zinc finger MYM-type protein 6

Overview
Namezinc finger MYM-type protein 6
Smed IDSMED30014454
Length (bp)1727
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of zinc finger MYM-type protein 6 (SMED30014454) t-SNE clustered cells

Violin plots show distribution of expression levels for zinc finger MYM-type protein 6 (SMED30014454) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of zinc finger MYM-type protein 6 (SMED30014454) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for zinc finger MYM-type protein 6 (SMED30014454) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 78.9518 bits (193), Expect = 1.008e-29
Identity = 46/142 (32.39%), Postives = 82/142 (57.75%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFS----EFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPF-SAELAHNLTFPVKVQLIELTSNKTLEQKYQ 616
            L+DIFS  ND N S+QGK+ T F+  +K+E   +K++ W + I+TDCY M  + +    E G+D      ++  +R     HL  +      YFP+K+D    ++W+ NPF S++   NLT  ++ +L++L +++ L+  ++
Sbjct:  954 LSDIFSIFNDLNASMQGKNATYFSMADKVEGQKQKLEAWKNRISTDCYDMFHNLTTIINEVGND-----LDIAHLRKVISEHLTNLLECFEFYFPSKEDPRIGNLWIQNPFLSSKDNLNLTVTLQDKLLKLATDEGLKISFE 1090          

HSP 2 Score: 44.669 bits (104), Expect = 1.008e-29
Identity = 19/36 (52.78%), Postives = 27/36 (75.00%), Query Frame = 1
Query:  706 FGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMT 813
            F +TYL E+GFST+ VIKTK RN L I   +R++++
Sbjct: 1120 FPSTYLCETGFSTLSVIKTKHRNSLNIHYPLRVALS 1155          

HSP 3 Score: 40.0466 bits (92), Expect = 1.008e-29
Identity = 15/23 (65.22%), Postives = 19/23 (82.61%), Query Frame = 1
Query:   31 MGAEHQTLFLHSHIRWLSKGKVL 99
            M A+H+ L LH+ IRWLS+GKVL
Sbjct:  895 MEADHKQLLLHAEIRWLSRGKVL 917          

HSP 4 Score: 27.335 bits (59), Expect = 1.008e-29
Identity = 12/27 (44.44%), Postives = 18/27 (66.67%), Query Frame = 3
Query:  627 NISRFWFEIREEYKMLSENALKLLLFF 707
            ++  FW + + +Y  L+E ALKLLL F
Sbjct: 1094 SLPSFWIKAKNDYPELAEIALKLLLLF 1120          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 78.9518 bits (193), Expect = 1.279e-29
Identity = 46/142 (32.39%), Postives = 82/142 (57.75%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFS----EFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPF-SAELAHNLTFPVKVQLIELTSNKTLEQKYQ 616
            L+DIFS  ND N S+QGK+ T F+  +K+E   +K++ W + I+TDCY M  + +    E G+D      ++  +R     HL  +      YFP+K+D    ++W+ NPF S++   NLT  ++ +L++L +++ L+  ++
Sbjct: 1105 LSDIFSIFNDLNASMQGKNATYFSMADKVEGQKQKLEAWKNRISTDCYDMFHNLTTIINEVGND-----LDIAHLRKVISEHLTNLLECFEFYFPSKEDPRIGNLWIQNPFLSSKDNLNLTVTLQDKLLKLATDEGLKISFE 1241          

HSP 2 Score: 44.2838 bits (103), Expect = 1.279e-29
Identity = 19/36 (52.78%), Postives = 27/36 (75.00%), Query Frame = 1
Query:  706 FGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMT 813
            F +TYL E+GFST+ VIKTK RN L I   +R++++
Sbjct: 1271 FPSTYLCETGFSTLSVIKTKHRNSLNIHYPLRVALS 1306          

HSP 3 Score: 40.0466 bits (92), Expect = 1.279e-29
Identity = 15/23 (65.22%), Postives = 19/23 (82.61%), Query Frame = 1
Query:   31 MGAEHQTLFLHSHIRWLSKGKVL 99
            M A+H+ L LH+ IRWLS+GKVL
Sbjct: 1046 MEADHKQLLLHAEIRWLSRGKVL 1068          

HSP 4 Score: 27.335 bits (59), Expect = 1.279e-29
Identity = 12/27 (44.44%), Postives = 18/27 (66.67%), Query Frame = 3
Query:  627 NISRFWFEIREEYKMLSENALKLLLFF 707
            ++  FW + + +Y  L+E ALKLLL F
Sbjct: 1245 SLPSFWIKAKNDYPELAEIALKLLLLF 1271          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 75.485 bits (184), Expect = 6.147e-25
Identity = 40/137 (29.20%), Postives = 79/137 (57.66%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAEL-AHNLTFPVKVQLIELTSNKTLEQKY 613
            L DIF+ +N+ NLS+QGK++T+F  ++K+ + ++K++ W  ++  + +   P+ S+F  +  ++     D+ +    HL  ++A L+ YFP  +D    + WV NPF+  +   +L       LI+LTS+  ++Q +
Sbjct:  477 LADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTE--INSTVDKDICSAIVQHLRGLRATLLKYFPVTND---NNAWVRNPFTVTVKPASLVARDYESLIDLTSDSQVKQNF 608          

HSP 2 Score: 40.817 bits (94), Expect = 6.147e-25
Identity = 15/29 (51.72%), Postives = 22/29 (75.86%), Query Frame = 1
Query:   13 KFYAKKMGAEHQTLFLHSHIRWLSKGKVL 99
            K   ++MGA+H  L L++ +RWLS+GKVL
Sbjct:  413 KILCEEMGAQHTALLLNTEVRWLSRGKVL 441          

HSP 3 Score: 36.5798 bits (83), Expect = 6.147e-25
Identity = 17/39 (43.59%), Postives = 23/39 (58.97%), Query Frame = 1
Query:  700 FSFGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMTN 816
              F T +L E+GFS     KTK R RL+ +  MRI ++N
Sbjct:  636 LPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSN 674          

HSP 4 Score: 21.9422 bits (45), Expect = 6.147e-25
Identity = 8/23 (34.78%), Postives = 15/23 (65.22%), Query Frame = 3
Query:  639 FWFEIREEYKMLSENALKLLLFF 707
            FW  + +EY  ++  A+++LL F
Sbjct:  616 FWSSLIQEYPSIARRAVRVLLPF 638          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 75.485 bits (184), Expect = 6.147e-25
Identity = 40/137 (29.20%), Postives = 79/137 (57.66%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAEL-AHNLTFPVKVQLIELTSNKTLEQKY 613
            L DIF+ +N+ NLS+QGK++T+F  ++K+ + ++K++ W  ++  + +   P+ S+F  +  ++     D+ +    HL  ++A L+ YFP  +D    + WV NPF+  +   +L       LI+LTS+  ++Q +
Sbjct:  477 LADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTE--INSTVDKDICSAIVQHLRGLRATLLKYFPVTND---NNAWVRNPFTVTVKPASLVARDYESLIDLTSDSQVKQNF 608          

HSP 2 Score: 40.817 bits (94), Expect = 6.147e-25
Identity = 15/29 (51.72%), Postives = 22/29 (75.86%), Query Frame = 1
Query:   13 KFYAKKMGAEHQTLFLHSHIRWLSKGKVL 99
            K   ++MGA+H  L L++ +RWLS+GKVL
Sbjct:  413 KILCEEMGAQHTALLLNTEVRWLSRGKVL 441          

HSP 3 Score: 36.5798 bits (83), Expect = 6.147e-25
Identity = 17/39 (43.59%), Postives = 23/39 (58.97%), Query Frame = 1
Query:  700 FSFGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMTN 816
              F T +L E+GFS     KTK R RL+ +  MRI ++N
Sbjct:  636 LPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSN 674          

HSP 4 Score: 21.9422 bits (45), Expect = 6.147e-25
Identity = 8/23 (34.78%), Postives = 15/23 (65.22%), Query Frame = 3
Query:  639 FWFEIREEYKMLSENALKLLLFF 707
            FW  + +EY  ++  A+++LL F
Sbjct:  616 FWSSLIQEYPSIARRAVRVLLPF 638          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Human
Match: ZMYM6 (zinc finger MYM-type containing 6 [Source:HGNC Symbol;Acc:HGNC:13050])

HSP 1 Score: 83.5741 bits (205), Expect = 2.257e-21
Identity = 48/133 (36.09%), Postives = 75/133 (56.39%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAELAHNLTFPVKVQLIELTSNKTLE 604
            L+DIFS +N+ NLSLQG   T FN  NKI+ F +K+++W+     + Y M PSFSEF +   L+   + D+      HL  +       FP + D+   ++W+I+PF     +NLT   + +L EL+S+  L+
Sbjct: 1116 LSDIFSLINELNLSLQGTLTTFFNLCNKIDVFKRKLKMWLKRTQENDYDMFPSFSEFSNSSGLN---MTDITRIIFEHLEGLSQVFSDCFPPEQDLRSGNLWIIHPFMNHQNNNLTDFEEEKLTELSSDLGLQ 1245          

