTSDFLRHDGVFLLRMISMNAGDVVTADVIVKMWDIYKTKFKN 398          
BLAST of Innexin vs. TrEMBL
Match: A0A0R3U3C1 (Innexin OS=Mesocestoides corti OX=53468 GN=inx PE=3 SV=1)

HSP 1 Score: 491.5 bits (1264), Expect = 5.365e-162
Identity = 217/438 (49.54%), Postives = 310/438 (70.78%), Query Frame = 1
Query:  142 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDLIRNKNLSASDDSIKKE-PMEN 1452
            MV  EF++ + + +++ ++G+EDFADK+SF++SV +L+LS  V+ +K YL   +ACY  T P G +F+ +L+N+CWVHGTI  L GE IPQN  +W  AD   RINYYQWVPF+LGLQCI+FYIP+++WQIICYN++GT+LE +V  AN A+NT   +RK  ++ +A T+E+MLFQHRDYR G  A  RRK +  C   V SK +GTWLI +Y+ IK +Y  N IGQL++M+ FLGFN +  +FGY V   MI G++W +T IFPRV++CY+ +++H+G  N+YVAQC LPVNMLNEK+Y+FLWFW  +V + TAISIPLW  R+     R+ FIK+FL + + Y   D+ +++NFI +FLRHDGVFL+RM+ +NAGD++T+D+V  +  IY+  YK+    N        D + D+I  + L +  ++ ++  P E 
Sbjct:    1 MVGIEFIDYLSKLRVNDFLGVEDFADKMSFMYSVLILLLSTTVIAVKQYLLASIACYIPTVPSGKDFDKFLQNFCWVHGTIPLLEGEHIPQNYSEWHEADQNLRINYYQWVPFMLGLQCILFYIPRVVWQIICYNRTGTDLEHLVTVANNASNTIENDRKGLVKHVAATMEEMLFQHRDYRHGKVADARRKAFKLCGMFVASKRLGTWLIFTYLFIKCIYLANAIGQLYLMQTFLGFNKSMGNFGYEVAKYMIEGRDWDETRIFPRVSFCYLEHVRHLGTTNRYVAQCVLPVNMLNEKLYIFLWFWTAIVAVCTAISIPLWIVRLGREKNRTHFIKKFLRLQEIYTTEDREILHNFICDFLRHDGVFLLRMISMNAGDVVTSDVVVEMWNIYRTKYKNRTMLN--------DIARDIIAQRLLESGGETTQRRVPYEK 430          

HSP 2 Score: 361.303 bits (926), Expect = 1.148e-111
Identity = 164/406 (40.39%), Postives = 259/406 (63.79%), Query Frame = 1
Query:  172 GQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDA-NAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGV-ANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK-----PM-------------INNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENY 1329
             +++++T +GI+D+AD++S+  S  + +L   +V+ K+Y+  PLAC+  T P GS+F++Y ++YCWVHGT      E IP++DV W   +  R+I YYQWVPFILGLQ I+FY+P + WQ I +N+ G +L +I+  A +A   T P +R+  +  +A+ +E +LF HRD+R+G  A L+R+++  C   + SK MGTW + SY+ IK LY +N +GQL++MK FLG+      FG T+  ++++G +W ++  FPRV +C V  ++H+G   N+Y+  CAL +NMLNEK+YVFLWFW + V I T +S+  WF R+A   R++  I+++L +    ++ +K     P+             +  FI EFLR DGVF+V ML +NAGD+IT +++  L   +   Y
Sbjct:  432 SKYQVATLIGIQDWADRMSYAHSTIIFLLCTAIVSAKTYILSPLACHVPTVPSGSDFDSYFDSYCWVHGTTPIRMNETIPEDDVAWTEFERERKITYYQWVPFILGLQTILFYLPHVAWQNITFNRLGADLTAIIVKAMDALKTTSPSKRETMVANVAKRLELLLFAHRDFRRGKKAALKRRLHAACGIFLVSKRMGTWTVFSYLCIKILYLVNAVGQLYLMKHFLGYGEDMVGFGLTIAHSLVAGIKWRESLFFPRVAFCSV-TVRHLGQKTNRYMGMCALAINMLNEKLYVFLWFWTLAVAIATFVSLINWFLRLAVRRRQASVIRKYLKLAPIVDKPEKEGSITPLSLSESLDPGRPDTVERFIHEFLRLDGVFIVHMLTMNAGDVITGEVIRLLWHTWVTKY 836          
BLAST of Innexin vs. TrEMBL
Match: W6UMB0 (Innexin OS=Echinococcus granulosus OX=6210 GN=inx PE=3 SV=1)

