Tumor susceptibility gene 101 protein

Overview
NameTumor susceptibility gene 101 protein
Smed IDSMED30014474
Length (bp)1668
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tumor susceptibility gene 101 protein (SMED30014474) t-SNE clustered cells

Violin plots show distribution of expression levels for Tumor susceptibility gene 101 protein (SMED30014474) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tumor susceptibility gene 101 protein (SMED30014474) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tumor susceptibility gene 101 protein (SMED30014474) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014474

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30014474h1SMcG0000666 Contig5044GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30014474h1SMcG0000666 Contig5044GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30014474h1SMcG0000666 Contig5044GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30014474h1SMcG0000666 Contig5044GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30014474h1SMcG0000666 Contig36279newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30014474h1SMcG0000666 Contig36279uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30014474h1SMcG0000666 DN293419smed_ncbi_20240424PMID:16890156
Guo et al., 2006
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Human
Match: TSG101 (tumor susceptibility 101 [Source:HGNC Symbol;Acc:HGNC:15971])

HSP 1 Score: 275.789 bits (704), Expect = 5.936e-87
Identity = 151/388 (38.92%), Postives = 231/388 (59.54%), Query Frame = 1
Query:   55 SKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQ-----SNIPTNSYIPGVANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            SKY Y+D    E  + I +Y DL P ++SYV NDG  R L+ L GTI V + G TYNIP+ ++L +TYPY  PI +VKPT +M IK  +HVDA G+IYLPYL+EW   +SD+ GL+ +M + FG+ PPVFS+   ++YP   A  P               +    G  S + +  PP P         P   Y    ++  P QPPV ++       I+ED ++ S++SAV DK      +   +  AE+  L+ T  DLKKG + +++M+  ++++ A V +  + L +++EEL + L K E + +   + D+ +   APLY+Q++NLY EE ++ED ++++GEA+ + VID+++FLK VR LSR+QF LRA ++K R+ AGL D+
Sbjct:   13 SKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSY----------MPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENN-DIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDL 389          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Human
Match: TSG101 (tumor susceptibility 101 [Source:HGNC Symbol;Acc:HGNC:15971])

HSP 1 Score: 243.432 bits (620), Expect = 6.770e-75
Identity = 137/367 (37.33%), Postives = 211/367 (57.49%), Query Frame = 1
Query:   55 SKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQSNIPTNS------------YIPGVANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLK 1119
            SKY Y+D    E  + I +Y DL P ++SYV NDG  R L+ L GTI V + G TYNIP+ ++L +TYPY  PI +VKPT +M IK  +HVDA G+IYLPYL+EW   +SD+ GL+ +M + FG+ PPVFS+   ++YP   A  P                S   G+  G +    PYP    P  S            Y    ++  P QPPV ++       I+ED ++ S++SAV DK      +   +  AE+  L+ T  DLKKG + +++M+  ++++ A V +  + L +++EEL + L K E + +   + D+ +   APLY+Q++NLY EE ++ED ++++GEA+ + VID+++FLK
Sbjct:   13 SKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNT-------------SYMPGMPGGIS----PYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENN-DIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLK 361          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Human
Match: UEVLD (UEV and lactate/malate dehyrogenase domains [Source:HGNC Symbol;Acc:HGNC:30866])

HSP 1 Score: 119.783 bits (299), Expect = 2.139e-30
Identity = 58/142 (40.85%), Postives = 86/142 (60.56%), Query Frame = 1
Query:   31 EGMNRLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTT 456
            EG+ RL   KY ++D    E+++    +P     M++YV  D  Q+ L+   GTI V + G TYNIP+  ++ +++P+  PI ++KPT  M I   +HVDAQGRIYLPYL  WS  KS I GL+  M  +F E  P++S ++
Sbjct:    6 EGLRRL-LGKYKFRDLTVEELRNVNVFFPHFKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELPMYSLSS 146          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Human
Match: UEVLD (UEV and lactate/malate dehyrogenase domains [Source:HGNC Symbol;Acc:HGNC:30866])

HSP 1 Score: 120.168 bits (300), Expect = 4.247e-29
Identity = 58/142 (40.85%), Postives = 86/142 (60.56%), Query Frame = 1
Query:   31 EGMNRLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTT 456
            EG+ RL   KY ++D    E+++    +P     M++YV  D  Q+ L+   GTI V + G TYNIP+  ++ +++P+  PI ++KPT  M I   +HVDAQGRIYLPYL  WS  KS I GL+  M  +F E  P++S ++
Sbjct:    6 EGLRRL-LGKYKFRDLTVEELRNVNVFFPHFKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELPMYSLSS 146          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Human
Match: UEVLD (UEV and lactate/malate dehyrogenase domains [Source:HGNC Symbol;Acc:HGNC:30866])

HSP 1 Score: 120.553 bits (301), Expect = 1.190e-28
Identity = 58/142 (40.85%), Postives = 86/142 (60.56%), Query Frame = 1
Query:   31 EGMNRLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTT 456
            EG+ RL   KY ++D    E+++    +P     M++YV  D  Q+ L+   GTI V + G TYNIP+  ++ +++P+  PI ++KPT  M I   +HVDAQGRIYLPYL  WS  KS I GL+  M  +F E  P++S ++
Sbjct:    6 EGLRRL-LGKYKFRDLTVEELRNVNVFFPHFKYSMDTYVFKDSSQKDLLNFTGTIPVMYQGNTYNIPIRFWILDSHPFAPPICFLKPTANMGILVGKHVDAQGRIYLPYLQNWSHPKSVIVGLIKEMIAKFQEELPMYSLSS 146          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Celegans
Match: tsg-101 (Tumor Susceptibility Gene homolog [Source:UniProtKB/TrEMBL;Acc:O76258])

HSP 1 Score: 218.009 bits (554), Expect = 8.155e-65
Identity = 139/417 (33.33%), Postives = 229/417 (54.92%), Query Frame = 1
Query:   67 YKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATANXXXXXXXXXXXXXXXFPLS-----NQHGIGSGWANSTPPY------------PQSNIPTNSYIP-GVANSNPYQP------------------PVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGIN----YDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLP 1197
            Y D  K ++   +  + DLSP  ++++  DG +RT   L GTI VY+ G  YNIPV+VYL +T+PY API YV PT TM+IK++EHV+ +G+++LPYLNEW     D+ GLL +M + F E+ PVF+++  ++     +      G S   + + +P S       +  GSG A   P              P  N+P ++  P G + ++PY                       S S GG+  I  D ++ S++SAVE+K      +    N AE+  +  T+ +L++G + +K+MLE++E   ++++    ++Y      KA+LAK  +  D G       D+A++ A PL+RQ+V  Y ++ + +D +Y +G+++ K+ I +  +L+ VR++SR QF+ RAT++KCR  AGLP
Sbjct:   17 YADSAKKDIIGALSQFKDLSPGTDTFMFPDGKRRTAFRLKGTIPVYYKGACYNIPVTVYLWDTHPYYAPICYVNPTSTMVIKESEHVNKEGKVFLPYLNEWRFPGYDLSGLLQVMAMVFQEKCPVFARSAANSA-TNASATNPSAGSSASSTPTPYPSSQPTMPTPYPTGSGAAPYPPSSTPYPSAGAMGYNPYMNVPQSTPYPMGASGASPYPSASSNPAPPPPRPPPVTAQTSVSSSSGGT--IQADTIRASVMSAVEEKIRAKLRERMGTNSAEMASIRTTSDELREGQQKLKRMLEELETQRSSLQ-TACEIYTAK---KAELAKALS--DAGGTDAPPIDEAIDAAFPLHRQIVLNYAKDLTCDDVIYSLGQSLKKRQITLAEYLRHVRDVSREQFIYRATMQKCRRTAGLP 424          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Fly
Match: TSG101 (gene:FBgn0036666 transcript:FBtr0075329)

HSP 1 Score: 255.758 bits (652), Expect = 2.271e-79
Identity = 150/399 (37.59%), Postives = 224/399 (56.14%), Query Frame = 1
Query:   52 FSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQ-SNI---PTNSYIPGVANSNPYQPPVNSISVGG--------------SALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGL 1194
             SKY Y    K +V D +  +  L+  ++ +V NDG  + L T+ GTI V +   TY IP+ ++L +T+P  AP+ +VKPTPTM IK + +VD  G++YLPYL++W    SD+  L+ +M + FG+ PPV+SK  E        N      G+   S S  P     G G    ++ PPYP  SN+   P     P   +  P  P     + GG              +  I E+ +K SI+SA++DK  R   +   Q  AEIE L  T ++L +G+  I  ++E +ER+  ++++    L ++ +EL+  L   E+     IN D+AV   APLYRQL+N Y +E + EDA+Y++GE +   VID+E FLK VR+LSR+QF+LRAT++KCR+KAGL
Sbjct:   13 LSKYKYVAATKKDVVDVVTSFRSLTYDLQRFVFNDGSSKELFTIQGTIPVVYKNNTYYIPICIWLMDTHPQNAPMCFVKPTPTMQIKVSMYVDHNGKVYLPYLHDWQPHSSDLLSLIQVMIVTFGDHPPVYSKPKEQIAAPYPTNSYMPQPGAPGGSNSFLPYPTAGGAG---GSNFPPYPTGSNVGPYPPTPAGPAGGSGYPAYPNFIQPTAGGYPPAAGYNPSNPSSTGTITEEHIKASIISAIDDKLRRRVQEKVNQYQAEIETLNRTKQELLEGSAKIDAIIERLEREHIDMQKNISILKDKEQELEKALEDLESAE--AINPDEAVTTTAPLYRQLLNAYADEAATEDAIYYLGEGLRGGVIDLETFLKHVRQLSRKQFILRATMQKCRQKAGL 406          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Zebrafish
Match: tsg101b (tumor susceptibility 101b [Source:ZFIN;Acc:ZDB-GENE-130530-542])