HSP 2 Score: 39.6614 bits (91), Expect = 2.257e-21
Identity = 13/29 (44.83%), Postives = 23/29 (79.31%), Query Frame = 1
Query:   16 FYAKKMGAEHQTLFLHSHIRWLSKGKVLK 102
               ++MG+EH +L LH+ +RW+S+G++LK
Sbjct: 1052 ILCEEMGSEHVSLPLHAEVRWISRGRMLK 1080          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 82.0333 bits (201), Expect = 4.123e-23
Identity = 42/137 (30.66%), Postives = 76/137 (55.47%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAELAHNLTFPVKVQLIELTSNKTLEQKYQ 616
            L DIFS +N  N SLQG   T FN YNK++ F K++++W+     + Y M P FSEF D   +S   V ++ +    HL  +     + +P ++D+   ++W+ +PF+   ++NLT   + +L  L+++   +  ++
Sbjct: 1040 LADIFSLINKLNSSLQGTMTTFFNLYNKVDVFQKRLKMWLKRAQENDYGMFPLFSEFLDSSDVS---VKNIASIIFEHLEGLSQIFHACYPPEEDLRSGNLWLTDPFATYHSNNLTDSEEEKLAVLSADTGFQSVHK 1173          

HSP 2 Score: 36.965 bits (84), Expect = 4.123e-23
Identity = 26/52 (50.00%), Postives = 41/52 (78.85%), Query Frame = 1
Query:   25 KKMGAEHQTLFLHSHIRWLSKGKVLKXXXXXXXXXXXXXXXQKSNLSEFFQN 180
            ++MG+EH  L L++ +RWLS+G++L R FELR EIEIFL ++ S+L+ +F +
Sbjct:  979 EEMGSEHVNLPLNAEVRWLSRGRILTRLFELRHEIEIFLNQKHSDLARYFHD 1030          

HSP 3 Score: 29.261 bits (64), Expect = 4.123e-23
Identity = 12/32 (37.50%), Postives = 18/32 (56.25%), Query Frame = 3
Query:  627 NISRFWFEIREEYKMLSENALKLLLFFWNDLF 722
            ++++FW   +  Y  L E ALKLLL F +   
Sbjct: 1176 SVTQFWVNAKTSYPKLHEKALKLLLPFSSTCL 1207          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 77.411 bits (189), Expect = 7.906e-22
Identity = 40/116 (34.48%), Postives = 66/116 (56.90%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAELAHNLT 553
            L DIFS +N  N SLQG   T FN YNK++ F K++++W+     + Y M P FSEF D   +S   V ++ +    HL  +     + +P ++D+   ++W+ +PF+   ++NLT
Sbjct:  948 LADIFSLINKLNSSLQGTMTTFFNLYNKVDVFQKRLKMWLKRAQENDYGMFPLFSEFLDSSDVS---VKNIASIIFEHLEGLSQIFHACYPPEEDLRSGNLWLTDPFATYHSNNLT 1060          

HSP 2 Score: 37.3502 bits (85), Expect = 7.906e-22
Identity = 26/52 (50.00%), Postives = 41/52 (78.85%), Query Frame = 1
Query:   25 KKMGAEHQTLFLHSHIRWLSKGKVLKXXXXXXXXXXXXXXXQKSNLSEFFQN 180
            ++MG+EH  L L++ +RWLS+G++L R FELR EIEIFL ++ S+L+ +F +
Sbjct:  887 EEMGSEHVNLPLNAEVRWLSRGRILTRLFELRHEIEIFLNQKHSDLARYFHD 938          

HSP 3 Score: 29.261 bits (64), Expect = 7.906e-22
Identity = 12/32 (37.50%), Postives = 18/32 (56.25%), Query Frame = 3
Query:  627 NISRFWFEIREEYKMLSENALKLLLFFWNDLF 722
            ++++FW   +  Y  L E ALKLLL F +   
Sbjct: 1084 SVTQFWVNAKTSYPKLHEKALKLLLPFSSTCL 1115          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 61.6178 bits (148), Expect = 4.496e-13
Identity = 32/96 (33.33%), Postives = 56/96 (58.33%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDI 493
            L DIF+ +N+ NLSLQG + T  +   KI +F  K+QLW   ++ + + MLP+ S F ++  + Q + + V  + + HL  + +++  YFP   +I
Sbjct:  540 LVDIFTILNELNLSLQGPNSTCLDLSEKIHSFQMKLQLWQKKLDENKFYMLPTLSAFFEEHDIEQHKRITVVISVKEHLDMLASEISWYFPNLPEI 635          

HSP 2 Score: 32.7278 bits (73), Expect = 4.496e-13
Identity = 13/19 (68.42%), Postives = 16/19 (84.21%), Query Frame = 1
Query:   46 QTLFLHSHIRWLSKGKVLK 102
            +TL LH+  RWLS+GKVLK
Sbjct:  485 KTLLLHTEGRWLSRGKVLK 503          

HSP 3 Score: 43.1282 bits (100), Expect = 5.501e-6
Identity = 17/38 (44.74%), Postives = 27/38 (71.05%), Query Frame = 1
Query:  700 FSFGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMT 813
              F TTYL E+GFS+++VIK+K R+RL +   +R ++ 
Sbjct:  700 LPFPTTYLCETGFSSLLVIKSKYRSRLVVEDDLRCALA 737          

HSP 4 Score: 26.9498 bits (58), Expect = 5.501e-6
Identity = 11/26 (42.31%), Postives = 18/26 (69.23%), Query Frame = 3
Query:  630 ISRFWFEIREEYKMLSENALKLLLFF 707
            +++FW +  + Y +LSE  L+LLL F
Sbjct:  677 VTQFWVKCLQSYPVLSEMVLRLLLPF 702          
BLAST of zinc finger MYM-type protein 6 vs. UniProt/SwissProt
Match: sp|Q6R2W3|SCND3_HUMAN (SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED9 PE=2 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 5.640e-29
Identity = 46/142 (32.39%), Postives = 82/142 (57.75%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFS----EFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPF-SAELAHNLTFPVKVQLIELTSNKTLEQKYQ 616
            L+DIFS  ND N S+QGK+ T F+  +K+E   +K++ W + I+TDCY M  + +    E G+D      ++  +R     HL  +      YFP+K+D    ++W+ NPF S++   NLT  ++ +L++L +++ L+  ++
Sbjct: 1105 LSDIFSIFNDLNASMQGKNATYFSMADKVEGQKQKLEAWKNRISTDCYDMFHNLTTIINEVGND-----LDIAHLRKVISEHLTNLLECFEFYFPSKEDPRIGNLWIQNPFLSSKDNLNLTVTLQDKLLKLATDEGLKISFE 1241          

HSP 2 Score: 44.2838 bits (103), Expect = 5.640e-29
Identity = 19/36 (52.78%), Postives = 27/36 (75.00%), Query Frame = 1
Query:  706 FGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMT 813
            F +TYL E+GFST+ VIKTK RN L I   +R++++
Sbjct: 1271 FPSTYLCETGFSTLSVIKTKHRNSLNIHYPLRVALS 1306          

HSP 3 Score: 40.0466 bits (92), Expect = 5.640e-29
Identity = 15/23 (65.22%), Postives = 19/23 (82.61%), Query Frame = 1
Query:   31 MGAEHQTLFLHSHIRWLSKGKVL 99
            M A+H+ L LH+ IRWLS+GKVL
Sbjct: 1046 MEADHKQLLLHAEIRWLSRGKVL 1068          

HSP 4 Score: 27.335 bits (59), Expect = 5.640e-29
Identity = 12/27 (44.44%), Postives = 18/27 (66.67%), Query Frame = 3
Query:  627 NISRFWFEIREEYKMLSENALKLLLFF 707
            ++  FW + + +Y  L+E ALKLLL F
Sbjct: 1245 SLPSFWIKAKNDYPELAEIALKLLLLF 1271          
BLAST of zinc finger MYM-type protein 6 vs. UniProt/SwissProt
Match: sp|A4Z943|ZBED5_BOVIN (Zinc finger BED domain-containing protein 5 OS=Bos taurus OX=9913 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 1.253e-24
Identity = 40/137 (29.20%), Postives = 80/137 (58.39%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAEL-AHNLTFPVKVQLIELTSNKTLEQKY 613
            L DIF+ +N+ NLS+QGK++T+F  ++K+ + ++K++ W  ++  + +   P+ S+F  +  ++     ++ +    HL  +++ L+ YFP  +DIH    WV NPF+  +   +L       LI+LTS+  ++Q +
Sbjct:  478 LADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTE--INSTVDKNICSAIVQHLRGLRSTLLKYFPVTNDIH---AWVRNPFTVTVKPASLVARDYESLIDLTSDSQVKQSF 609          