HSP 1 Score: 478.404 bits (1230), Expect = 7.028e-162
Identity = 209/426 (49.06%), Postives = 304/426 (71.36%), Query Frame = 1
Query:  142 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDF-----RNYTAYTKALDKSGDLIRNK 1404
            MV  EF++ + +  +S ++G+EDFADK+SF++SV +L+L   ++ +K YL   +ACY  T P G +FE +L+N+CWVHGTI  L GE IPQN  +W  AD+  RINYYQWVPF+LGLQCI+FY+P+++WQIICYN++GT+LE+++  AN A+NT   +RK  ++ +A T+ +MLFQHRDYR+G  A  RRK +      + SK +GTWLI +Y+ IK +Y  N IGQL++M+ FLGFN + S+FGY V   M++G++W +T IFPRV++CY+ +++H+G  N+YVAQC LPVNMLNEK+Y+FLWFW  +V + TA+SIPLW  R+     +  FIK+FL +   Y    K ++ NFI +FLRHDGVFL+RM+ +NAGD++TAD+V  + +IYK  YK+        R+  A  + L++ G+  + +
Sbjct:   61 MVGIEFIDYLTKLHVSDFLGLEDFADKMSFMYSVLILLLCTTIIAVKQYLLASIACYIPTVPSGKDFEKFLQNFCWVHGTIPILEGEHIPQNYSEWHDADENMRINYYQWVPFMLGLQCILFYVPRVVWQIICYNRTGTDLENLIAVANKASNTIENDRKMLVKHVAGTMAEMLFQHRDYRRGKVADARRKAFKFFGMFIASKRLGTWLIFTYLFIKCIYLANAIGQLYLMQTFLGFNKSMSNFGYEVARYMVNGRDWDETRIFPRVSFCYLEHVRHLGTTNRYVAQCVLPVNMLNEKLYIFLWFWTAIVAVCTAVSIPLWIMRLGREKNKVHFIKKFLRLQDIYTPEHKEILRNFISDFLRHDGVFLLRMISMNAGDVVTADVVVEMWDIYKTKYKNRAMLNDIARDIAAQRRQLEEGGETTQRR 486          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000080788.1 (SMESG000080788.1)

HSP 1 Score: 909.057 bits (2348), Expect = 0.000e+0
Identity = 436/439 (99.32%), Postives = 438/439 (99.77%), Query Frame = 1
Query:  142 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV 1458
            MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQC MFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRK+YNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNN+TSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV
Sbjct:    1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCFMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKIYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNSTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV 439          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000053975.1 (SMESG000053975.1)

HSP 1 Score: 426.402 bits (1095), Expect = 6.817e-146
Identity = 200/402 (49.75%), Postives = 273/402 (67.91%), Query Frame = 1
Query:  142 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFR 1347
            MVA EF +LI +       G+ED ADK+S +FSV +L + + +VTIKSY+ KP++CY +  P G NF++Y+ENYCW+HGTI   P + +  N V W   + T++INYYQWVPFILGLQCIMFYIPK+IWQI C+N++GTNL++I+  +      P  ER+ + E IA+ IE+ML  HRD+R    A +RR VY+ C+  + SK +GT ++ SY + K LY  N IGQLF+++  LGF N   +FG  +   ++SG E      FPRV +CY++ I+HVGV N YVAQC LPVNMLNEKIY FLW W++LV   T ISIPLW  R+     R  +I  FL M  +Y+   KP+I+ FI +FLRHDG+FL+RM+  NAGD+I A +VN L +IY + Y++ + R
Sbjct:    1 MVANEFFSLINRLNAVHNYGLEDLADKMSSIFSVLILSVCVSIVTIKSYVIKPISCYLSIGPSGGNFQDYIENYCWIHGTIPLYPNQKLSDNHVGWDELERTQKINYYQWVPFILGLQCIMFYIPKLIWQIFCFNQAGTNLDTIIKLSMKMAEIPISERRVENENIAKIIENMLVLHRDFRDSKIANIRRSVYSKCSLFMSSKRLGTMIVFSYFVTKLLYLTNGIGQLFMIQSVLGFYNYLPTFGSHLFWYIVSGTELETQHYFPRVVFCYLKRIRHVGVQNNYVAQCVLPVNMLNEKIYTFLWCWILLVSFATFISIPLWINRLYRADVREHYIGNFLQMLNSYDEHKKPLIHKFINDFLRHDGLFLLRMISNNAGDLIAAYLVNNLWDIYLKKYQNRNLR 402          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000065083.1 (SMESG000065083.1)