HSP 1 Score: 277.33 bits (708), Expect = 1.040e-87
Identity = 158/391 (40.41%), Postives = 237/391 (60.61%), Query Frame = 1
Query:   43 RLNFSKY-TYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSK-TTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGVANSNPYQPPVNSISVGGS--ALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            R  FSKY  Y+D    ++ +   +Y DL P M++YV NDG  + L++L GT+ V + G  YNIPV ++L +TYPY  PI +VKPT  M+IK  +HVDA G++YLPYL+EW   +SD+ GL+ +M + FGE PPVFS+ +++  YP   A     P  SY  +  G P S  H    G      PYP     T S  P  + S+ Y P  +  +VG S    I ED ++ S++SAV DK  R   +      AE++ L  T  DLK+G + +++M+  ++ + A V R   +L +++EEL A L + E + +   + DD +   APLY+Q++NLY EE ++ED ++++GEA+ + VID+++FLK VR LSR+QF LRA ++K R+ AGL D+
Sbjct:   10 RKVFSKYYKYRDLTARDITNVTNIYKDLKPMMDNYVFNDGSTKELLSLTGTVPVNYRGNIYNIPVCLWLLDTYPYNPPICFVKPTSAMMIKPGKHVDANGKVYLPYLHEWKPPQSDLYGLIQVMIVVFGEEPPVFSRPSSQPAYPAFPA--AGPPNTSYMPTPQGLPYSQGHSANPGVFQGY-PYPA----TGSGYPTTSGSSMYTPMSSVPTVGPSRDGTIGEDTIRASLVSAVSDKLRRRMKEEMDGAQAELDALRRTEEDLKRGHQKLEEMVTKLDVEMAEVDRNIDRLKQKDEELTAALERMENQAEDN-DIDDVIVPTAPLYKQILNLYAEENAIEDTIFYLGEALRRDVIDLDVFLKHVRLLSRKQFQLRALMQKARKIAGLSDL 392          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Zebrafish
Match: tsg101a (tumor susceptibility 101a [Source:ZFIN;Acc:ZDB-GENE-030217-1])

HSP 1 Score: 270.781 bits (691), Expect = 3.589e-85
Identity = 153/394 (38.83%), Postives = 229/394 (58.12%), Query Frame = 1
Query:   31 EGMNRLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSK-TTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGVANSNPY--QPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            EG  +    +Y Y+D    E+ + I  Y DL P M++YV NDG  R L++L GT+ V + G  YNIPV ++L +TYPY  PI +VKPT  M+IK  +H+DA G+IYLPYL+EW   +SD+ GL+ +M + FGE PPVFS+ TT+  Y    A      G        G P  + +G      N            N+Y P     + Y  Q PV ++       I ED ++ S++SAV DK      +   +  AE++ L+ T  DLKKG + ++ M+  ++++ A V R  + L +++EEL   L K E + +   + DD +   APLY+Q++NLY EE ++ED ++++GEA+ + VID+E+FLK VR LSR+QF LRA ++K R+ AGL D+
Sbjct:    6 EGALKKMLKQYKYRDLTVREITNVISQYKDLKPVMDAYVFNDGSSRDLMSLTGTVPVSYRGNVYNIPVCLWLLDTYPYNPPICFVKPTSAMMIKTGKHIDANGKIYLPYLHEWKHPQSDLYGLIQVMIVVFGEEPPVFSRPTTQPPYQAFQAT-----GPPNQSYMPGMPAVSPYGPNQ---NPCGYPGYPYPGGNAY-PATGGPSHYTSQTPVTTVGPSRDGTIGEDTIRASLISAVSDKLRWRMKEEMDRAQAELDALKRTEEDLKKGHQKLEDMVSRLDQEVAEVDRNIELLKKKDEELSEALEKMENQSENN-DIDDVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLEVFLKHVRLLSRKQFQLRALMQKARKTAGLSDL 389          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Zebrafish
Match: uevld (UEV and lactate/malate dehyrogenase domains [Source:NCBI gene;Acc:445225])

HSP 1 Score: 124.02 bits (310), Expect = 4.914e-30
Identity = 53/135 (39.26%), Postives = 91/135 (67.41%), Query Frame = 1
Query:   52 FSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTT 456
             SKY ++D    E+Q   +VYPD+     +Y S+D +Q+ L+ L G I V + G++YNIP+ ++L +++P+  PI Y++PT +M+I++ +HVD++GRI+LP L+ W   KS +  LL+ M  +F E PP+ +K++
Sbjct:   12 LSKYKFRDVAVEELQKVYRVYPDMKIMAGTYTSSDSLQKDLLKLVGNIPVVYQGRSYNIPILLWLLDSFPFTPPICYLRPTSSMVIREGKHVDSKGRIHLPALHNWDHPKSSVNALLAEMIGKFEEEPPLGTKSS 146          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Zebrafish
Match: uevld (UEV and lactate/malate dehyrogenase domains [Source:NCBI gene;Acc:445225])

HSP 1 Score: 124.02 bits (310), Expect = 4.914e-30
Identity = 53/135 (39.26%), Postives = 91/135 (67.41%), Query Frame = 1
Query:   52 FSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTT 456
             SKY ++D    E+Q   +VYPD+     +Y S+D +Q+ L+ L G I V + G++YNIP+ ++L +++P+  PI Y++PT +M+I++ +HVD++GRI+LP L+ W   KS +  LL+ M  +F E PP+ +K++
Sbjct:   12 LSKYKFRDVAVEELQKVYRVYPDMKIMAGTYTSSDSLQKDLLKLVGNIPVVYQGRSYNIPILLWLLDSFPFTPPICYLRPTSSMVIREGKHVDSKGRIHLPALHNWDHPKSSVNALLAEMIGKFEEEPPLGTKSS 146          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Zebrafish
Match: zgc:123278 (zgc:123278 [Source:ZFIN;Acc:ZDB-GENE-051127-21])

HSP 1 Score: 115.931 bits (289), Expect = 1.560e-29
Identity = 50/127 (39.37%), Postives = 81/127 (63.78%), Query Frame = 1
Query:   61 YTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPV 441
            Y ++  V +E+   +  Y  L P +E +V NDG  + L+ L GTI+V++  + YNIPV+++L E+YP  API Y+KPT  M++  +++V++ G I +PYL+EW   K D+  L+ +M   F E PP+
Sbjct:   17 YDHRTEVLSEISLVLSHYQHLEPVLEKFVFNDGTAKNLINLTGTIQVFYERKQYNIPVTLWLRESYPRTAPICYLKPTCEMVVVTSKYVNSNGEIMMPYLDEWKHTKCDLHSLIQVMMATFSEVPPL 143          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Xenopus
Match: thbs2 (thrombospondin 2 [Source:Xenbase;Acc:XB-GENE-482462])

HSP 1 Score: 151.369 bits (381), Expect = 1.015e-41
Identity = 73/144 (50.69%), Postives = 98/144 (68.06%), Query Frame = 1
Query:   58 KYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTE-STYPMATAN 486
            +Y Y+D    E+ +   +Y DL P M+SYV NDG  R L++L GTI V + G TYNIP+ ++L +TYP+  PI +VKPT TM IK  +HVDA G+IYLPYL+EW    SD+ GL+ I+ + FGE PPVFS++T  + YPM  A 
Sbjct:    1 QYKYRDLSVREILNVTSLYRDLKPIMDSYVFNDGSSRELLSLSGTIPVPYKGNTYNIPICLWLLDTYPFNPPICFVKPTSTMTIKTGKHVDANGKIYLPYLHEWKHPPSDLLGLIQILIVVFGEEPPVFSRSTAPAPYPMYPAT 144          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Xenopus
Match: uevld (UEV and lactate/malate dehyrogenase domains [Source:NCBI gene;Acc:493332])

HSP 1 Score: 120.939 bits (302), Expect = 6.651e-29
Identity = 51/137 (37.23%), Postives = 84/137 (61.31%), Query Frame = 1
Query:   49 NFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTE 459
            +   Y ++D    E++D  + +P     ME+Y   DG Q+ L+ L GT+ +   G TYNIP+ +++ +++P+  P+ ++KP+  M I+   H+DAQGRIYLPYL  WS  KS + GL+  M ++F E  P++S + E
Sbjct:    4 DCGAYKFRDLTIEELKDLNRTFPSFIFSMETYTFRDGSQKDLLNLTGTVPMKHQGTTYNIPICLWILDSHPFAPPLCFLKPSGNMGIRVGRHIDAQGRIYLPYLQNWSHPKSTVTGLIREMAVKFEEELPLYSLSAE 140          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Xenopus
Match: uevld (UEV and lactate/malate dehyrogenase domains [Source:NCBI gene;Acc:493332])

HSP 1 Score: 120.553 bits (301), Expect = 1.202e-28
Identity = 51/133 (38.35%), Postives = 83/133 (62.41%), Query Frame = 1
Query:   61 YTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTE 459
            Y ++D    E++D  + +P     ME+Y   DG Q+ L+ L GT+ +   G TYNIP+ +++ +++P+  P+ ++KP+  M I+   H+DAQGRIYLPYL  WS  KS + GL+  M ++F E  P++S + E
Sbjct:   14 YKFRDLTIEELKDLNRTFPSFIFSMETYTFRDGSQKDLLNLTGTVPMKHQGTTYNIPICLWILDSHPFAPPLCFLKPSGNMGIRVGRHIDAQGRIYLPYLQNWSHPKSTVTGLIREMAVKFEEELPLYSLSAE 146          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Xenopus
Match: uevld (UEV and lactate/malate dehyrogenase domains [Source:NCBI gene;Acc:493332])

HSP 1 Score: 102.834 bits (255), Expect = 8.840e-23
Identity = 43/102 (42.16%), Postives = 68/102 (66.67%), Query Frame = 1
Query:  154 DGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTE 459
            DG Q+ L+ L GT+ +   G TYNIP+ +++ +++P+  P+ ++KP+  M I+   H+DAQGRIYLPYL  WS  KS + GL+  M ++F E  P++S + E
Sbjct:   12 DGSQKDLLNLTGTVPMKHQGTTYNIPICLWILDSHPFAPPLCFLKPSGNMGIRVGRHIDAQGRIYLPYLQNWSHPKSTVTGLIREMAVKFEEELPLYSLSAE 113          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Mouse
Match: Tsg101 (tumor susceptibility gene 101 [Source:MGI Symbol;Acc:MGI:106581])