HSP 2 Score: 40.4318 bits (93), Expect = 1.253e-24
Identity = 15/29 (51.72%), Postives = 22/29 (75.86%), Query Frame = 1
Query:   13 KFYAKKMGAEHQTLFLHSHIRWLSKGKVL 99
            K   ++MGA+H  L L++ +RWLS+GKVL
Sbjct:  414 KILCEEMGAQHTALLLNTEVRWLSRGKVL 442          

HSP 3 Score: 36.5798 bits (83), Expect = 1.253e-24
Identity = 17/39 (43.59%), Postives = 23/39 (58.97%), Query Frame = 1
Query:  700 FSFGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMTN 816
              F T +L E+GFS     KTK R RL+ +  MRI ++N
Sbjct:  637 LPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSN 675          

HSP 4 Score: 21.9422 bits (45), Expect = 1.253e-24
Identity = 8/23 (34.78%), Postives = 15/23 (65.22%), Query Frame = 3
Query:  639 FWFEIREEYKMLSENALKLLLFF 707
            FW  + +EY  ++  A+++LL F
Sbjct:  617 FWSSLIQEYPSVARRAVRVLLPF 639          
BLAST of zinc finger MYM-type protein 6 vs. UniProt/SwissProt
Match: sp|Q49AG3|ZBED5_HUMAN (Zinc finger BED domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ZBED5 PE=2 SV=2)

HSP 1 Score: 75.485 bits (184), Expect = 2.711e-24
Identity = 40/137 (29.20%), Postives = 79/137 (57.66%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAEL-AHNLTFPVKVQLIELTSNKTLEQKY 613
            L DIF+ +N+ NLS+QGK++T+F  ++K+ + ++K++ W  ++  + +   P+ S+F  +  ++     D+ +    HL  ++A L+ YFP  +D    + WV NPF+  +   +L       LI+LTS+  ++Q +
Sbjct:  477 LADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTE--INSTVDKDICSAIVQHLRGLRATLLKYFPVTND---NNAWVRNPFTVTVKPASLVARDYESLIDLTSDSQVKQNF 608          

HSP 2 Score: 40.817 bits (94), Expect = 2.711e-24
Identity = 15/29 (51.72%), Postives = 22/29 (75.86%), Query Frame = 1
Query:   13 KFYAKKMGAEHQTLFLHSHIRWLSKGKVL 99
            K   ++MGA+H  L L++ +RWLS+GKVL
Sbjct:  413 KILCEEMGAQHTALLLNTEVRWLSRGKVL 441          

HSP 3 Score: 36.5798 bits (83), Expect = 2.711e-24
Identity = 17/39 (43.59%), Postives = 23/39 (58.97%), Query Frame = 1
Query:  700 FSFGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMTN 816
              F T +L E+GFS     KTK R RL+ +  MRI ++N
Sbjct:  636 LPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSN 674          

HSP 4 Score: 21.9422 bits (45), Expect = 2.711e-24
Identity = 8/23 (34.78%), Postives = 15/23 (65.22%), Query Frame = 3
Query:  639 FWFEIREEYKMLSENALKLLLFF 707
            FW  + +EY  ++  A+++LL F
Sbjct:  616 FWSSLIQEYPSIARRAVRVLLPF 638          
BLAST of zinc finger MYM-type protein 6 vs. UniProt/SwissProt
Match: sp|A4Z944|ZBED5_CANLF (Zinc finger BED domain-containing protein 5 OS=Canis lupus familiaris OX=9615 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 9.049e-24
Identity = 39/137 (28.47%), Postives = 79/137 (57.66%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAEL-AHNLTFPVKVQLIELTSNKTLEQKY 613
            L DIF+ +N+ NLS+QGK++T+F  ++K+ + ++K++ W  ++  + +   P+ S+F  +  ++     D+ +    HL  +++ L+ YFP  +D    + WV NPF+  +   +L       LI+LTS+  ++Q +
Sbjct:  478 LADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTE--INSTVDKDICSAIVQHLRGLRSTLLKYFPVTND---NNTWVRNPFTVTVKPASLVARDYESLIDLTSDSQVKQNF 609          

HSP 2 Score: 40.817 bits (94), Expect = 9.049e-24
Identity = 15/29 (51.72%), Postives = 22/29 (75.86%), Query Frame = 1
Query:   13 KFYAKKMGAEHQTLFLHSHIRWLSKGKVL 99
            K   ++MGA+H  L L++ +RWLS+GKVL
Sbjct:  414 KILCEEMGAQHTALLLNTEVRWLSRGKVL 442          

HSP 3 Score: 36.1946 bits (82), Expect = 9.049e-24
Identity = 17/39 (43.59%), Postives = 23/39 (58.97%), Query Frame = 1
Query:  700 FSFGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMTN 816
              F T +L E+GFS     KTK R RL+ +  MRI ++N
Sbjct:  637 LPFATMHLCETGFSYYAATKTKYRKRLDAAPHMRIRLSN 675          

HSP 4 Score: 21.9422 bits (45), Expect = 9.049e-24
Identity = 8/23 (34.78%), Postives = 15/23 (65.22%), Query Frame = 3
Query:  639 FWFEIREEYKMLSENALKLLLFF 707
            FW  + +EY  ++  A+++LL F
Sbjct:  617 FWSSLIQEYPSIARRAVRVLLPF 639          
BLAST of zinc finger MYM-type protein 6 vs. UniProt/SwissProt
Match: sp|O95789|ZMYM6_HUMAN (Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2)

HSP 1 Score: 83.5741 bits (205), Expect = 9.945e-21
Identity = 48/133 (36.09%), Postives = 75/133 (56.39%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAELAHNLTFPVKVQLIELTSNKTLE 604
            L+DIFS +N+ NLSLQG   T FN  NKI+ F +K+++W+     + Y M PSFSEF +   L+   + D+      HL  +       FP + D+   ++W+I+PF     +NLT   + +L EL+S+  L+
Sbjct: 1116 LSDIFSLINELNLSLQGTLTTFFNLCNKIDVFKRKLKMWLKRTQENDYDMFPSFSEFSNSSGLN---MTDITRIIFEHLEGLSQVFSDCFPPEQDLRSGNLWIIHPFMNHQNNNLTDFEEEKLTELSSDLGLQ 1245          

HSP 2 Score: 39.6614 bits (91), Expect = 9.945e-21
Identity = 13/29 (44.83%), Postives = 23/29 (79.31%), Query Frame = 1
Query:   16 FYAKKMGAEHQTLFLHSHIRWLSKGKVLK 102
               ++MG+EH +L LH+ +RW+S+G++LK
Sbjct: 1052 ILCEEMGSEHVSLPLHAEVRWISRGRMLK 1080          
BLAST of zinc finger MYM-type protein 6 vs. TrEMBL
Match: A0A2S2R2G6 (SCAN domain-containing protein 3 OS=Sipha flava OX=143950 GN=SCAND3_13 PE=4 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 4.837e-41
Identity = 52/140 (37.14%), Postives = 83/140 (59.29%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAELAHNLTFPVKVQLIELTSNKTLEQKYQVQK 625
            L+DIFS +N+ NLS+QG H  LF  YNKI+AF+KKI+LW + +    + M P+F     + IL++ E+ ++    E HL  ++ K+  YF    DI +   WVINPF     + L+   + +LIEL+++  L + ++  K
Sbjct:  422 LSDIFSILNELNLSMQGPHTNLFISYNKIDAFLKKIRLWTNRVRNYTFDMFPNFFNMTQENILTKNEINEMCIIIEEHLGRLREKMSKYFDPTKDIRKNCNWVINPFVQSDQNILSLTNEEKLIELSADVGLHEIFRSNK 561          

HSP 2 Score: 59.3066 bits (142), Expect = 4.837e-41
Identity = 28/37 (75.68%), Postives = 31/37 (83.78%), Query Frame = 1
Query:  703 SFGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMT 813
            SF TTYL E+GFST+  IK K RNRLEISSAMRIS+T
Sbjct:  587 SFSTTYLCENGFSTLTTIKNKTRNRLEISSAMRISLT 623          

HSP 3 Score: 46.595 bits (109), Expect = 4.837e-41
Identity = 31/58 (53.45%), Postives = 47/58 (81.03%), Query Frame = 1
Query:   13 KFYAKKMGAEHQTLFLHSHIRWLSKGKVLKXXXXXXXXXXXXXXXQKSNLSEFFQNNL 186
            K   ++MG+  + L LH+H+RWLS+GKVL R FEL+ E+EIFLR++KS +S++F+NN+
Sbjct:  357 KVMCEEMGSGFKNLLLHTHVRWLSRGKVLTRLFELKTEVEIFLRDKKSPVSDYFENNV 414          