HSP 1 Score: 410.223 bits (1053), Expect = 1.553e-139
Identity = 195/422 (46.21%), Postives = 290/422 (68.72%), Query Frame = 1
Query:  142 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNN-TTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKP--MINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDLIR 1398
            MVA EFL+ + + ++ST VG+ED  D+L+F FSV +L++ +++VT+K Y+FKP++CY     GGSN  +Y+EN CWV GTI        P  D +W   +  + + YYQWVPF+LGLQCIMFY+PK++WQIICYN++GT+++ +V  AN A ++    R   +  +++T+E +L+QHRD+R G  AK RRK++N+  F + SK +GTWL+ SY+L+K  Y  N   QL IM+KFLGF++    +FG  V +N+ SG +W  T IFPRV+YC+V+ + H+GV N  VAQC LPVNMLNE+IY FLW W+++V  +T +SIP+W  R+  +  R  FI++FL++ +   +  K   ++  F  +FLRHDG+FL++M+ +NAGDIIT++IV +L  IYK NY + +F N     +  DKS  +I+
Sbjct:    1 MVASEFLDYLSKLQVSTNVGLEDLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEKHKML-YYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCFVK-VTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILIVLSLTILSIPIWILRILCIKYRRHFIRQFLIISEEITKDQKENYLLAKFESQFLRHDGIFLLKMISLNAGDIITSEIVCQLWNIYKTNYVNRNFLN-DGSDEDDDKSRTMIK 419          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000066858.1 (SMESG000066858.1)

HSP 1 Score: 405.986 bits (1042), Expect = 4.610e-138
Identity = 193/438 (44.06%), Postives = 288/438 (65.75%), Query Frame = 1
Query:  142 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFN-NTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMEN 1452
            MVA   L+LI   K++ Y G+ED  DK+SF  SV + I+   +VT K+Y+ KPL+CYTA +P GSNF+ YL NYCW+ GT+ ++PG+  PQ   D    D  ++INYYQWVPF+L LQCIMFY+P++ WQ++ YNK G +LE I  DA++A+N     RK K + IA+ + ++ F HRDY+ G +A  RRK++   +F + SK +GTWL   Y ++K ++  N +GQL+++++FLGF+ N           ++++G +W  + +FPRVT C + NIK +GV N Y+ QC L  NMLNEKIY+FLWFW+ +V +VT I+I LW  ++ FL  R++FIK+FL  H+ Y +S +  ++NFI+ FLRHDG F++ M+ +N GD+IT+ +V+ L EIY+  Y + D         + +K   L++     +SD S   EPM+N
Sbjct:    1 MVANTLLDLIKSHKVTDYQGLEDIGDKISFQISVIIYIICGFIVTSKTYILKPLSCYTAISPTGSNFDGYLRNYCWITGTVPWVPGDKFPQVGDDMKLDDSLKKINYYQWVPFVLALQCIMFYLPRLFWQLMSYNKIGIDLELIFKDASSASNDDEAARKKKAKGIAKNLANVFFFHRDYKYGTWANFRRKIFKFASFFMMSKRLGTWLTYWYFVMKLMFLANAVGQLYLIQRFLGFHGNNIFETSRVFFDSLVNGVQWTTSRLFPRVTVCSIDNIKLLGVENNYITQCVLSQNMLNEKIYMFLWFWLHIVIVVTLITIGLWCKKIIFLGSRAEFIKKFLKNHEVYRKSKRDSLDNFIQTFLRHDGSFIIMMMTMNCGDLITSHVVSELWEIYQSEYANSD--------TSSEKDPQLLKIYPNISSDFS---EPMKN 427          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000066886.1 (SMESG000066886.1)