HSP 1 Score: 273.092 bits (697), Expect = 3.967e-86
Identity = 154/397 (38.79%), Postives = 232/397 (58.44%), Query Frame = 1
Query:   52 FSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSK-TTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGV------------ANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
             SKY Y+D    +  + I +Y DL P ++SYV NDG  R LV L GTI V + G  YNIP+ ++L +TYPY  PI +VKPT +M IK  +HVDA G+IYLPYL++W   +S++  L+ IM + FGE PPVFS+ T  ++YP  TA  P                S   G+ SG +     YP    P  S  PG             ++  P QPPV ++       I+ED ++ S++SAV DK      +      AE+  L+ T  DLKKG + +++M+  ++++ A V +  + L +++EEL + L K E + +   + D+ +   APLY+Q++NLY EE ++ED ++++GEA+ + VID+++FLK VR LSR+QF LRA ++K R+ AGL D+
Sbjct:   12 MSKYKYRDLTVRQTVNVIAMYKDLKPVLDSYVFNDGSSRELVNLTGTIPVRYRGNIYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHDWKHPRSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNT-------------SYMPGMPSGISA----YPSGYPPNPSGYPGCPYPPAGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDGAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENN-DIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDL 390          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Mouse
Match: Tsg101 (tumor susceptibility gene 101 [Source:MGI Symbol;Acc:MGI:106581])

HSP 1 Score: 181.03 bits (458), Expect = 1.088e-52
Identity = 109/310 (35.16%), Postives = 170/310 (54.84%), Query Frame = 1
Query:  274 IPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGVANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            I +VKPT +M IK  +HVDA G+IYLPYL++W   +S++  L+ IM + FGE PPVFS+ T S                                      S PPY  +                   P NS S  G+  I+ED ++ S++SAV DK      +      AE+  L+ T  DLKKG + +++M+  ++++ A V +  + L +++EEL + L K E + +   + D+ +   APLY+Q++NLY EE ++ED ++++GEA+ + VID+++FLK VR LSR+QF LRA ++K R+ AGL D+
Sbjct:    1 ICFVKPTSSMTIKTGKHVDANGKIYLPYLHDWKHPRSELLELIQIMIVIFGEEPPVFSRPTVSA-------------------------------------SYPPYTATG------------------PPNSPSRDGT--ISEDTIRASLISAVSDKLRWRMKEEMDGAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENN-DIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDL 252          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Mouse
Match: Tsg101 (tumor susceptibility gene 101 [Source:MGI Symbol;Acc:MGI:106581])

HSP 1 Score: 115.161 bits (287), Expect = 8.115e-30
Identity = 60/146 (41.10%), Postives = 84/146 (57.53%), Query Frame = 1
Query:   52 FSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSK-TTESTYPMATAN 486
             SKY Y+D    +  + I +Y DL P ++SY                      G  YNIP+ ++L +TYPY  PI +VKPT +M IK  +HVDA G+IYLPYL++W   +S++  L+ IM + FGE PPVFS+ T  ++YP  TA 
Sbjct:   12 MSKYKYRDLTVRQTVNVIAMYKDLKPVLDSY----------------------GNIYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHDWKHPRSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTAT 135          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Mouse
Match: Uevld (UEV and lactate/malate dehyrogenase domains [Source:MGI Symbol;Acc:MGI:1860490])

HSP 1 Score: 116.316 bits (290), Expect = 6.199e-29
Identity = 56/139 (40.29%), Postives = 85/139 (61.15%), Query Frame = 1
Query:   31 EGMNRLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFS 447
            EG+ RL   KY ++D    E+++    +P     +++YV  D  Q+ L+   GTI V + G+TYNIP+  ++ +++P+  PI ++KPT  M I   +HVDA+GRIYLPYL  WS  KS I GL+  M  +F E  P++S
Sbjct:    6 EGVRRL-LGKYKFRDLTVEELKNVSVSFPHFRYSVDTYVFKDTSQKDLLNFTGTIPVMYQGKTYNIPIRFWILDSHPFAPPICFLKPTANMEISVGKHVDAKGRIYLPYLQNWSHPKSAIVGLIKEMIAKFQEELPLYS 143          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Mouse
Match: Uevld (UEV and lactate/malate dehyrogenase domains [Source:MGI Symbol;Acc:MGI:1860490])

HSP 1 Score: 117.472 bits (293), Expect = 9.601e-28
Identity = 56/139 (40.29%), Postives = 85/139 (61.15%), Query Frame = 1
Query:   31 EGMNRLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFS 447
            EG+ RL   KY ++D    E+++    +P     +++YV  D  Q+ L+   GTI V + G+TYNIP+  ++ +++P+  PI ++KPT  M I   +HVDA+GRIYLPYL  WS  KS I GL+  M  +F E  P++S
Sbjct:    6 EGVRRL-LGKYKFRDLTVEELKNVSVSFPHFRYSVDTYVFKDTSQKDLLNFTGTIPVMYQGKTYNIPIRFWILDSHPFAPPICFLKPTANMEISVGKHVDAKGRIYLPYLQNWSHPKSAIVGLIKEMIAKFQEELPLYS 143          
BLAST of Tumor susceptibility gene 101 protein vs. UniProt/SwissProt
Match: sp|Q99816|TS101_HUMAN (Tumor susceptibility gene 101 protein OS=Homo sapiens OX=9606 GN=TSG101 PE=1 SV=2)

HSP 1 Score: 275.789 bits (704), Expect = 2.851e-86
Identity = 151/388 (38.92%), Postives = 231/388 (59.54%), Query Frame = 1
Query:   55 SKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQ-----SNIPTNSYIPGVANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            SKY Y+D    E  + I +Y DL P ++SYV NDG  R L+ L GTI V + G TYNIP+ ++L +TYPY  PI +VKPT +M IK  +HVDA G+IYLPYL+EW   +SD+ GL+ +M + FG+ PPVFS+   ++YP   A  P               +    G  S + +  PP P         P   Y    ++  P QPPV ++       I+ED ++ S++SAV DK      +   +  AE+  L+ T  DLKKG + +++M+  ++++ A V +  + L +++EEL + L K E + +   + D+ +   APLY+Q++NLY EE ++ED ++++GEA+ + VID+++FLK VR LSR+QF LRA ++K R+ AGL D+
Sbjct:   13 SKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRPISASYPPYQATGPPNTSY----------MPGMPGGISPYPSGYPPNPSGYPGCPYPPGGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDRAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENN-DIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDL 389          
BLAST of Tumor susceptibility gene 101 protein vs. UniProt/SwissProt
Match: sp|Q61187|TS101_MOUSE (Tumor susceptibility gene 101 protein OS=Mus musculus OX=10090 GN=Tsg101 PE=1 SV=2)

HSP 1 Score: 273.092 bits (697), Expect = 2.775e-85
Identity = 154/397 (38.79%), Postives = 232/397 (58.44%), Query Frame = 1
Query:   52 FSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSK-TTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGV------------ANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
             SKY Y+D    +  + I +Y DL P ++SYV NDG  R LV L GTI V + G  YNIP+ ++L +TYPY  PI +VKPT +M IK  +HVDA G+IYLPYL++W   +S++  L+ IM + FGE PPVFS+ T  ++YP  TA  P                S   G+ SG +     YP    P  S  PG             ++  P QPPV ++       I+ED ++ S++SAV DK      +      AE+  L+ T  DLKKG + +++M+  ++++ A V +  + L +++EEL + L K E + +   + D+ +   APLY+Q++NLY EE ++ED ++++GEA+ + VID+++FLK VR LSR+QF LRA ++K R+ AGL D+
Sbjct:   12 MSKYKYRDLTVRQTVNVIAMYKDLKPVLDSYVFNDGSSRELVNLTGTIPVRYRGNIYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHDWKHPRSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNT-------------SYMPGMPSGISA----YPSGYPPNPSGYPGCPYPPAGPYPATTSSQYPSQPPVTTVGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDGAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENN-DIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDL 390          
BLAST of Tumor susceptibility gene 101 protein vs. UniProt/SwissProt
Match: sp|Q6IRE4|TS101_RAT (Tumor susceptibility gene 101 protein OS=Rattus norvegicus OX=10116 GN=Tsg101 PE=1 SV=1)

HSP 1 Score: 269.24 bits (687), Expect = 9.638e-84
Identity = 152/397 (38.29%), Postives = 230/397 (57.93%), Query Frame = 1
Query:   52 FSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSK-TTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGV------------ANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
             SKY Y+D    +  + I +Y DL P ++SYV NDG  R LV L GTI V + G  YNIP+ ++L +TYPY  PI +VKPT +M IK  +HVDA G+IYLPYL++W   +S++  L+ IM + FGE PPVFS+ T  ++YP  TA              + +  S   GI +        YP    P  S  PG             ++  P QPPV +        I+ED ++ S++SAV DK      +      AE+  L+ T  DLKKG + +++M+  ++++ A V +  + L +++EEL + L K E + +   + D+ +   APLY+Q++NLY EE ++ED ++++GEA+ + VID+++FLK VR LSR+QF LRA ++K R+ AGL D+
Sbjct:   12 MSKYKYRDLTVRQTVNVIAMYKDLKPVLDSYVFNDGSSRELVNLTGTIPVRYRGNIYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHDWKHPRSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTA---------AGPPNTSYLPSMPSGISA--------YPSGYPPNPSGYPGCPYPPAGPYPATTSSQYPSQPPVTTAGPSRDGTISEDTIRASLISAVSDKLRWRMKEEMDGAQAELNALKRTEEDLKKGHQKLEEMVTRLDQEVAEVDKNIELLKKKDEELSSALEKMENQSENN-DIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDL 390          
BLAST of Tumor susceptibility gene 101 protein vs. UniProt/SwissProt
Match: sp|Q6DBY5|UEVLD_DANRE (Ubiquitin-conjugating enzyme E2 variant 3 OS=Danio rerio OX=7955 GN=uevld PE=2 SV=1)