HSP 4 Score: 31.9574 bits (71), Expect = 4.837e-41
Identity = 13/27 (48.15%), Postives = 19/27 (70.37%), Query Frame = 3
Query:  627 NISRFWFEIREEYKMLSENALKLLLFF 707
            NI +FW +++ EY  L+E  LKLL+ F
Sbjct:  562 NIGQFWIKVQNEYPSLAEEVLKLLISF 588          

HSP 5 Score: 21.557 bits (44), Expect = 4.837e-41
Identity = 6/12 (50.00%), Postives = 11/12 (91.67%), Query Frame = 3
Query:    3 RIFKILCQKNGS 38
            R+FK++C++ GS
Sbjct:  354 RVFKVMCEEMGS 365          
BLAST of zinc finger MYM-type protein 6 vs. TrEMBL
Match: A0A2S2R615 (Zinc finger MYM-type protein 6 (Fragment) OS=Sipha flava OX=143950 GN=ZMYM6_10 PE=4 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.944e-38
Identity = 55/140 (39.29%), Postives = 85/140 (60.71%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAELAHNLTFPVKVQLIELTSNKTLEQKYQVQK 625
            ++DIFS +ND NLSLQG +  +F   NKIEAF+ KI+LW   +    + M PSF    ++KI+++ E+ +++     HL+++K K + YF    DI   ++WVINPF     + L+   + +LIEL S+K LEQ +   K
Sbjct:  198 ISDIFSILNDLNLSLQGPYTNIFTSNNKIEAFLNKIELWEKRLQKLTFDMFPSFFNIVEEKIINENEINEMQNVIAIHLLKLKEKFLKYFDPTKDIRLNNLWVINPFIKSEKNKLSSLNEEKLIELYSDKGLEQIFHSNK 337          

HSP 2 Score: 53.9138 bits (128), Expect = 1.944e-38
Identity = 25/37 (67.57%), Postives = 29/37 (78.38%), Query Frame = 1
Query:  703 SFGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMT 813
             F TTYL E+GFSTM  IKTK RNRL+IS  MRIS++
Sbjct:  363 PFSTTYLCEAGFSTMTTIKTKSRNRLDISPTMRISLS 399          

HSP 3 Score: 48.9062 bits (115), Expect = 1.944e-38
Identity = 30/58 (51.72%), Postives = 46/58 (79.31%), Query Frame = 1
Query:   13 KFYAKKMGAEHQTLFLHSHIRWLSKGKVLKXXXXXXXXXXXXXXXQKSNLSEFFQNNL 186
            K    +MG+++ +L LH+H+RWLS+GK L R FEL+ E+EIFL+++KS L ++F+NNL
Sbjct:  133 KVMCDEMGSDYTSLLLHTHVRWLSRGKCLTRLFELKTEVEIFLKDKKSPLGDYFENNL 190          

HSP 4 Score: 32.3426 bits (72), Expect = 1.944e-38
Identity = 14/27 (51.85%), Postives = 19/27 (70.37%), Query Frame = 3
Query:  627 NISRFWFEIREEYKMLSENALKLLLFF 707
            NI +FW +I+ EY  L+E ALK L+ F
Sbjct:  338 NICKFWIKIQSEYPALTEEALKKLIPF 364          

HSP 5 Score: 21.557 bits (44), Expect = 1.944e-38
Identity = 7/12 (58.33%), Postives = 10/12 (83.33%), Query Frame = 3
Query:    3 RIFKILCQKNGS 38
            RIFK++C + GS
Sbjct:  130 RIFKVMCDEMGS 141          
BLAST of zinc finger MYM-type protein 6 vs. TrEMBL
Match: J9LZ91 (DUF4371 domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 110.923 bits (276), Expect = 6.420e-34
Identity = 57/139 (41.01%), Postives = 87/139 (62.59%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAELAHNLTFPVKVQLIELTSNKTLEQKYQVQ 622
            L+DIFS +N+ NLS+QG    +F CYNK+EAF+ K+ LWI  I  + Y M PS+    ++K L + E+  ++   + HL ++K KL+ YFP   DI   +MW++NPF     H L+   + QL+EL+S+K LEQ +  +
Sbjct:  424 LSDIFSLLNELNLSMQGPLTNIFTCYNKVEAFLNKLDLWIKRIQENTYDMFPSYYNITEEKFLKKNEINVMQCVIKTHLSKLKNKLLKYFPPSHDIRSNNMWILNPFLPCENHKLSLLNESQLLELSSDKLLEQSFNTK 562          

HSP 2 Score: 56.225 bits (134), Expect = 6.420e-34
Identity = 25/38 (65.79%), Postives = 30/38 (78.95%), Query Frame = 1
Query:  703 SFGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMTN 816
            SF TTYL ESGFST+  IKTK RN+L++   MRIS+TN
Sbjct:  588 SFATTYLCESGFSTLTTIKTKARNKLDVEPTMRISLTN 625          

HSP 3 Score: 28.4906 bits (62), Expect = 6.420e-34
Identity = 13/27 (48.15%), Postives = 18/27 (66.67%), Query Frame = 3
Query:  627 NISRFWFEIREEYKMLSENALKLLLFF 707
            N+++FW  +R EY  L E ALK L+ F
Sbjct:  563 NLNQFWISLRNEYHNLYEEALKKLVSF 589          
BLAST of zinc finger MYM-type protein 6 vs. TrEMBL
Match: A0A2J7PUK3 (Dimer_Tnp_hAT domain-containing protein OS=Cryptotermes secundus OX=105785 GN=B7P43_G06635 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.632e-31
Identity = 53/141 (37.59%), Postives = 80/141 (56.74%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEF--GDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAELAHNLT-FPVK--VQLIELTSNKTLEQKY 613
            L+DIFS+MN+ NL  QG    +FN +NKIE+F KK++LW++ I      M  S S++    D + SQ  V D+      HL  +      YFP  +D  +++MW++ PF   + H +T FP+K    L EL+S+K LE  +
Sbjct:   95 LSDIFSYMNELNLKFQGPDTIIFNEWNKIESFKKKLRLWLNMIAEGNNEMFQSCSDYIMEADDLYSQNSVSDIIAA---HLKMMMLSFEKYFPEHEDPQRQNMWIVKPF---VEHKVTAFPMKKPFNLFELSSDKGLESTF 229          

HSP 2 Score: 46.595 bits (109), Expect = 3.632e-31
Identity = 33/72 (45.83%), Postives = 50/72 (69.44%), Query Frame = 1
Query:   13 KFYAKKMGAEHQTLFLHSHIRWLSKGKVLKXXXXXXXXXXXXXXXQKSNLSEFFQNNL*I*KNKFDRYIFTY 228
            K    +MG++HQ L  HS +RWLS+ +VLKR FEL+ E+E+FL ++KSNLS +FQ+   + +  +   IF+Y
Sbjct:   30 KALCDEMGSDHQNLLFHSEVRWLSRNQVLKRLFELQKEVELFLIDKKSNLSHYFQDKKWVARLAYLSDIFSY 101          

HSP 3 Score: 45.0542 bits (105), Expect = 3.632e-31
Identity = 19/37 (51.35%), Postives = 27/37 (72.97%), Query Frame = 1
Query:  706 FGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMTN 816
            F TTYL E+ FS M V+KTK RN L++S  +R+ +T+
Sbjct:  259 FSTTYLCETAFSAMTVLKTKQRNCLKLSDCLRLVLTS 295          

HSP 4 Score: 28.1054 bits (61), Expect = 3.632e-31
Identity = 12/25 (48.00%), Postives = 17/25 (68.00%), Query Frame = 3
Query:  633 SRFWFEIREEYKMLSENALKLLLFF 707
            S+FW  ++ EY  L E A++ LLFF
Sbjct:  235 SKFWIRMKNEYPNLHEIAVRFLLFF 259          
BLAST of zinc finger MYM-type protein 6 vs. TrEMBL
Match: A0A2K5RH95 (Zinc finger BED-type containing 9 OS=Cebus capucinus imitator OX=1737458 GN=ZBED9 PE=4 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 9.666e-28
Identity = 51/165 (30.91%), Postives = 90/165 (54.55%), Query Frame = 2
Query:  125 KLKYFYANKNQI*ANFFKIICRYKKIN-LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFS----EFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPF-SAELAHNLTFPVKVQLIELTSNKTL 601
            +L  F   K  + +  FK +    ++  L+DIFS  ND N S+QGK+ T F+  +K+E   +K++ W + I+TDCY M  + +    E G+D      ++  +R     HL  +      YFP+K+D    ++W+ NPF S++   NLT  ++ +L++L +++ L
Sbjct: 1078 ELLVFLQGKKPVWSQLFKDVNWTARLAYLSDIFSIFNDLNASMQGKNATYFSMADKVEGQKQKLEAWKNRISTDCYDMFHNLTTIINEVGND-----LDIAHLRKVISEHLTNLLECFEFYFPSKEDPRIGNLWIQNPFLSSKGNLNLTVTLQDKLLKLATDEGL 1237          