HSP 1 Score: 405.601 bits (1041), Expect = 6.669e-138
Identity = 193/438 (44.06%), Postives = 288/438 (65.75%), Query Frame = 1
Query:  142 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFN-NTTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMEN 1452
            MVA   L+LI   K++ Y G+ED  DK+SF  SV + I+   +VT K+Y+ KPL+CYTA +P GSNF+ YL NYCW+ GT+ ++PG+  PQ   D    D  ++INYYQWVPF+L LQCIMFY+P++ WQ++ YNK G +LE I  DA++A+N     RK K + IA+ + ++ F HRDY+ G +A  RRK++   +F + SK +GTWL   Y ++K ++  N +GQL+++++FLGF+ N           ++++G +W  + +FPRVT C + NIK +GV N Y+ QC L  NMLNEKIY+FLWFW+ +V +VT I+I LW  ++ FL  R++FIK+FL  H+ Y +S +  ++NFI+ FLRHDG F++ M+ +N GD+IT+ +V+ L EIY+  Y + D         + +K   L++     +SD S   EPM+N
Sbjct:    1 MVANTLLDLIKSHKVTDYQGLEDIGDKISFQISVIIYIICGFIVTSKTYILKPLSCYTAISPTGSNFDGYLRNYCWITGTVPWVPGDKFPQVGDDMKLDDSLKKINYYQWVPFVLALQCIMFYLPRLFWQLMSYNKIGIDLELIFKDASSASNDDEAARKKKAKGIAKNLANVFFFHRDYKYGTWANFRRKIFKFASFFMMSKRLGTWLTYWYFVMKLMFLANAVGQLYLIQRFLGFHGNNIFETSRIFFDSLVNGVQWTTSRLFPRVTVCSIDNIKLLGVENNYITQCVLSQNMLNEKIYMFLWFWLHIVIVVTLITIGLWCKKIIFLGSRAEFIKKFLKNHEVYRKSKRDSLDNFIQTFLRHDGSFIIMMMTMNCGDLITSHVVSELWEIYQSEYANSD--------TSSEKDPQLLKIYPNISSDFS---EPMKN 427          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-93.830e-7133.87Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
unc-71.885e-6733.79Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
unc-76.977e-6733.42Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
unc-71.386e-6633.42Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
unc-71.733e-6633.42Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx21.992e-2728.66gene:FBgn0027108 transcript:FBtr0301860[more]
Inx21.992e-2728.66gene:FBgn0027108 transcript:FBtr0071005[more]
Inx21.992e-2728.66gene:FBgn0027108 transcript:FBtr0332314[more]
Inx21.992e-2728.66gene:FBgn0027108 transcript:FBtr0071006[more]
shakB3.011e-2527.39gene:FBgn0085387 transcript:FBtr0112570[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL4.872e-7033.87Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL7.407e-6533.42Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q19746|INX3_CAEEL1.780e-6432.90Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|Q23157|INX11_CAEEL3.894e-5730.27Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|A8WVX4|INX19_CAEBR3.415e-5428.68Innexin-19 OS=Caenorhabditis briggsae OX=6238 GN=i... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q2L6M60.000e+075.17Innexin OS=Dugesia japonica OX=6161 GN=inx9 PE=2 S... [more]
Q2L6M70.000e+067.24Innexin OS=Dugesia japonica OX=6161 GN=inx8 PE=2 S... [more]
A0A564YPR71.177e-16351.51Innexin OS=Hymenolepis diminuta OX=6216 GN=inx PE=... [more]
A0A0R3U3C15.365e-16249.54Innexin OS=Mesocestoides corti OX=53468 GN=inx PE=... [more]
W6UMB07.028e-16249.06Innexin OS=Echinococcus granulosus OX=6210 GN=inx ... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080788.10.000e+099.32SMESG000080788.1[more]
SMESG000053975.16.817e-14649.75SMESG000053975.1[more]
SMESG000065083.11.553e-13946.21SMESG000065083.1[more]
SMESG000066858.14.610e-13844.06SMESG000066858.1[more]
SMESG000066886.16.669e-13844.06SMESG000066886.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014488 ID=SMED30014488|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1559bp
TTGACCGAAAATTTTTAAAATTAAAATAAAATTCATATAATATAATTTTC
ACAACCGGAAATAAGGTTACATAAACAATGATTTCACTGACACCTTAATA
ATCTAGTGACTTTTGAAATACGATTCATTAAATTCTAAATCATGGTAGCC
GAGGAATTCTTAAATCTAATCGGGCAATTCAAGATATCCACATATGTTGG
AATTGAGGACTTCGCTGACAAACTTAGCTTCTTGTTCAGCGTAACACTAC
TAATACTTTCAATGATGGTTGTGACTATAAAGTCATACTTATTCAAGCCA
CTTGCGTGTTACACGGCGACCGCTCCTGGAGGATCAAATTTTGAAAATTA
TCTGGAAAATTACTGTTGGGTACATGGAACTATCACTTTTTTGCCTGGAG
AAGATATTCCTCAGAATGATGTTGACTGGGCTCGTGCTGATGATACTAGA
AGAATAAATTATTATCAATGGGTCCCATTTATACTTGGTCTCCAATGTAT
CATGTTTTATATCCCAAAAATAATTTGGCAAATAATATGCTACAATAAAT
CTGGAACGAATCTTGAAAGTATTGTTAATGATGCAAACGCTGCGAATAAT
ACGCCACCAGTTGAAAGAAAGGATAAAATTGAACGCATTGCGAGAACGAT
TGAAGATATGCTATTTCAACACAGAGATTATCGTCAAGGAAATTTCGCAA
AGTTACGAAGAAAAGTATATAATACTTGCAATTTTTGTGTTTTTTCAAAG
CACATGGGAACTTGGTTAATTTTATCATATATTTTAATTAAATTTCTTTA
CGGACTGAATGTAATTGGTCAGTTATTTATAATGAAAAAGTTTTTGGGAT
TTAATAATACTACTTCGTCATTTGGTTACACTGTATTATCTAATATGATA
TCTGGCAAAGAATGGCACCAAACTGGGATTTTCCCCAGAGTCACATATTG
TTACGTAAGAAACATCAAACATGTTGGAGTGGCTAACAAATACGTTGCTC
AATGTGCTCTACCAGTAAACATGCTTAATGAAAAGATTTATGTGTTTTTA
TGGTTTTGGATGGTTTTAGTTGGAATAGTAACGGCAATTAGTATTCCACT
CTGGTTTTATCGGATGGCTTTTCTTAGTAGACGAAGTAAATTCATTAAAA
GGTTTTTGATGATGCACCAAAATTATGAGAGATCAGATAAACCTATGATA
AATAATTTTATTGAAGAATTCCTTCGTCATGATGGAGTGTTCTTAGTGCG
AATGCTGTTTATCAATGCTGGGGATATCATTACGGCAGACATTGTTAACA
GACTCTTGGAAATATACAAAGAGAATTACAAACATTTGGATTTTCGGAAT
TATACAGCTTATACGAAAGCACTTGATAAATCGGGGGATTTAATACGAAA
TAAAAATTTATCCGCCTCTGATGATTCTATTAAAAAGGAGCCAATGGAGA
ATTTTGTTTGAATTTCACGTGAAACTTTCATTAATATTTAATTGCCTATC
TCAAACTTTAATTGATTATTTAATTTTTTTATAATAAATCTCAATTCATT
TAAAAAAAA
back to top