HSP 1 Score: 124.02 bits (310), Expect = 3.710e-29
Identity = 53/135 (39.26%), Postives = 91/135 (67.41%), Query Frame = 1
Query:   52 FSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTT 456
             SKY ++D    E+Q   +VYPD+     +Y S+D +Q+ L+ L G I V + G++YNIP+ ++L +++P+  PI Y++PT +M+I++ +HVD++GRI+LP L+ W   KS +  LL+ M  +F E PP+ +K++
Sbjct:   12 LSKYKFRDVAVEELQKVYRVYPDMKIMAGTYTSSDSLQKDLLKLVGNIPVVYQGRSYNIPILLWLLDSFPFTPPICYLRPTSSMVIREGKHVDSKGRIHLPALHNWDHPKSSVNALLAEMIGKFEEEPPLGTKSS 146          
BLAST of Tumor susceptibility gene 101 protein vs. UniProt/SwissProt
Match: sp|Q66KB7|UEVLD_XENTR (Ubiquitin-conjugating enzyme E2 variant 3 OS=Xenopus tropicalis OX=8364 GN=uevld PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 5.070e-29
Identity = 53/139 (38.13%), Postives = 85/139 (61.15%), Query Frame = 1
Query:   43 RLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTE 459
            R    KY ++D    E++D  + +P     ME+Y   DG Q+ L+ L GT+ +   G TYNIP+ +++ +++P+  P+ ++KP+  M I+   H+DAQGRIYLPYL  WS  KS + GL+  M ++F E  P++S + E
Sbjct:    9 RQQLGKYKFRDLTIEELKDLNRTFPSFIFSMETYTFRDGSQKDLLNLTGTVPMKHQGTTYNIPICLWILDSHPFAPPLCFLKPSGNMGIRVGRHIDAQGRIYLPYLQNWSHPKSTVTGLIREMAVKFEEELPLYSLSAE 147          
BLAST of Tumor susceptibility gene 101 protein vs. TrEMBL
Match: R7V940 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_155778 PE=4 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 3.560e-97
Identity = 173/414 (41.79%), Postives = 253/414 (61.11%), Query Frame = 1
Query:   28 YEGMNRLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTES----TYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYP----QSNIPTNSYIPGVANSNPYQP--------------PVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            YE   R   +KY Y D  K ++ + ++ Y DL P  ++++ NDG ++ L+ L GTI V F G TYNIP+ ++L  T+PY  P+ YV+PT TM IK  +HVD  G+IYLPYL+EW   +SD+ GL+ I+ I FGE PPVF+K++       YP  +     YP           P S+ +  G     S P YP    Q+  P+++Y PG +++   QP              P NS +V     ++++ +K S+L+AVEDK  R   +IFAQ  AE++VL+ T  DL+KG +T+  ML+ +E +   V+R    L E++EEL++ L K E + D+ I  DD V  AAPLYRQL+  + EEQ+  DA+Y++GEA+ + VID+++FLK+VR LSR+QF+LRA V KCR+KAGLPD+
Sbjct:    4 YEAYLRTALAKYEYADITKRDILNALRSYTDLRPMKDTFIFNDGKRQELLCLTGTIPVSFKGSTYNIPICLWLMTTHPYNPPMVYVRPTATMQIKPGKHVDTNGKIYLPYLHEWKHPQSDLYGLIQILSIVFGEEPPVFAKSSAGPPRPAYPPQSRPNLPYPNSGGAMPMPTLPASSGN-TGYPANPSYPGYPGYPAQATQPSSAY-PGYSSAGYAQPTATQAPSYGGYPSQPANSTTVASGNSLSDEQIKASLLTAVEDKMRRRLKEIFAQAQAELDVLKKTEEDLQKGKQTLDSMLQKLETEQNEVERNITLLQEKDEELRSSLEKVEGKEDIPI--DDIVLPAAPLYRQLLTAFAEEQATADAIYYLGEALRRGVIDLDVFLKQVRGLSRKQFLLRALVHKCRQKAGLPDL 413          
BLAST of Tumor susceptibility gene 101 protein vs. TrEMBL
Match: A0A1S3JU80 (tumor susceptibility gene 101 protein isoform X4 OS=Lingula unguis OX=7574 GN=LOC106176203 PE=4 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 4.695e-95
Identity = 172/422 (40.76%), Postives = 241/422 (57.11%), Query Frame = 1
Query:   43 RLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYP--------------------------------QSNIPTNSYIPGVANSNPYQPPVNSISVGG---SALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            R   SKY Y D  K ++      + DL P ++S+V NDG ++ L+ L GTI V + G TYNIPV ++L ET+PY  P+ YVKPT TM IK  +HVDA GR+YLPYL+EW   +SD+ GL+ IM I FGE PPVF+K T    P     P   P          +P+     + S    + PPYP                                 S+ P  S  PG     P QP   + +      SA I+++ +++S++SAVEDK  R   +IFAQ  AE++ L+ T  DL  G   +  M+  +  +   V R  + L E++ E++  L K E++ D  +N DDAV   APLY+QL+N + EEQS+EDA+Y+IGEA+ K VID+++FLK+VRELSR+QFMLRA ++KCR+KAGLP++
Sbjct:   12 RNALSKYQYPDLAKRDILQAFSNFKDLRPNVDSFVFNDGNRKELLCLEGTIPVTYRGTTYNIPVCLWLLETHPYNPPMVYVKPTATMQIKPGQHVDANGRVYLPYLHEWRHPQSDLFGLIQIMGIIFGENPPVFAKKTGGPPPRPGYPPGGLPYPLPGGGTPPYPMQRFMPMPSVGGPTNPPYPAYQPSYPPTSYPSAGAGSGGYPGGGYGGYPPQGSSYPATSSYPGSQGYQPSQPSFATPTTAAMQQSAAISDEQIRLSLVSAVEDKMRRRLKEIFAQAQAEMDALKKTQDDLNNGKTKLDDMISRLRAEQNEVGRSLEILTEKDNEIREALRKMESQND--LNIDDAVVTTAPLYKQLMNAFAEEQSIEDAIYYIGEALRKGVIDLDVFLKQVRELSRQQFMLRALIQKCRQKAGLPEI 431          
BLAST of Tumor susceptibility gene 101 protein vs. TrEMBL
Match: A0A1S3JUC6 (tumor susceptibility gene 101 protein isoform X2 OS=Lingula unguis OX=7574 GN=LOC106176203 PE=4 SV=1)

HSP 1 Score: 305.064 bits (780), Expect = 3.450e-94
Identity = 178/447 (39.82%), Postives = 249/447 (55.70%), Query Frame = 1
Query:   43 RLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTEST----------------------YPMATANXXXXXXXXXXXXXXXFPLSNQHG---IGSGWANSTPPYP--------------------------------QSNIPTNSYIPGVANSNPYQPPVNSISVGG---SALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            R   SKY Y D  K ++      + DL P ++S+V NDG ++ L+ L GTI V + G TYNIPV ++L ET+PY  P+ YVKPT TM IK  +HVDA GR+YLPYL+EW   +SD+ GL+ IM I FGE PPVF+K T                         YPM  ++   YP  S   S   +P +N  G   + S    + PPYP                                 S+ P  S  PG     P QP   + +      SA I+++ +++S++SAVEDK  R   +IFAQ  AE++ L+ T  DL  G   +  M+  +  +   V R  + L E++ E++  L K E++ D  +N DDAV   APLY+QL+N + EEQS+EDA+Y+IGEA+ K VID+++FLK+VRELSR+QFMLRA ++KCR+KAGLP++
Sbjct:   12 RNALSKYQYPDLAKRDILQAFSNFKDLRPNVDSFVFNDGNRKELLCLEGTIPVTYRGTTYNIPVCLWLLETHPYNPPMVYVKPTATMQIKPGQHVDANGRVYLPYLHEWRHPQSDLFGLIQIMGIIFGENPPVFAKKTGGPPPRPGYPPGGLPYPLPGGGTPPYPMQNSSQTPYPPASTGASQPPYPSANSSGFMPMPSVGGPTNPPYPAYQPSYPPTSYPSAGAGSGGYPGGGYGGYPPQGSSYPATSSYPGSQGYQPSQPSFATPTTAAMQQSAAISDEQIRLSLVSAVEDKMRRRLKEIFAQAQAEMDALKKTQDDLNNGKTKLDDMISRLRAEQNEVGRSLEILTEKDNEIREALRKMESQND--LNIDDAVVTTAPLYKQLMNAFAEEQSIEDAIYYIGEALRKGVIDLDVFLKQVRELSRQQFMLRALIQKCRQKAGLPEI 456          
BLAST of Tumor susceptibility gene 101 protein vs. TrEMBL
Match: A0A1S3JV13 (tumor susceptibility gene 101 protein isoform X3 OS=Lingula unguis OX=7574 GN=LOC106176203 PE=4 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 4.467e-93
Identity = 173/434 (39.86%), Postives = 242/434 (55.76%), Query Frame = 1
Query:   43 RLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHG------------IGSGWANSTPPYP--------------------------------QSNIPTNSYIPGVANSNPYQPPVNSISVGG---SALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            R   SKY Y D  K ++      + DL P ++S+V NDG ++ L+ L GTI V + G TYNIPV ++L ET+PY  P+ YVKPT TM IK  +HVDA GR+YLPYL+EW   +SD+ GL+ IM I FGE PPVF+K T    P     P   P          +P+ N               + S    + PPYP                                 S+ P  S  PG     P QP   + +      SA I+++ +++S++SAVEDK  R   +IFAQ  AE++ L+ T  DL  G   +  M+  +  +   V R  + L E++ E++  L K E++ D  +N DDAV   APLY+QL+N + EEQS+EDA+Y+IGEA+ K VID+++FLK+VRELSR+QFMLRA ++KCR+KAGLP++
Sbjct:   12 RNALSKYQYPDLAKRDILQAFSNFKDLRPNVDSFVFNDGNRKELLCLEGTIPVTYRGTTYNIPVCLWLLETHPYNPPMVYVKPTATMQIKPGQHVDANGRVYLPYLHEWRHPQSDLFGLIQIMGIIFGENPPVFAKKTGGPPPRPGYPPGGLPYPLPGGGTPPYPMQNSSQTPYPPASTGFMPMPSVGGPTNPPYPAYQPSYPPTSYPSAGAGSGGYPGGGYGGYPPQGSSYPATSSYPGSQGYQPSQPSFATPTTAAMQQSAAISDEQIRLSLVSAVEDKMRRRLKEIFAQAQAEMDALKKTQDDLNNGKTKLDDMISRLRAEQNEVGRSLEILTEKDNEIREALRKMESQND--LNIDDAVVTTAPLYKQLMNAFAEEQSIEDAIYYIGEALRKGVIDLDVFLKQVRELSRQQFMLRALIQKCRQKAGLPEI 443          
BLAST of Tumor susceptibility gene 101 protein vs. TrEMBL
Match: A0A1S3JUC1 (tumor susceptibility gene 101 protein isoform X1 OS=Lingula unguis OX=7574 GN=LOC106176203 PE=4 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 2.141e-91
Identity = 177/457 (38.73%), Postives = 248/457 (54.27%), Query Frame = 1
Query:   43 RLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTEST----------------------YPMATANXXXXXXXXXXXXXXXFPLSNQHG-------------IGSGWANSTPPYP--------------------------------QSNIPTNSYIPGVANSNPYQPPVNSISVGG---SALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            R   SKY Y D  K ++      + DL P ++S+V NDG ++ L+ L GTI V + G TYNIPV ++L ET+PY  P+ YVKPT TM IK  +HVDA GR+YLPYL+EW   +SD+ GL+ IM I FGE PPVF+K T                         YPM  ++   YP  S   S   +P +N                + S    + PPYP                                 S+ P  S  PG     P QP   + +      SA I+++ +++S++SAVEDK  R   +IFAQ  AE++ L+ T  DL  G   +  M+  +  +   V R  + L E++ E++  L K E++ D  +N DDAV   APLY+QL+N + EEQS+EDA+Y+IGEA+ K VID+++FLK+VRELSR+QFMLRA ++KCR+KAGLP++
Sbjct:   12 RNALSKYQYPDLAKRDILQAFSNFKDLRPNVDSFVFNDGNRKELLCLEGTIPVTYRGTTYNIPVCLWLLETHPYNPPMVYVKPTATMQIKPGQHVDANGRVYLPYLHEWRHPQSDLFGLIQIMGIIFGENPPVFAKKTGGPPPRPGYPPGGLPYPLPGGGTPPYPMQNSSQTPYPPASTGASQPPYPSANSSDPVLQPPPSPGFMPMPSVGGPTNPPYPAYQPSYPPTSYPSAGAGSGGYPGGGYGGYPPQGSSYPATSSYPGSQGYQPSQPSFATPTTAAMQQSAAISDEQIRLSLVSAVEDKMRRRLKEIFAQAQAEMDALKKTQDDLNNGKTKLDDMISRLRAEQNEVGRSLEILTEKDNEIREALRKMESQND--LNIDDAVVTTAPLYKQLMNAFAEEQSIEDAIYYIGEALRKGVIDLDVFLKQVRELSRQQFMLRALIQKCRQKAGLPEI 466          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Cavefish
Match: tsg101a (tumor susceptibility 101 [Source:NCBI gene;Acc:103047482])