HSP 2 Score: 44.2838 bits (103), Expect = 9.666e-28
Identity = 19/36 (52.78%), Postives = 27/36 (75.00%), Query Frame = 1
Query:  706 FGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMT 813
            F +TYL E+GFST+ VIKTK RN L I   +R++++
Sbjct: 1272 FPSTYLCETGFSTLSVIKTKHRNSLNIHYPLRVALS 1307          

HSP 3 Score: 40.0466 bits (92), Expect = 9.666e-28
Identity = 15/23 (65.22%), Postives = 19/23 (82.61%), Query Frame = 1
Query:   31 MGAEHQTLFLHSHIRWLSKGKVL 99
            M A+H+ L LH+ IRWLS+GKVL
Sbjct: 1047 MEADHKQLLLHAEIRWLSRGKVL 1069          

HSP 4 Score: 30.4166 bits (67), Expect = 9.666e-28
Identity = 13/27 (48.15%), Postives = 19/27 (70.37%), Query Frame = 3
Query:  627 NISRFWFEIREEYKMLSENALKLLLFF 707
            ++  FW +++ EY  L+E ALKLLL F
Sbjct: 1246 SLPSFWIKVKNEYPELAEIALKLLLLF 1272          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000051422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:35461191:35465166:-1 gene:ENSAMXG00000032672.1 transcript:ENSAMXT00000051422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 2.919e-27
Identity = 42/107 (39.25%), Postives = 59/107 (55.14%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPF 526
            L+DIF+H+N  N+SLQGK +T F+  NKIEA IKK+ +W   +    Y    + S+F   +  S    +  R   E HL  +K +L  YFP   D+H    W+ NPF
Sbjct:  454 LSDIFTHLNGLNISLQGKSVTAFHVQNKIEATIKKLDMWTKRVEQSNYESFDNLSDFLTKENASLPNAVS-RPIVE-HLQSLKMQLRDYFPAL-DVHFS--WIENPF 555          

HSP 2 Score: 46.595 bits (109), Expect = 2.919e-27
Identity = 18/40 (45.00%), Postives = 28/40 (70.00%), Query Frame = 1
Query:  694 YCFSFGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMT 813
            +   F TTYL E+GFS ++V+KTK RNRL +   +R+ ++
Sbjct:  613 FLMPFPTTYLCETGFSMLVVLKTKYRNRLNVEPDLRLQLS 652          

HSP 3 Score: 38.5058 bits (88), Expect = 2.919e-27
Identity = 14/25 (56.00%), Postives = 20/25 (80.00%), Query Frame = 1
Query:   25 KKMGAEHQTLFLHSHIRWLSKGKVL 99
            ++MG+ H  L LH+ +RWLS+GKVL
Sbjct:  393 EEMGSSHVQLLLHTEVRWLSRGKVL 417          

HSP 4 Score: 25.7942 bits (55), Expect = 2.919e-27
Identity = 10/23 (43.48%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  639 FWFEIREEYKMLSENALKLLLFF 707
            FW   R EY  LS+ A++ L+ F
Sbjct:  595 FWLHARSEYPDLSDKAVRFLMPF 617          

HSP 5 Score: 21.1718 bits (43), Expect = 2.919e-27
Identity = 6/12 (50.00%), Postives = 11/12 (91.67%), Query Frame = 3
Query:    3 RIFKILCQKNGS 38
            R+F++LC++ GS
Sbjct:  386 RLFRVLCEEMGS 397          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000044261.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000070.1:2279767:2281653:1 gene:ENSAMXG00000037161.1 transcript:ENSAMXT00000044261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 3.416e-26
Identity = 43/107 (40.19%), Postives = 59/107 (55.14%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPF 526
            L+DIF+H+N  NLSLQGK +T F+  NKIEA IKK+ +W   +    Y    + S+F   +  S    +  R   E HL  +K +L  YFP   D+H    W+ NPF
Sbjct:  411 LSDIFTHLNGLNLSLQGKSVTAFHVQNKIEATIKKLDMWTKRVEQSNYESFDNLSDFLTKENASLPNAVS-RPIVE-HLQSLKMQLRDYFPAL-DVHFS--WIENPF 512          

HSP 2 Score: 46.595 bits (109), Expect = 3.416e-26
Identity = 18/40 (45.00%), Postives = 28/40 (70.00%), Query Frame = 1
Query:  694 YCFSFGTTYLVESGFSTMIVIKTKLRNRLEISSAMRISMT 813
            +   F TTYL E+GFS ++V+KTK RNRL +   +R+ ++
Sbjct:  570 FLMPFPTTYLCETGFSMLVVLKTKYRNRLNVEPDLRLQLS 609          

HSP 3 Score: 35.4242 bits (80), Expect = 3.416e-26
Identity = 13/25 (52.00%), Postives = 18/25 (72.00%), Query Frame = 1
Query:   25 KKMGAEHQTLFLHSHIRWLSKGKVL 99
            ++M + H  L LH+ +RWLS GKVL
Sbjct:  350 EEMASSHVQLLLHTEVRWLSHGKVL 374          

HSP 4 Score: 25.7942 bits (55), Expect = 3.416e-26
Identity = 10/23 (43.48%), Postives = 14/23 (60.87%), Query Frame = 3
Query:  639 FWFEIREEYKMLSENALKLLLFF 707
            FW   R EY  LS+ A++ L+ F
Sbjct:  552 FWLHARSEYPDLSDKAVRFLMPF 574          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000050151.1 (pep primary_assembly:Astyanax_mexicanus-2.0:17:23214084:23215952:-1 gene:ENSAMXG00000029603.1 transcript:ENSAMXT00000050151.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.8246 bits (107), Expect = 2.259e-14
Identity = 38/150 (25.33%), Postives = 76/150 (50.67%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTE--NHLIEIKAKLVSYFPTKDDIHQRDMWVINP--------FSAELAHNL----TFPVKVQLIELTSNKTLEQKY 613
            L DI SH+N  NL LQGK+ ++ +    + +F +K+Q++ + +  D Y   P        K+   Q   DV +  E  + LIE  +K    F   +++    +++ NP        F+ ++ H+     T P+++Q+I+L ++  L++++
Sbjct:  396 LADIMSHLNGLNLQLQGKNNSICDLMTAVRSFQRKLQVFKEDLQGD-YTHFP--------KVKQVQGHRDVSSFVEFVDKLIENFSKRFDSFSIGEELK---LFIQNPFLITDVRAFTNDVTHHFKWANTGPLQMQMIDLQADVALKEQF 533          

HSP 2 Score: 37.7354 bits (86), Expect = 2.259e-14
Identity = 18/40 (45.00%), Postives = 28/40 (70.00%), Query Frame = 1
Query:  706 FGTTYLVESGFSTMIVIKTKLRNRL---EISSAMRISMTN 816
            FG+TY  E+ FSTM +IKTK R++L    +   MR+++T+
Sbjct:  565 FGSTYSCEAAFSTMNIIKTKYRSKLTNEHLHMCMRMALTS 604          

HSP 3 Score: 34.2686 bits (77), Expect = 2.259e-14
Identity = 13/28 (46.43%), Postives = 20/28 (71.43%), Query Frame = 1
Query:   19 YAKKMGAEHQTLFLHSHIRWLSKGKVLK 102
            + K+  A    L LH+++RWLSKG+VL+
Sbjct:  329 FLKETDANSDDLLLHNNVRWLSKGRVLE 356          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000057314.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:4224188:4227217:-1 gene:ENSAMXG00000029268.1 transcript:ENSAMXT00000057314.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 44.669 bits (104), Expect = 9.411e-9
Identity = 31/114 (27.19%), Postives = 55/114 (48.25%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQE--VLDVRTTTE--NHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAE 535
            L DIFS  N+ N  +QG   T+  C   ++AF++K++   + +        P         +L QQ   VL    TT+   H+  ++ ++ S F    ++  +D WV++PF A+
Sbjct:  344 LADIFSLYNEANKRMQGADGTVIECKETVDAFVRKVEFRRNKLKKGDLQHFP---------LLLQQSGGVLPDALTTQFACHMDRLQEEMHSRFSDIHELVSKDAWVMDPFLAK 448          

HSP 2 Score: 35.039 bits (79), Expect = 9.411e-9
Identity = 13/19 (68.42%), Postives = 16/19 (84.21%), Query Frame = 1
Query:   43 HQTLFLHSHIRWLSKGKVL 99
            HQTL LH+ +RWLS+GK L
Sbjct:  320 HQTLLLHTEVRWLSRGKFL 338          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Cavefish
Match: ENSAMXT00000054244.1 (SCAN domain-containing protein 3-like [Source:NCBI gene;Acc:111191664])