protein sequence of SMED30014488-orf-1

>SMED30014488-orf-1 ID=SMED30014488-orf-1|Name=SMED30014488-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=440bp
MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYL
FKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARAD
DTRRINYYQWVPFILGLQCIMFYIPKIIWQIICYNKSGTNLESIVNDANA
ANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKVYNTCNFCV
FSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNTTSSFGYTVLS
NMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIY
VFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDK
PMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLD
FRNYTAYTKALDKSGDLIRNKNLSASDDSIKKEPMENFV*
back to top
Aliases
The feature 'Innexin' has the following synonyms
Synonym
Dj-inx9
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005921gap junction
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
IPR006605G2_nidogen/fibulin_G2F
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 213..227
score: 46.4
coord: 288..304
score: 59.29
coord: 107..129
score: 57.22
coord: 45..56
score: 29.67
coord: 74..83
score: 41.6
coord: 263..272
score: 54.4
IPR000990InnexinPFAMPF00876Innexincoord: 22..392
e-value: 3.0E-111
score: 372.1
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 14..400
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 17..398
score: 31.214
NoneNo IPR availableTMHMMTMhelixcoord: 29..51
NoneNo IPR availableTMHMMTMhelixcoord: 208..230
NoneNo IPR availableTMHMMTMhelixcoord: 301..323
NoneNo IPR availableTMHMMTMhelixcoord: 110..132