HSP 1 Score: 279.256 bits (713), Expect = 1.517e-88
Identity = 157/394 (39.85%), Postives = 230/394 (58.38%), Query Frame = 1
Query:   31 EGMNRLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSK-TTESTYP--MATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGVANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            EG  +    +Y Y+D    E+ + I  Y DL P M++YV NDG  R L++L GT+ V + G  YNIPV ++L +TYPY  PI +VKPT  M+IK  +H+DA G+IYLPYL+EW   +SD+ GL+ +M + FGE PPVFS+ TT+  Y    AT  P        P      P  N  G           YP S  PT+          P QPPV ++       I ED ++ S++SAV DK      +   +  AE++ L+ T  DLKKG + +++M+  ++++ A V R    L +++EEL   L K E + +   + DD +   APLY+Q++NLY EE ++ED ++++GEA+ + VID+E+FLK VR LSR+QF LRA ++K R+ AGL D+
Sbjct:    6 EGALKKMLKQYKYRDLTVREITNVILQYKDLKPLMDAYVFNDGSSRELMSLTGTVPVSYRGNVYNIPVCLWLLDTYPYNPPICFVKPTSAMMIKTGKHIDANGKIYLPYLHEWKHPQSDLYGLIQVMIVVFGEEPPVFSRPTTQPPYQSFQATGPPNQSYMPGMPAVSGYGPNPNPCGYPGYPYPGGSTYPASGGPTHY---------PSQPPVTTVGQSRDGTIGEDTIRASLISAVSDKLRWRMKEEMDRAQAELDALKRTEEDLKKGHQKLEEMVSRLDQEVAEVDRNIDLLKKKDEELTEALEKMENQSENN-DIDDVIVPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLEVFLKHVRLLSRKQFQLRALMQKARKTAGLSDL 389          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Cavefish
Match: tsg101a (tumor susceptibility 101 [Source:NCBI gene;Acc:103047482])

HSP 1 Score: 260.766 bits (665), Expect = 6.032e-82
Identity = 146/360 (40.56%), Postives = 214/360 (59.44%), Query Frame = 1
Query:  133 MESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSK-TTESTYP--MATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGVANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            M++YV NDG  R L++L GT+ V + G  YNIPV ++L +TYPY  PI +VKPT  M+IK  +H+DA G+IYLPYL+EW   +SD+ GL+ +M + FGE PPVFS+ TT+  Y    AT  P        P      P  N  G           YP S  PT+          P QPPV ++       I ED ++ S++SAV DK      +   +  AE++ L+ T  DLKKG + +++M+  ++++ A V R    L +++EEL   L K E + +   + DD +   APLY+Q++NLY EE ++ED ++++GEA+ + VID+E+FLK VR LSR+QF LRA ++K R+ AGL D+
Sbjct:    1 MDAYVFNDGSSRELMSLTGTVPVSYRGNVYNIPVCLWLLDTYPYNPPICFVKPTSAMMIKTGKHIDANGKIYLPYLHEWKHPQSDLYGLIQVMIVVFGEEPPVFSRPTTQPPYQSFQATGPPNQSYMPGMPAVSGYGPNPNPCGYPGYPYPGGSTYPASGGPTHY---------PSQPPVTTVGQSRDGTIGEDTIRASLISAVSDKLRWRMKEEMDRAQAELDALKRTEEDLKKGHQKLEEMVSRLDQEVAEVDRNIDLLKKKDEELTEALEKMENQSENN-DIDDVIVPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLEVFLKHVRLLSRKQFQLRALMQKARKTAGLSDL 350          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Cavefish
Match: tsg101b (tumor susceptibility 101b [Source:ZFIN;Acc:ZDB-GENE-130530-542])

HSP 1 Score: 259.225 bits (661), Expect = 2.776e-81
Identity = 143/389 (36.76%), Postives = 219/389 (56.30%), Query Frame = 1
Query:   37 MNRLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGVANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            + +L    Y Y+D    E+ +    Y DL P M++YV NDG  R L++L GT+ V + G  YNIP+ ++L +TYPY  PI +VKPT TM+IK  +HVDA G+IYLPYL+EW   +SD+ GL+ +M + FGE PPVFS+ T  T   A                                     +P S  PT +Y          +  V  + + G+    ED ++ S++SAV DK      +   +  AE++ L+ T  DLKKG + +++M+  ++++  +V +    L  ++EEL A L K E + +   + DD +   APLYRQ++NLY EE ++ED ++++GEA+ + VID+++FLK VR LS +QF LRA ++K R+ AGL D+
Sbjct:    8 LRKLLSKAYKYRDLTVREITNVTTSYKDLKPVMDNYVFNDGSTRELMSLSGTVPVSYRGNVYNIPICLWLLDTYPYNPPICFVKPTSTMMIKTGKHVDANGKIYLPYLHEWKHPQSDLFGLIQVMIVVFGEEPPVFSRPTTQTPYQA-------------------------------------FPASGPPTCTYKQPADLHKARRVSVRQVRL-GTGRSGEDTIRASLVSAVSDKLRWRMKEEMDRAQAELDALKRTEEDLKKGHQKLEEMVTKLDQEIVHVDKNIDLLKLKDEELTAALGKMENQSENN-DIDDLIVPTAPLYRQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSCKQFQLRALMQKARKTAGLSDL 357          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Cavefish
Match: tsg101a (tumor susceptibility 101 [Source:NCBI gene;Acc:103047482])