HSP 1 Score: 41.2022 bits (95), Expect = 2.775e-7
Identity = 18/46 (39.13%), Postives = 30/46 (65.22%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTD 343
            L DIF H+N  NL LQGK  T+ +   K+E+F + ++++   I+T+
Sbjct:  398 LCDIFGHLNKLNLQLQGKDKTIVDMVEKLESFTRMLEMFEADISTN 443          

HSP 2 Score: 33.113 bits (74), Expect = 2.775e-7
Identity = 14/32 (43.75%), Postives = 18/32 (56.25%), Query Frame = 1
Query:    7 FSKFYAKKMGAEHQTLFLHSHIRWLSKGKVLK 102
            F +  A+   A H  L L + +RWLSKGK L 
Sbjct:  327 FRQLVAESEDATHNDLLLQNDVRWLSKGKSLD 358          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Medaka
Match: ENSORLT00000035574.1 (pep primary_assembly:ASM223467v1:10:5595259:5596581:-1 gene:ENSORLG00000022539.1 transcript:ENSORLT00000035574.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 9.959e-27
Identity = 45/140 (32.14%), Postives = 73/140 (52.14%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEV--LDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAELAHNLTFPVKVQ--LIELTSNKTLEQKY 613
            L DIF  +N+ N+SLQGK  ++ N Y+K+  F+KK ++W    + + +   P       D  LS ++V    V+     HL  + +   SYFP  D+   +  WV NPF    A+    PV  Q  L+E++S++ L+ K+
Sbjct:  222 LADIFRKLNELNMSLQGKDTSILNLYDKVGGFLKKAEMWKRACDQEDFTCFPQL-----DVFLSNEDVATAPVKLVIVGHLANLISGFHSYFPDMDEKSVQLDWVRNPFLLSEANRSKLPVTHQEKLMEVSSDRGLQMKF 356          

HSP 2 Score: 38.1206 bits (87), Expect = 9.959e-27
Identity = 14/26 (53.85%), Postives = 19/26 (73.08%), Query Frame = 1
Query:   22 AKKMGAEHQTLFLHSHIRWLSKGKVL 99
             +  GAEH  L LH+ +RWLS+G+VL
Sbjct:  160 CENTGAEHTELLLHTEVRWLSRGRVL 185          

HSP 3 Score: 38.1206 bits (87), Expect = 9.959e-27
Identity = 16/33 (48.48%), Postives = 23/33 (69.70%), Query Frame = 1
Query:  700 FSFGTTYLVESGFSTMIVIKTKLRNRLEISSAM 798
              F +TYL E+ FS M++IKTK RNRL +  ++
Sbjct:  384 LPFASTYLCEASFSAMMLIKTKQRNRLCLEKSL 416          

HSP 4 Score: 27.335 bits (59), Expect = 9.959e-27
Identity = 10/30 (33.33%), Postives = 20/30 (66.67%), Query Frame = 3
Query:  624 NNISRFWFEIREEYKMLSENALKLLLFFWN 713
            + +++FW  +R+E+  L + AL+ LL F +
Sbjct:  359 STLTQFWLCVRQEHPELGQKALEQLLPFAS 388          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Medaka
Match: ENSORLT00000031208.1 (pep primary_assembly:ASM223467v1:14:26692610:26696672:-1 gene:ENSORLG00000026199.1 transcript:ENSORLT00000031208.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 1.281e-26
Identity = 45/140 (32.14%), Postives = 74/140 (52.86%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEV--LDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAELAHNLTFPVKVQ--LIELTSNKTLEQKY 613
            L DIF  +N+ N+SLQGK  ++ N Y+K+  F+KK+++W    + + +   P       D  LS ++V    V+     HL  + +   SYFP  D+   +  WV NPF    A+    PV  Q  L+E++S++ L+ K+
Sbjct:  386 LADIFRKLNELNMSLQGKDTSILNLYDKVGGFLKKVEMWKRACDQEDFTCFPQL-----DVFLSNEDVATAPVKLVIVGHLANLISGFHSYFPDMDEKSVQLDWVRNPFLLSEANRSKLPVTHQEKLMEVSSDRGLQMKF 520          

HSP 2 Score: 37.7354 bits (86), Expect = 1.281e-26
Identity = 14/26 (53.85%), Postives = 18/26 (69.23%), Query Frame = 1
Query:   22 AKKMGAEHQTLFLHSHIRWLSKGKVL 99
             +  GAEH  L LH  +RWLS+G+VL
Sbjct:  324 CENTGAEHTELLLHPEVRWLSRGRVL 349          

HSP 3 Score: 36.965 bits (84), Expect = 1.281e-26
Identity = 15/26 (57.69%), Postives = 19/26 (73.08%), Query Frame = 1
Query:  700 FSFGTTYLVESGFSTMIVIKTKLRNR 777
              F +TYL E+ FS M++IKTK RNR
Sbjct:  548 LPFASTYLCEASFSAMMLIKTKQRNR 573          

HSP 4 Score: 27.335 bits (59), Expect = 1.281e-26
Identity = 10/28 (35.71%), Postives = 19/28 (67.86%), Query Frame = 3
Query:  624 NNISRFWFEIREEYKMLSENALKLLLFF 707
            + +++FW  +R+E+  L + AL+ LL F
Sbjct:  523 STLTQFWLCVRQEHPELGQKALEQLLPF 550          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Medaka
Match: ENSORLT00000040762.1 (pep primary_assembly:ASM223467v1:1:8553592:8557739:1 gene:ENSORLG00000022190.1 transcript:ENSORLT00000040762.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 1.597e-25
Identity = 45/141 (31.91%), Postives = 73/141 (51.77%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEV--LDVRTTTENHLIE-IKAKLVSYFPTKDDIHQRDMWVINPFSAELAHNLTFPVKVQ--LIELTSNKTLEQKY 613
            L DIF  +N+ N+SLQGK  ++ N Y+K+  F+KK ++W    + + +   P       D  LS ++V    V+     HL   + +   SYFP  D+   +  WV NPF    A+    PV  Q  L+E++S++ L+ K+
Sbjct:  436 LADIFRKLNELNMSLQGKDTSILNLYDKVGGFLKKAEMWKRACDQEDFTCFPQL-----DVFLSNEDVATAPVKLVIVGHLAANLISGFHSYFPDMDEKSVQLDWVRNPFLLSEANRSKLPVTHQEKLMEVSSDRGLQMKF 571          

HSP 2 Score: 38.5058 bits (88), Expect = 1.597e-25
Identity = 16/27 (59.26%), Postives = 20/27 (74.07%), Query Frame = 1
Query:  700 FSFGTTYLVESGFSTMIVIKTKLRNRL 780
              F +TYL E+ FS M++IKTK RNRL
Sbjct:  599 LPFASTYLCEASFSAMMLIKTKQRNRL 625          

HSP 3 Score: 38.1206 bits (87), Expect = 1.597e-25
Identity = 14/26 (53.85%), Postives = 19/26 (73.08%), Query Frame = 1
Query:   22 AKKMGAEHQTLFLHSHIRWLSKGKVL 99
             +  GAEH  L LH+ +RWLS+G+VL
Sbjct:  374 CENTGAEHTELLLHTEVRWLSRGRVL 399          

HSP 4 Score: 27.7202 bits (60), Expect = 1.597e-25
Identity = 10/30 (33.33%), Postives = 20/30 (66.67%), Query Frame = 3
Query:  624 NNISRFWFEIREEYKMLSENALKLLLFFWN 713
            + +++FW  +R+E+  L + AL+ LL F +
Sbjct:  574 STLTQFWLCVRQEHPELGQKALEQLLPFAS 603          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Medaka
Match: ENSORLT00000030244.1 (pep primary_assembly:ASM223467v1:13:28104458:28106771:-1 gene:ENSORLG00000022768.1 transcript:ENSORLT00000030244.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 1.874e-25
Identity = 43/139 (30.94%), Postives = 78/139 (56.12%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAELAHN-LTFP--VKVQLIELTSNKTLEQKY 613
            L+DIFS +N  N+SLQG++  +F   +K++AF +K+ LW    + +   M P  S+     IL     + +  +   HL ++  K   YFP  +D  +  MWV++PFS +   N +  P  ++ QL+E++++ TL+ ++
Sbjct:  252 LSDIFSLLNQLNISLQGRNSNIFFVADKVQAFQRKLSLWSKRAHEERLDMFPLLSD-----ILESSPQVKISHSVSQHLSQLAEKFAEYFP--EDPREGHMWVVDPFSVDPTENDVALPSHLESQLLEVSTDSTLKGQW 383          