HSP 1 Score: 253.447 bits (646), Expect = 1.111e-78
Identity = 141/354 (39.83%), Postives = 207/354 (58.47%), Query Frame = 1
Query:  145 VSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSK-TTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGVANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            V NDG  R L++L GT+ V + G  YNIPV ++L +TYPY  PI +VKPT  M+IK  +H+DA G+IYLPYL+EW   +SD+ GL+ +M + FGE PPVFS+ TT+  Y    A       G        F      G           YP S  PT+          P QPPV ++       I ED ++ S++SAV DK      +   +  AE++ L+ T  DLKKG + +++M+  ++++ A V R    L +++EEL   L K E + +   + DD +   APLY+Q++NLY EE ++ED ++++GEA+ + VID+E+FLK VR LSR+QF LRA ++K R+ AGL D+
Sbjct:   48 VFNDGSSRELMSLTGTVPVSYRGNVYNIPVCLWLLDTYPYNPPICFVKPTSAMMIKTGKHIDANGKIYLPYLHEWKHPQSDLYGLIQVMIVVFGEEPPVFSRPTTQPPYQSFQAT------GPPNLYLFCFACRCCSGYPGYPYPGGSTYPASGGPTHY---------PSQPPVTTVGQSRDGTIGEDTIRASLISAVSDKLRWRMKEEMDRAQAELDALKRTEEDLKKGHQKLEEMVSRLDQEVAEVDRNIDLLKKKDEELTEALEKMENQSENN-DIDDVIVPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLEVFLKHVRLLSRKQFQLRALMQKARKTAGLSDL 385          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Cavefish
Match: ENSAMXT00000041886.1 (pep primary_assembly:Astyanax_mexicanus-2.0:8:11037583:11047829:1 gene:ENSAMXG00000016647.2 transcript:ENSAMXT00000041886.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.635 bits (309), Expect = 6.310e-30
Identity = 56/135 (41.48%), Postives = 86/135 (63.70%), Query Frame = 1
Query:   52 FSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTT 456
             SKY ++D    E+Q   +VYPD+  K  SY  +D  QR L+ L G I V + G +YN+P+ ++L +++P+  PI +++PT  M+I++ +HVDA+GRIYLP L+ W   KS +  LL  M  +F E PP+  K+T
Sbjct:   12 LSKYKFRDVAIEELQKLNRVYPDMKLKTGSYTFSDSTQRDLLNLVGNIPVKYKGHSYNLPIQLWLLDSFPFTPPICFLRPTSNMMIREGKHVDAKGRIYLPGLHNWDHPKSSVSVLLEEMIAKFEEDPPLGMKST 146          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006883.1 (pep scaffold:Pmarinus_7.0:GL480512:21680:33616:-1 gene:ENSPMAG00000006203.1 transcript:ENSPMAT00000006883.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 254.218 bits (648), Expect = 5.977e-80
Identity = 146/391 (37.34%), Postives = 219/391 (56.01%), Query Frame = 1
Query:  145 VSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTT--ESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGVANSNPYQPPVNSISV------GGSA-------------------------------LINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPD 1200
            V NDG  R LV+L GTI V + G  YNIPV ++L +T+PY  PI +VKPT TMLIKQ +HVDA GR+YLPYL+EW    SD+ GL+ +M + FGE PPVFS+T+  ++  PM   N                     HG         P YP +  P  SY+PG   + PYQP  NS +       GGSA                               +I+E+ ++ S++SA+ DK     ++  ++  AE+E L+ T  +L+ G  +++ M   + R+  +V +    L +++EE+ + L K E++ +   N D+AV   APLY+Q++NLY EE ++ED ++++GEA+ + VID+++FLK VR L+R+QF LRA ++K R+ A L D
Sbjct:    1 VFNDGTARELVSLNGTIPVNYRGSIYNIPVQLWLFDTHPYNPPICFVKPTSTMLIKQGKHVDANGRVYLPYLHEWKANASDLVGLIQVMLVVFGEEPPVFSRTSAGQAVAPMGPFN---------------------HGY--------PSYPAAGPPMGSYVPG-GGTYPYQPTANSTNYPPYPFSGGSAYPAPPPAQPQISQPHYGSQPVPGTSAMSRDGVISEEHIRASLVSAITDKLRWRLNEEVSRAQAELEALQRTEEELRNGQRSLQDMAGRITREIGDVDQNIDLLKKKDEEITSALEKMESQSESS-NIDEAVVTTAPLYKQILNLYAEENAIEDTIFYLGEALRQGVIDLDVFLKHVRLLARKQFQLRALMQKARKTACLTD 360          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007530.1 (pep scaffold:Pmarinus_7.0:GL479259:2250:6777:-1 gene:ENSPMAG00000006802.1 transcript:ENSPMAT00000007530.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.2781 bits (225), Expect = 1.887e-22
Identity = 38/89 (42.70%), Postives = 59/89 (66.29%), Query Frame = 1
Query:  145 VSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIM 411
            ++ +G+ + L+ L GTI V + G  YN+PV ++LPE++PY  P+ +V+PT  M++    HVD++GR+YLPYL  W+   S   GLL  M
Sbjct:   24 MATNGIDKNLLHLSGTIPVIYEGVEYNMPVRLWLPESFPYSPPLAFVQPTQDMILNPGHHVDSRGRVYLPYLQHWTHPNSTTCGLLQAM 112          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Nematostella
Match: EDO39177 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAT5])

HSP 1 Score: 262.307 bits (669), Expect = 5.282e-82
Identity = 154/431 (35.73%), Postives = 235/431 (54.52%), Query Frame = 1
Query:   28 YEGMNRLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSK------------------------------TTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANS--------TPPYPQSNIPTNSYIPGVANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVG-INYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            +E   R    K+ + +  K ++   + VY DL P M+ +V NDG +  L++L GTI V F G TYNIPV ++L ET+P+  P+ YV+PT TM IK ++HVD  GR++LPYL +WS  +S+I GL+ I+   F E PPV++K                               T    PM                  G+P S   G  + + ++        TPP PQ   P +S    V+ SNP   P+    +     I++D++K S+LSAVEDK  R     F Q   E++ L  T  +LK+G E ++ ++  ++++ A+V+     L ++NEE+   +AK E+  D G +  D+AV   APLY Q++NL+ EE ++ED +Y++ EA+ K+ +D E+FLK+VR LSR+QFM+RA ++K R  AGL DV
Sbjct:    3 WEPYLRDKLRKHPHAELCKRQILAAMAVYKDLRPSMQKFVHNDGRESELLSLDGTIPVSFRGSTYNIPVCIFLQETHPFIPPLVYVRPTSTMAIKVSKHVDNNGRVFLPYLTDWSHPRSEIAGLIQILCCVFAEEPPVYAKPNNYQPPPQPGYRPPYPGYPPTSSSATPYPATPHGMPMPMPGAGPGRPRQGYPPYQGYPPSTGTG-ATPYPHTTQGQNHFPTPPVPQRPYPASSGYSPVSQSNPS--PMVETRLQSQPSISDDMIKASLLSAVEDKLRRKAKATFEQAQIELDQLNRTQEELKRGGEKLQDIVTKLQKEQADVENNINVLTQKNEEISDVIAKLES--DTGNLQIDEAVVTTAPLYNQILNLFAEENAIEDTIYYLSEALRKEAVDSEVFLKQVRILSRKQFMIRALLQKARRAAGLGDV 428          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Medaka
Match: tsg101a (tumor susceptibility 101 [Source:NCBI gene;Acc:101166276])

HSP 1 Score: 275.018 bits (702), Expect = 5.492e-87
Identity = 152/385 (39.48%), Postives = 229/385 (59.48%), Query Frame = 1
Query:   52 FSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSK-TTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGVANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
              +Y Y+D    E+   I  Y DL P M++YV NDG  R L++L GT+ V + G TYNIPV ++L +TYPY  PI +VKPT  M+IK  +H+DA G+IYLPYL+EW   +SD+ GL+ +M + FGE PPVFS+ TT+  +P   A      G       +G P ++ +    G       YP       S  P  A   P Q  V+++       I ED ++ S++SAV DK      +   +  AE++ L+ T  DLKKG + +++M+  ++++ A V R  + L +++EEL   L K E + +   + DD +   APLY+Q++NLY EE ++ED ++++GEA+ + VID+E+FLK VR LSR+QF LRA ++K R+ AGL D+
Sbjct:   13 LKQYKYRDLTVREITYVISQYKDLKPVMDAYVFNDGSSRDLMSLTGTVPVSYRGNTYNIPVCLWLLDTYPYNPPICFVKPTSAMMIKTGKHIDANGKIYLPYLHEWKHPQSDLIGLIQVMIVVFGEEPPVFSRPTTQPPFPAFQA-----AGPPNTSYMAGMPAASPYNQNPGG------YPAFQFQGGSSYP--AGPYPLQTAVSTVGPSRDGTIGEDTIRASLISAVSDKLRWRMKEEMDRAQAELDALKRTEEDLKKGHQKLEEMISKLDQEVAEVDRNIELLKKKDEELSEALEKMENQTENN-DIDDVIVPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLEVFLKHVRLLSRKQFQLRALMQKARKTAGLSDL 383          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Medaka
Match: zgc:123278 (tumor susceptibility gene 101 protein [Source:NCBI gene;Acc:101166028])

HSP 1 Score: 110.923 bits (276), Expect = 7.504e-28
Identity = 52/124 (41.94%), Postives = 75/124 (60.48%), Query Frame = 1
Query:   70 KDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPV 441
            +  V +E+      + +L P M+ +VS  G  +TL++L GTI V F G+ YNIPV V++ E YP+  PI YV+PT  M++ +   + A G+I LPYL EW +   D+  LL +M   FGE PPV
Sbjct:   18 RSYVAHEIFVATTYFKNLRPAMDRFVSRAGAAKTLMSLTGTIPVTFAGKIYNIPVCVWIEERYPHAPPICYVQPTAEMMLVKRVFLSADGQILLPYLKEWKKGDCDLISLLQVMAAVFGEFPPV 141          
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Medaka
Match: si:dkey-181m9.8 (E3 ubiquitin-protein ligase RNF31 [Source:NCBI gene;Acc:101162956])

HSP 1 Score: 72.7886 bits (177), Expect = 5.506e-13
Identity = 43/137 (31.39%), Postives = 70/137 (51.09%), Query Frame = 1
Query:   46 LNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIK-QNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKT 453
            L   +Y++      ++Q+    +PDLS   + Y   +   + LV L GT+ V + G TYNIPV V+L  T+P   P  YV P+ +M+I      ++A G I L  L +W+   S +  LL+ M   F    P++++ 
Sbjct:   13 LTECQYSHPVETLLDLQEARSRFPDLSLYADYYCFPNKETKKLVFLAGTLPVLYEGSTYNIPVCVWLHVTHPESCPRCYVCPSASMVINPSCPCINASGNISLDGLTKWTRGVSSLSELLAEMIQVFQRDTPIYARC 149          
BLAST of Tumor susceptibility gene 101 protein vs. Planmine SMEST
Match: SMESG000004871.1 (SMESG000004871.1)

HSP 1 Score: 760.37 bits (1962), Expect = 0.000e+0
Identity = 387/389 (99.49%), Postives = 388/389 (99.74%), Query Frame = 1
Query:   37 MNRLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGVANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 1203
            MNRLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMAT NPPYYPGGSYPKSGSGFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGVANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSD+FAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV
Sbjct:    1 MNRLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATTNPPYYPGGSYPKSGSGFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGVANSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDVFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV 389          
BLAST of Tumor susceptibility gene 101 protein vs. Planmine SMEST
Match: SMESG000039021.1 (SMESG000039021.1)