HSP 2 Score: 39.2762 bits (90), Expect = 1.874e-25
Identity = 20/40 (50.00%), Postives = 27/40 (67.50%), Query Frame = 1
Query:  700 FSFGTTYLVESGFSTMIVIKTKLRNRLEIS--SAMRISMT 813
              F TTYL ESGFST+   KTK R+RL  S  + +R+S++
Sbjct:  411 LPFTTTYLCESGFSTVATTKTKARSRLRASLEATLRVSLS 450          

HSP 3 Score: 32.7278 bits (73), Expect = 1.874e-25
Identity = 25/50 (50.00%), Postives = 33/50 (66.00%), Query Frame = 1
Query:   31 MGAEHQTLFLHSHIRWLSKGKVLKXXXXXXXXXXXXXXXQKSNLSEFFQN 180
            M A+H  L  HS +RWLS+G VL R FELR E+  FL ++KS L+  + N
Sbjct:  193 MEADHVKLLYHSEVRWLSRGLVLTRIFELRKEVFSFLTDKKSPLAHHYTN 242          

HSP 4 Score: 26.1794 bits (56), Expect = 1.874e-25
Identity = 11/29 (37.93%), Postives = 19/29 (65.52%), Query Frame = 3
Query:  621 KNNISRFWFEIREEYKMLSENALKLLLFF 707
            K ++  FW  + +EY +L+  A+K+LL F
Sbjct:  385 KLDLGSFWIVVSKEYPLLALRAVKVLLPF 413          
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Medaka
Match: ENSORLT00000030788.1 (pep primary_assembly:ASM223467v1:17:2264135:2274164:1 gene:ENSORLG00000023031.1 transcript:ENSORLT00000030788.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 2.027e-25
Identity = 45/140 (32.14%), Postives = 74/140 (52.86%), Query Frame = 2
Query:  206 LTDIFSHMNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEV--LDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAELAHNLTFPVKVQ--LIELTSNKTLEQKY 613
            L DIF  +N+ N+SLQGK+ ++ N Y+K+  F+KK ++W    + + +   P       D  LS ++V    V+     HL  + +   SYFP  D+   +  WV NPF    A+    PV  Q  L+E++S++ L+ K+
Sbjct:  363 LADIFRKLNELNMSLQGKNTSILNLYDKVGGFLKKAEMWKRACDQEDFTCFPQL-----DVFLSNEDVATAPVKLVIVGHLANLISGFHSYFPDTDEKSVQLDWVRNPFLLSEANRSKLPVTHQEKLMEVSSDRGLQMKF 497          

HSP 2 Score: 36.965 bits (84), Expect = 2.027e-25
Identity = 13/26 (50.00%), Postives = 18/26 (69.23%), Query Frame = 1
Query:   22 AKKMGAEHQTLFLHSHIRWLSKGKVL 99
             +  G EH  L LH+ +RWLS+G+VL
Sbjct:  301 CENTGVEHTELLLHTEVRWLSRGRVL 326          

HSP 3 Score: 36.965 bits (84), Expect = 2.027e-25
Identity = 15/26 (57.69%), Postives = 19/26 (73.08%), Query Frame = 1
Query:  700 FSFGTTYLVESGFSTMIVIKTKLRNR 777
              F +TYL E+ FS M++IKTK RNR
Sbjct:  525 LPFASTYLCEASFSAMMLIKTKQRNR 550          

HSP 4 Score: 24.6386 bits (52), Expect = 2.027e-25
Identity = 10/30 (33.33%), Postives = 19/30 (63.33%), Query Frame = 3
Query:  624 NNISRFWFEIREEYKMLSENALKLLLFFWN 713
            + +++FW   R+E+  L + AL+ LL F +
Sbjct:  500 STLTQFWLCERQEHPELGQKALEQLLPFAS 529          
BLAST of zinc finger MYM-type protein 6 vs. Planmine SMEST
Match: SMESG000055069.1 (SMESG000055069.1)

HSP 1 Score: 267.314 bits (682), Expect = 2.576e-86
Identity = 130/139 (93.53%), Postives = 132/139 (94.96%), Query Frame = 2
Query:  230 NDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAELAHNLTFPVKVQLIELTSNKTLEQKYQVQKQYISILV 646
            N  N S  GKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEF DDKILSQQEVLDVRTTTENHLIE+KAKLVSYFPTKDDIHQR+MWVINPFSAELAHNLTFP KVQLIELTSNKTLEQKYQVQKQYISILV
Sbjct:   80 NSENSSANGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEFVDDKILSQQEVLDVRTTTENHLIEMKAKLVSYFPTKDDIHQRNMWVINPFSAELAHNLTFPEKVQLIELTSNKTLEQKYQVQKQYISILV 218          
BLAST of zinc finger MYM-type protein 6 vs. Planmine SMEST
Match: SMESG000077718.1 (SMESG000077718.1)

HSP 1 Score: 155.992 bits (393), Expect = 4.745e-50
Identity = 78/96 (81.25%), Postives = 84/96 (87.50%), Query Frame = 2
Query:  350 MMLPSFSEFGDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPFSAELAHNLTFPVKVQLIELTSNKTLEQKYQVQKQYIS 637
            MMLPSFSEF DDKILS+QEVLDVRT  ENHLIE+KAKLV YFP+KDDI Q +MWV  PFSAELA+NLTFP KVQLIELTS+KTLEQKYQV K  IS
Sbjct:    1 MMLPSFSEFDDDKILSEQEVLDVRTIIENHLIEMKAKLVLYFPSKDDIRQGNMWVNYPFSAELANNLTFPEKVQLIELTSDKTLEQKYQVHKNNIS 96          

HSP 2 Score: 55.4546 bits (132), Expect = 4.745e-50
Identity = 26/30 (86.67%), Postives = 28/30 (93.33%), Query Frame = 3
Query:  621 KNNISRFWFEIREEYKMLSENALKLLLFFW 710
            KNNISRFWFEIREEYK+LS+NALKLLL F 
Sbjct:   92 KNNISRFWFEIREEYKILSQNALKLLLPFG 121          

HSP 3 Score: 27.7202 bits (60), Expect = 4.745e-50
Identity = 12/18 (66.67%), Postives = 12/18 (66.67%), Query Frame = 1
Query:  700 FSFGTTYLVESGFSTMIV 753
              FGTTYL ESGFS   V
Sbjct:  118 LPFGTTYLAESGFSKNKV 135          
BLAST of zinc finger MYM-type protein 6 vs. Planmine SMEST
Match: SMESG000013482.1 (SMESG000013482.1)