HSP 1 Score: 227.639 bits (579), Expect = 7.316e-69
Identity = 142/412 (34.47%), Postives = 213/412 (51.70%), Query Frame = 1
Query:   46 LNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPP----------YPQSNIPTNSYIPGVANSNPYQPPVNS-------ISVGGSALIN-----------EDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLP 1197
            LN S+Y  KD +KNE+Q    +YP+L  KME     DG  + L+TL GTIK+ +    +NIP+S++LP+ YP K PI +V+PT  M IK ++ V  +G I +PYL+ W+    ++  L+S +   F   P           PM T                  P ++  G   G  N TP           Y   ++ T  Y+  +  +N  + PV             G  L N           E+    S+   VE++ +R +  IF+    ++E LEN  + L      +  ++E+ +   ++VK+  + L + N+ +   ++  E E   GI YD  +    PLY+QL+  +IEEQS++DA+YFIGEA+GK VID+E+FLKKVRELSRRQF+LRAT++ CREKA LP
Sbjct:    5 LNLSQYPSKDVIKNELQQLTGIYPNLCSKMEELSIQDGTHKNLITLSGTIKISYQNSNFNIPISIHLPDLYPLKRPIVFVRPTNEMEIKISDIVSGKGEINIPYLSNWNHLNCNLVSLMSNICQAFSNDP-----------PMYTK----------IHEIIENPTTSMKGPFIGL-NKTPKAIKEEAENIVYGSHSLSTLPYV-AIQKNNELKLPVRHENQNLILTKFPGQDLENNKKSIIIDQHLENAQLQSLQKLVEERYNRFFDRIFSSYKIDLEYLENETQILNNRAIELFNLMEEFQIQISSVKKESEMLNQINKSIYYVISNLEKESSNGITYDGTIATTTPLYKQLLEAFIEEQSIDDAVYFIGEALGKSVIDVEIFLKKVRELSRRQFILRATIRLCREKARLP 393          
BLAST of Tumor susceptibility gene 101 protein vs. Planmine SMEST
Match: SMESG000039021.1 (SMESG000039021.1)

HSP 1 Score: 223.016 bits (567), Expect = 8.297e-67
Identity = 140/408 (34.31%), Postives = 210/408 (51.47%), Query Frame = 1
Query:   58 KYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPP----------YPQSNIPTNSYIPGVANSNPYQPPVNS-------ISVGGSALIN-----------EDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLP 1197
            KY  KD +KNE+Q    +YP+L  KME     DG  + L+TL GTIK+ +    +NIP+S++LP+ YP K PI +V+PT  M IK ++ V  +G I +PYL+ W+    ++  L+S +   F   P           PM T                  P ++  G   G  N TP           Y   ++ T  Y+  +  +N  + PV             G  L N           E+    S+   VE++ +R +  IF+    ++E LEN  + L      +  ++E+ +   ++VK+  + L + N+ +   ++  E E   GI YD  +    PLY+QL+  +IEEQS++DA+YFIGEA+GK VID+E+FLKKVRELSRRQF+LRAT++ CREKA LP
Sbjct:   37 KYPSKDVIKNELQQLTGIYPNLCSKMEELSIQDGTHKNLITLSGTIKISYQNSNFNIPISIHLPDLYPLKRPIVFVRPTNEMEIKISDIVSGKGEINIPYLSNWNHLNCNLVSLMSNICQAFSNDP-----------PMYTK----------IHEIIENPTTSMKGPFIGL-NKTPKAIKEEAENIVYGSHSLSTLPYV-AIQKNNELKLPVRHENQNLILTKFPGQDLENNKKSIIIDQHLENAQLQSLQKLVEERYNRFFDRIFSSYKIDLEYLENETQILNNRAIELFNLMEEFQIQISSVKKESEMLNQINKSIYYVISNLEKESSNGITYDGTIATTTPLYKQLLEAFIEEQSIDDAVYFIGEALGKSVIDVEIFLKKVRELSRRQFILRATIRLCREKARLP 421          
BLAST of Tumor susceptibility gene 101 protein vs. Planmine SMEST
Match: SMESG000039021.1 (SMESG000039021.1)

HSP 1 Score: 223.402 bits (568), Expect = 2.201e-66
Identity = 140/408 (34.31%), Postives = 210/408 (51.47%), Query Frame = 1
Query:   58 KYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLGGTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQGRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATANXXXXXXXXXXXXXXXFPLSNQHGIGSGWANSTPP----------YPQSNIPTNSYIPGVANSNPYQPPVNS-------ISVGGSALIN-----------EDVLKMSILSAVEDKAHRSYSDIFAQNLAEIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLP 1197
            KY  KD +KNE+Q    +YP+L  KME     DG  + L+TL GTIK+ +    +NIP+S++LP+ YP K PI +V+PT  M IK ++ V  +G I +PYL+ W+    ++  L+S +   F   P           PM T                  P ++  G   G  N TP           Y   ++ T  Y+  +  +N  + PV             G  L N           E+    S+   VE++ +R +  IF+    ++E LEN  + L      +  ++E+ +   ++VK+  + L + N+ +   ++  E E   GI YD  +    PLY+QL+  +IEEQS++DA+YFIGEA+GK VID+E+FLKKVRELSRRQF+LRAT++ CREKA LP
Sbjct:   86 KYPSKDVIKNELQQLTGIYPNLCSKMEELSIQDGTHKNLITLSGTIKISYQNSNFNIPISIHLPDLYPLKRPIVFVRPTNEMEIKISDIVSGKGEINIPYLSNWNHLNCNLVSLMSNICQAFSNDP-----------PMYTK----------IHEIIENPTTSMKGPFIGL-NKTPKAIKEEAENIVYGSHSLSTLPYV-AIQKNNELKLPVRHENQNLILTKFPGQDLENNKKSIIIDQHLENAQLQSLQKLVEERYNRFFDRIFSSYKIDLEYLENETQILNNRAIELFNLMEEFQIQISSVKKESEMLNQINKSIYYVISNLEKESSNGITYDGTIATTTPLYKQLLEAFIEEQSIDDAVYFIGEALGKSVIDVEIFLKKVRELSRRQFILRATIRLCREKARLP 470          
BLAST of Tumor susceptibility gene 101 protein vs. Planmine SMEST
Match: SMESG000039021.1 (SMESG000039021.1)