HSP 1 Score: 93.5893 bits (231), Expect = 2.587e-22
Identity = 50/104 (48.08%), Postives = 67/104 (64.42%), Query Frame = 2
Query: 1100 MDTISFIRIEIGKSREENTRLVRQLLQAK*ELQQIKATSFEPASVKKIY**LEVARTSLKEAVQVLQAQRFQIRALETALFASQEGNAVKCLLVFAPAQIAYKE 1411
            MD+   +R+E+  +R++N  L  Q++Q   E+ QI+AT  +PA VK +Y  L  A+    E  QV Q+ R QIR LE AL ASQEG AV   LVFAPAQ+AY+E
Sbjct:    1 MDSTPTLRMELATARKDNKNLYNQIIQLTREVHQIRATWIDPAKVKSLYQRLTAAQKGWAEEKQVNQSLRTQIRGLEVALSASQEGAAVTYPLVFAPAQLAYRE 104          
BLAST of zinc finger MYM-type protein 6 vs. Planmine SMEST
Match: SMESG000054288.1 (SMESG000054288.1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.124e-21
Identity = 52/127 (40.94%), Postives = 73/127 (57.48%), Query Frame = 2
Query: 1100 MDTISFIRIEIGKSREENTRLVRQLLQAK*ELQQIKATSFEPASVKKIY**LEVARTSLKEAVQVLQAQRFQIRALETALFASQEGNAVKCLLVFAPAQIAYKERELPTMTVNAL*YLINVLNRQFR 1480
            MD+   +R+E+  +R  N  L  Q++Q   E+ QI+AT  +PA +K +Y  L  A+    E  Q+ Q+ R QIR LE AL ASQEG AV   LVFAPAQ+AY+E    + +V      +N  +R  R
Sbjct:    1 MDSPQTLRVELAIARRNNKNLYDQIIQLTREVHQIRATWIDPAKIKPLYQRLTAAQKGWAEEKQINQSLRTQIRGLEVALSASQEGAAVTYPLVFAPAQLAYRESAAASTSVPNPPATVNTYSRHGR 127          
BLAST of zinc finger MYM-type protein 6 vs. Planmine SMEST
Match: SMESG000003397.1 (SMESG000003397.1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.178e-21
Identity = 52/133 (39.10%), Postives = 76/133 (57.14%), Query Frame = 2
Query: 1082 LICFSAMDTISFIRIEIGKSREENTRLVRQLLQAK*ELQQIKATSFEPASVKKIY**LEVARTSLKEAVQVLQAQRFQIRALETALFASQEGNAVKCLLVFAPAQIAYKERELPTMTVNAL*YLINVLNRQFR 1480
            ++    MD+   +R+E+  +R+ N  L  Q++Q   E+ QI+AT  +PA +K +Y  L  A+    E  Q+ Q+ R QIR LE AL ASQEG AV   LVFAPAQ+AY+E    + +V      +N  +R  R
Sbjct:    8 ILSIPDMDSPQTLRVELAIARQNNKNLYDQIIQLTREVHQIRATWIDPAKIKPLYQRLTAAQKGWAEEKQINQSLRTQIRGLEVALSASQEGAAVTYPLVFAPAQLAYRESAAASTSVPNPAATVNTYSRPGR 140          
The following BLAST results are available for this feature:
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBED91.008e-2932.39zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
ZBED91.279e-2932.39zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
ZBED56.147e-2529.20zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
ZBED56.147e-2529.20zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
ZMYM62.257e-2136.09zinc finger MYM-type containing 6 [Source:HGNC Sym... [more]
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Zmym64.123e-2330.66zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zmym67.906e-2234.48zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zbed54.496e-1333.33zinc finger, BED type containing 5 [Source:MGI Sym... [more]
back to top
BLAST of zinc finger MYM-type protein 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6R2W3|SCND3_HUMAN5.640e-2932.39SCAN domain-containing protein 3 OS=Homo sapiens O... [more]
sp|A4Z943|ZBED5_BOVIN1.253e-2429.20Zinc finger BED domain-containing protein 5 OS=Bos... [more]
sp|Q49AG3|ZBED5_HUMAN2.711e-2429.20Zinc finger BED domain-containing protein 5 OS=Hom... [more]
sp|A4Z944|ZBED5_CANLF9.049e-2428.47Zinc finger BED domain-containing protein 5 OS=Can... [more]
sp|O95789|ZMYM6_HUMAN9.945e-2136.09Zinc finger MYM-type protein 6 OS=Homo sapiens OX=... [more]
back to top
BLAST of zinc finger MYM-type protein 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2S2R2G64.837e-4137.14SCAN domain-containing protein 3 OS=Sipha flava OX... [more]
A0A2S2R6151.944e-3839.29Zinc finger MYM-type protein 6 (Fragment) OS=Sipha... [more]
J9LZ916.420e-3441.01DUF4371 domain-containing protein OS=Acyrthosiphon... [more]
A0A2J7PUK33.632e-3137.59Dimer_Tnp_hAT domain-containing protein OS=Cryptot... [more]
A0A2K5RH959.666e-2830.91Zinc finger BED-type containing 9 OS=Cebus capucin... [more]
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000051422.12.919e-2739.25pep primary_assembly:Astyanax_mexicanus-2.0:15:354... [more]
ENSAMXT00000044261.13.416e-2640.19pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050151.12.259e-1425.33pep primary_assembly:Astyanax_mexicanus-2.0:17:232... [more]
ENSAMXT00000057314.19.411e-927.19pep primary_assembly:Astyanax_mexicanus-2.0:1:4224... [more]
ENSAMXT00000054244.12.775e-739.13SCAN domain-containing protein 3-like [Source:NCBI... [more]
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of zinc finger MYM-type protein 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000035574.19.959e-2732.14pep primary_assembly:ASM223467v1:10:5595259:559658... [more]
ENSORLT00000031208.11.281e-2632.14pep primary_assembly:ASM223467v1:14:26692610:26696... [more]
ENSORLT00000040762.11.597e-2531.91pep primary_assembly:ASM223467v1:1:8553592:8557739... [more]
ENSORLT00000030244.11.874e-2530.94pep primary_assembly:ASM223467v1:13:28104458:28106... [more]
ENSORLT00000030788.12.027e-2532.14pep primary_assembly:ASM223467v1:17:2264135:227416... [more]
back to top
BLAST of zinc finger MYM-type protein 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055069.12.576e-8693.53SMESG000055069.1[more]
SMESG000077718.14.745e-5081.25SMESG000077718.1[more]
SMESG000013482.12.587e-2248.08SMESG000013482.1[more]
SMESG000054288.11.124e-2140.94SMESG000054288.1[more]
SMESG000003397.11.178e-2139.10SMESG000003397.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014454 ID=SMED30014454|Name=zinc finger MYM-type protein 6|organism=Schmidtea mediterranea sexual|type=transcript|length=1727bp
CAAGAATTTTCAAAATTTTATGCCAAAAAAATGGGAGCAGAACATCAGAC
ATTGTTTTTGCATTCTCATATAAGATGGCTGTCTAAGGGTAAAGTATTGA
AACGATTCTTTGAACTAAGAATTGAAATTGAAATATTTTTACGCGAACAA
AAATCAAATTTAAGCGAATTTTTTCAAAATAATTTGTAGATATAAAAAAA
TAAATTTGACAGATATATTTTCACATATGAACGATTTTAATCTATCTCTT
CAGGGAAAGCATATTACTCTCTTCAATTGCTATAATAAAATCGAAGCATT
TATTAAAAAGATTCAGCTTTGGATCGACACTATTAACACAGATTGCTACA
TGATGCTTCCTTCATTTTCTGAATTTGGTGATGATAAAATTTTATCTCAG
CAAGAAGTGCTCGATGTTCGCACAACTACAGAAAATCATTTGATTGAGAT
AAAAGCAAAATTAGTTTCGTACTTTCCGACTAAGGACGACATTCATCAAA
GAGATATGTGGGTAATAAATCCGTTCAGTGCTGAATTAGCGCATAATTTA
ACATTCCCAGTAAAAGTACAGTTAATTGAATTAACTTCGAATAAAACTTT
AGAACAGAAATATCAAGTGCAAAAACAATATATCTCGATTTTGGTTTGAA
ATAAGGGAAGAATATAAAATGTTAAGTGAAAATGCATTGAAATTATTGCT
TTTCTTTTGGAACGACCTATTTAGTGGAAAGTGGATTTTCAACTATGATT
GTAATAAAAACCAAATTGAGGAATCGGCTTGAAATCAGCTCGGCAATGCG
AATTTCAATGACGAATTGATTTTGATAAATTAGTTGCTAAAAACTACAAC
ATCCATCTCACTAATTGTAAGTTTATTAATATTTCTACTATAAATTTGTT
TAATTTATTTTGTAATAAATAAAATTCAGTTTTATTACAATATCTAAAGC
TTATAGTTATTTGGGTCGCAAGCTATTCAAACATAAAAGTTGGGTCATCA
ATGTAGAAATTTTGAGAAACGCTGGTGTAGAATATATCGTTTTCTCTAAC
TGACAACTATCATTCTTAAATAAATGAGTAATTAATTTGTTTTTCAGCGA
TGGATACGATCTCATTCATTAGAATCGAAATTGGAAAATCACGTGAAGAG
AATACTCGGCTCGTCCGACAACTGCTGCAGGCCAAGTGAGAATTACAACA
AATTAAAGCCACCTCGTTCGAACCGGCCAGCGTCAAGAAGATATATTGAT
AGTTGGAAGTGGCCCGGACATCATTGAAGGAAGCCGTGCAAGTATTACAA
GCCCAGCGATTCCAAATCAGGGCACTCGAAACCGCTCTGTTCGCAAGCCA
AGAGGGTAATGCCGTGAAGTGCCTCCTGGTGTTCGCTCCAGCCCAAATTG
CTTACAAAGAGAGAGAGCTACCAACAATGACAGTGAACGCATTGTGATAT
TTAATAAATGTATTAAACCGTCAATTCCGTTGTATCGTCAATAAGAAAAA
TTGTAATATATATTATAAAATAGTAGATAGCAGGCCGTTTTGACTCCATC
CATACAGCTAGGCTATTTAAAGGCTTCAAGAAAAATTAAATGAAATTTGA
TTCGATGTGTGCTTCAGTGACATCAACAACAGCATTTGAATTTTTCATCA
GTAAAGGATCTAGCATGATTTAAAGAAGGAGACTGTAAGGAGTAGGAATG
TTGGTAAATCGAATTGGAAAATTTGGG
back to top

protein sequence of SMED30014454-orf-1

>SMED30014454-orf-1 ID=SMED30014454-orf-1|Name=SMED30014454-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=141bp
MNDFNLSLQGKHITLFNCYNKIEAFIKKIQLWIDTINTDCYMMLPSFSEF
GDDKILSQQEVLDVRTTTENHLIEIKAKLVSYFPTKDDIHQRDMWVINPF
SAELAHNLTFPVKVQLIELTSNKTLEQKYQVQKQYISILV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: molecular function
TermDefinition
GO:0000981RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0007010cytoskeleton organization
GO:0007275multicellular organism development
GO:0022604regulation of cell morphogenesis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR45935FAMILY NOT NAMEDcoord: 1..131