HSP 1 Score: 124.79 bits (312), Expect = 1.249e-33
Identity = 58/107 (54.21%), Postives = 80/107 (74.77%), Query Frame = 1
Query:  877 ANVKRLQKQLYEENEELKAQLAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMGKKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLP 1197
            ++VK+  + L + N+ +   ++  E E   GI YD  +    PLY+QL+  +IEEQS++DA+YFIGEA+GK VID+E+FLKKVRELSRRQF+LRAT++ CREKA LP
Sbjct:   20 SSVKKESEMLNQINKSIYYVISNLEKESSNGITYDGTIATTTPLYKQLLEAFIEEQSIDDAVYFIGEALGKSVIDVEIFLKKVRELSRRQFILRATIRLCREKARLP 126          
The following BLAST results are available for this feature:
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TSG1015.936e-8738.92tumor susceptibility 101 [Source:HGNC Symbol;Acc:H... [more]
TSG1016.770e-7537.33tumor susceptibility 101 [Source:HGNC Symbol;Acc:H... [more]
UEVLD2.139e-3040.85UEV and lactate/malate dehyrogenase domains [Sourc... [more]
UEVLD4.247e-2940.85UEV and lactate/malate dehyrogenase domains [Sourc... [more]
UEVLD1.190e-2840.85UEV and lactate/malate dehyrogenase domains [Sourc... [more]
back to top
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tsg-1018.155e-6533.33Tumor Susceptibility Gene homolog [Source:UniProt... [more]
back to top
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TSG1012.271e-7937.59gene:FBgn0036666 transcript:FBtr0075329[more]
back to top
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tsg101b1.040e-8740.41tumor susceptibility 101b [Source:ZFIN;Acc:ZDB-GEN... [more]
tsg101a3.589e-8538.83tumor susceptibility 101a [Source:ZFIN;Acc:ZDB-GEN... [more]
uevld4.914e-3039.26UEV and lactate/malate dehyrogenase domains [Sourc... [more]
uevld4.914e-3039.26UEV and lactate/malate dehyrogenase domains [Sourc... [more]
zgc:1232781.560e-2939.37zgc:123278 [Source:ZFIN;Acc:ZDB-GENE-051127-21][more]
back to top
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
thbs21.015e-4150.69thrombospondin 2 [Source:Xenbase;Acc:XB-GENE-48246... [more]
uevld6.651e-2937.23UEV and lactate/malate dehyrogenase domains [Sourc... [more]
uevld1.202e-2838.35UEV and lactate/malate dehyrogenase domains [Sourc... [more]
uevld8.840e-2342.16UEV and lactate/malate dehyrogenase domains [Sourc... [more]
back to top
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tsg1013.967e-8638.79tumor susceptibility gene 101 [Source:MGI Symbol;A... [more]
Tsg1011.088e-5235.16tumor susceptibility gene 101 [Source:MGI Symbol;A... [more]
Tsg1018.115e-3041.10tumor susceptibility gene 101 [Source:MGI Symbol;A... [more]
Uevld6.199e-2940.29UEV and lactate/malate dehyrogenase domains [Sourc... [more]
Uevld9.601e-2840.29UEV and lactate/malate dehyrogenase domains [Sourc... [more]
back to top
BLAST of Tumor susceptibility gene 101 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99816|TS101_HUMAN2.851e-8638.92Tumor susceptibility gene 101 protein OS=Homo sapi... [more]
sp|Q61187|TS101_MOUSE2.775e-8538.79Tumor susceptibility gene 101 protein OS=Mus muscu... [more]
sp|Q6IRE4|TS101_RAT9.638e-8438.29Tumor susceptibility gene 101 protein OS=Rattus no... [more]
sp|Q6DBY5|UEVLD_DANRE3.710e-2939.26Ubiquitin-conjugating enzyme E2 variant 3 OS=Danio... [more]
sp|Q66KB7|UEVLD_XENTR5.070e-2938.13Ubiquitin-conjugating enzyme E2 variant 3 OS=Xenop... [more]
back to top
BLAST of Tumor susceptibility gene 101 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7V9403.560e-9741.79Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1S3JU804.695e-9540.76tumor susceptibility gene 101 protein isoform X4 O... [more]
A0A1S3JUC63.450e-9439.82tumor susceptibility gene 101 protein isoform X2 O... [more]
A0A1S3JV134.467e-9339.86tumor susceptibility gene 101 protein isoform X3 O... [more]
A0A1S3JUC12.141e-9138.73tumor susceptibility gene 101 protein isoform X1 O... [more]
back to top
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tsg101a1.517e-8839.85tumor susceptibility 101 [Source:NCBI gene;Acc:103... [more]
tsg101a6.032e-8240.56tumor susceptibility 101 [Source:NCBI gene;Acc:103... [more]
tsg101b2.776e-8136.76tumor susceptibility 101b [Source:ZFIN;Acc:ZDB-GEN... [more]
tsg101a1.111e-7839.83tumor susceptibility 101 [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000041886.16.310e-3041.48pep primary_assembly:Astyanax_mexicanus-2.0:8:1103... [more]
back to top
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000006883.15.977e-8037.34pep scaffold:Pmarinus_7.0:GL480512:21680:33616:-1 ... [more]
ENSPMAT00000007530.11.887e-2242.70pep scaffold:Pmarinus_7.0:GL479259:2250:6777:-1 ge... [more]
back to top
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO391775.282e-8235.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tumor susceptibility gene 101 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tsg101a5.492e-8739.48tumor susceptibility 101 [Source:NCBI gene;Acc:101... [more]
zgc:1232787.504e-2841.94tumor susceptibility gene 101 protein [Source:NCBI... [more]
si:dkey-181m9.85.506e-1331.39E3 ubiquitin-protein ligase RNF31 [Source:NCBI gen... [more]
back to top
BLAST of Tumor susceptibility gene 101 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004871.10.000e+099.49SMESG000004871.1[more]
SMESG000039021.17.316e-6934.47SMESG000039021.1[more]
SMESG000039021.18.297e-6734.31SMESG000039021.1[more]
SMESG000039021.12.201e-6634.31SMESG000039021.1[more]
SMESG000039021.11.249e-3354.21SMESG000039021.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014474 ID=SMED30014474|Name=Tumor susceptibility gene 101 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1668bp
TTATTTGTTACCTTAAATTATTAGTTTTATGAAGGGATGAATAGATTGAA
TTTCTCTAAGTACACTTACAAAGATAGAGTTAAAAATGAAGTTCAAGATA
CTATAAAGGTTTATCCAGATCTTTCACCAAAAATGGAAAGTTACGTTTCT
AATGATGGTGTTCAGCGGACATTAGTCACTCTTGGTGGAACTATCAAAGT
ATATTTTATGGGCCAGACTTATAACATTCCGGTTTCTGTTTATTTACCGG
AGACTTATCCTTATAAGGCCCCGATACCTTATGTTAAACCAACACCGACC
ATGTTAATAAAACAGAATGAACACGTTGATGCTCAAGGCCGAATCTATTT
GCCTTACTTAAATGAATGGTCAGAAAGAAAATCTGATATTCAAGGATTAT
TGTCTATTATGCAAATTGAATTTGGTGAACGACCTCCAGTTTTTTCAAAA
ACAACTGAATCAACTTACCCAATGGCAACAGCTAACCCACCGTATTATCC
AGGTGGCTCTTATCCGAAGTCCGGAAGTGGCTTTCCGTTATCTAATCAAC
ATGGAATAGGCAGTGGATGGGCTAATTCAACTCCACCATATCCTCAAAGT
AATATACCAACTAACTCTTATATTCCTGGCGTTGCTAATTCAAATCCTTA
TCAGCCACCAGTAAATTCTATTTCAGTTGGTGGTTCAGCTCTTATAAATG
AAGATGTTTTGAAAATGTCGATTTTATCAGCCGTTGAAGACAAAGCCCAT
AGAAGTTATTCAGATATTTTTGCTCAGAACTTAGCTGAAATCGAAGTTCT
TGAGAATACTAATAGGGATTTAAAAAAAGGAACTGAAACTATTAAGAAAA
TGCTAGAAGATATGGAAAGAGACACGGCAAATGTCAAAAGATTGCAAAAG
CAGTTATACGAGGAAAATGAAGAATTGAAAGCCCAATTAGCTAAATGTGA
AACTGAAATGGATGTTGGTATCAATTACGATGATGCTGTAGAGGGCGCAG
CTCCACTTTATCGACAATTAGTTAATCTTTACATTGAAGAACAGAGCCTA
GAAGATGCTCTGTATTTCATAGGCGAGGCTATGGGTAAAAAGGTGATTGA
TATTGAACTATTTCTAAAGAAAGTTCGAGAACTGTCGAGGAGACAATTTA
TGCTGCGAGCCACAGTTAAAAAATGTAGAGAAAAAGCTGGACTTCCAGAT
GTTTGACAACTTATTAAATTGTTTTAACGATCGTCATTTATCTATTCACT
GATTTGTATAAAAATATTTTCAAATTATGTTACTCATTTTTTGAATTATT
TTTCTAAAAAAATGTTTTTAAATTTTTAGCTGTAATGAAATTTATATAGA
TAACGTTATTGAGCCAGTGTGTGTACTGTAATATTTCTTTGCACAGTGAA
ACGATATTGATTGTGGTACTGTTTCACATTTTTACAGTTAATTAGGTTTA
ATTGGTCCTCGTGCGTAACAGCAGTTTACAAAACTTTCAAATCCAATTTT
TTAGTATTTAAAATCAATAATAAAGTGACTTGTTATTAATTAATATTTTT
CTATGTATCCGTGAAGTGTAAATTTTACAATTCAGTGTTGTTTTAGTGGG
AATGTGTCACAGACTGATGGGAAAATAAGTATAATTGTATAGTGAGGTAG
GTAGTGCATACTTTATCG
back to top

protein sequence of SMED30014474-orf-1

>SMED30014474-orf-1 ID=SMED30014474-orf-1|Name=SMED30014474-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=390bp
MNRLNFSKYTYKDRVKNEVQDTIKVYPDLSPKMESYVSNDGVQRTLVTLG
GTIKVYFMGQTYNIPVSVYLPETYPYKAPIPYVKPTPTMLIKQNEHVDAQ
GRIYLPYLNEWSERKSDIQGLLSIMQIEFGERPPVFSKTTESTYPMATAN
PPYYPGGSYPKSGSGFPLSNQHGIGSGWANSTPPYPQSNIPTNSYIPGVA
NSNPYQPPVNSISVGGSALINEDVLKMSILSAVEDKAHRSYSDIFAQNLA
EIEVLENTNRDLKKGTETIKKMLEDMERDTANVKRLQKQLYEENEELKAQ
LAKCETEMDVGINYDDAVEGAAPLYRQLVNLYIEEQSLEDALYFIGEAMG
KKVIDIELFLKKVRELSRRQFMLRATVKKCREKAGLPDV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR037202ESCRT_assembly_dom
IPR016135UBQ-conjugating_enzyme/RWD
IPR017916SB_dom
IPR008883UEV_N
Vocabulary: biological process
TermDefinition
GO:0006464cellular protein modification process
GO:0015031protein transport
GO:0001558regulation of cell growth
GO:0006513protein monoubiquitination
GO:0006810transport
GO:0007049cell cycle
GO:0007050cell cycle arrest
GO:0008285negative regulation of cell proliferation
GO:0008333endosome to lysosome transport
GO:0016032viral process
GO:0016197endosomal transport
GO:0016236macroautophagy
GO:0019058viral life cycle
GO:0030154cell differentiation
GO:0030216keratinocyte differentiation
GO:0036258multivesicular body assembly
GO:0039702viral budding via host ESCRT complex
GO:0040008regulation of growth
GO:0042059negative regulation of epidermal growth factor receptor signaling pathway
GO:0043162ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway
GO:0043405regulation of MAP kinase activity
GO:0045892negative regulation of transcription, DNA-templated
GO:0046755viral budding
GO:0048524positive regulation of viral process
GO:0051301cell division
GO:0075733intracellular transport of virus
GO:0097352autophagosome maturation
GO:1902188positive regulation of viral release from host cell
GO:1903543positive regulation of exosomal secretion
GO:1903551regulation of extracellular exosome assembly
GO:1903772regulation of viral budding via host ESCRT complex
GO:1903774positive regulation of viral budding via host ESCRT complex
GO:1990182exosomal secretion
GO:2000397positive regulation of ubiquitin-dependent endocytosis
Vocabulary: cellular component
TermDefinition
GO:0000813ESCRT I complex
GO:0005634nucleus
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005768endosome
GO:0005769early endosome
GO:0005770late endosome
GO:0005771multivesicular body
GO:0005829cytosol
GO:0005886plasma membrane
GO:0010008endosome membrane
GO:0016020membrane
GO:0031902late endosome membrane
GO:0070062extracellular exosome
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003714transcription corepressor activity
GO:0005515protein binding
GO:0030374ligand-dependent nuclear receptor transcription coactivator activity
GO:0031625ubiquitin protein ligase binding
GO:0042803protein homodimerization activity
GO:0043130ubiquitin binding
GO:0046790virion binding
GO:0048306calcium-dependent protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 255..307
NoneNo IPR availablePANTHERPTHR23306TUMOR SUSCEPTIBILITY GENE 101 PROTEIN-RELATEDcoord: 7..382
IPR008883Ubiquitin E2 variant, N-terminalPFAMPF05743UEVcoord: 16..135
e-value: 3.5E-38
score: 130.2
IPR008883Ubiquitin E2 variant, N-terminalPROSITEPS51322UEVcoord: 1..139
score: 45.293
IPR017916Steadiness box (SB) domainPFAMPF09454Vps23_corecoord: 317..379
e-value: 3.9E-22
score: 78.0
IPR017916Steadiness box (SB) domainPROSITEPS51312SBcoord: 322..389
score: 13.807
IPR016135Ubiquitin-conjugating enzyme/RWD-likeGENE3DG3DSA:3.10.110.10coord: 2..139
e-value: 9.2E-49
score: 167.0
IPR016135Ubiquitin-conjugating enzyme/RWD-likeSUPERFAMILYSSF54495UBC-likecoord: 6..137
IPR037202ESCRT assembly domainSUPERFAMILYSSF140111Endosomal sorting complex assembly domaincoord: 323..383