plexin B-5

Overview
Nameplexin B-5 (AJA72715.1)
Smed IDSMED30014448
Length (bp)3733
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of plexin B-5 (SMED30014448) t-SNE clustered cells

Violin plots show distribution of expression levels for plexin B-5 (SMED30014448) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of plexin B-5 (SMED30014448) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for plexin B-5 (SMED30014448) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014448

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30014448h1SMcG0011638 Contig31118uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014448h1SMcG0022656 Contig31118uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30014448h1SMcG0011640 dd_Smed_v6_4956_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014448h1SMcG0011638 dd_Smed_v6_3573_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014448h1SMcG0011643 dd_Smed_v6_3573_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of plexin B-5 vs. Ensembl Human
Match: PLXNB2 (plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104])

HSP 1 Score: 145.591 bits (366), Expect = 2.314e-34
Identity = 147/562 (26.16%), Postives = 238/562 (42.35%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAI--------HLQIP-NETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEI-----------VQKNQLYRY 3462
            F N+L  K  L+ +I  +E       + K   AS LT+ L    +Y+ +++  L  +L+ E+Y   K     L+ S  + ER++  W SIC++  LK +  GE  + L++ IK + E G VD    KAKY L+   LL  D++Y  L + V V+ +            ++ I V +L+ D+ISQ+KEKIID+               G PC C  P   S        S  +I L D D TS +    K+   +NT  HYN++ G  L+L   S + +   P + +   P    A+        HL  P +E + G     +     +TK +          + YL  L++ K +L   +D F QS+                         ++   + P  ++              Y F   DE A+   I D D I++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C        +  D P  K ++  +I     +    +  I++  +VSD++M   L+EI           V  +QLY+Y
Sbjct: 1319 FSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMHTLFLELL-EQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDS-AGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDE-----------GVDAIPVKVLNCDTISQVKEKIIDQVY------------RGQPCSCW-PRPDSVVLEWRPGSTAQI-LSDLDLTSQREGRWKR---VNTLMHYNVRDGATLIL---SKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAI---------TEIYLTRLLSVKGTLQQFVDNFFQSV-------------------------LAPGHAVPPAVK--------------YFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDAC--TRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQY 1797          
BLAST of plexin B-5 vs. Ensembl Human
Match: PLXNB2 (plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104])

HSP 1 Score: 145.591 bits (366), Expect = 2.314e-34
Identity = 147/562 (26.16%), Postives = 238/562 (42.35%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAI--------HLQIP-NETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEI-----------VQKNQLYRY 3462
            F N+L  K  L+ +I  +E       + K   AS LT+ L    +Y+ +++  L  +L+ E+Y   K     L+ S  + ER++  W SIC++  LK +  GE  + L++ IK + E G VD    KAKY L+   LL  D++Y  L + V V+ +            ++ I V +L+ D+ISQ+KEKIID+               G PC C  P   S        S  +I L D D TS +    K+   +NT  HYN++ G  L+L   S + +   P + +   P    A+        HL  P +E + G     +     +TK +          + YL  L++ K +L   +D F QS+                         ++   + P  ++              Y F   DE A+   I D D I++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C        +  D P  K ++  +I     +    +  I++  +VSD++M   L+EI           V  +QLY+Y
Sbjct: 1319 FSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMHTLFLELL-EQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDS-AGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDE-----------GVDAIPVKVLNCDTISQVKEKIIDQVY------------RGQPCSCW-PRPDSVVLEWRPGSTAQI-LSDLDLTSQREGRWKR---VNTLMHYNVRDGATLIL---SKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAI---------TEIYLTRLLSVKGTLQQFVDNFFQSV-------------------------LAPGHAVPPAVK--------------YFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDAC--TRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQY 1797          
BLAST of plexin B-5 vs. Ensembl Human
Match: PLXNB1 (plexin B1 [Source:HGNC Symbol;Acc:HGNC:9103])

HSP 1 Score: 118.627 bits (296), Expect = 4.212e-26
Identity = 126/544 (23.16%), Postives = 228/544 (41.91%), Query Frame = 1
Query: 1921 VKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIID---KAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSG---------TKLLLTQDSMMSIG-----FSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKV--SDEEMANILSEI-----------VQKNQLYRY 3462
             +D+  +AS LT+ L    +YF ++L+ L+  L+ + Y          ++  + E+++  W SIC++  ++ + +GE  + L+RGIK + + G VD  + KAKY L+ + LL  D++Y+ L ++  + V            E + + V +L  D+ISQ KEK++D   K +    + +  T         +   S  A  LI         L D D TS    + ++   +NT +HY +  G         TK +L ++     G        V++   +P      HL  P++     +    + R  + +      R     + YL  L++ K +L   +D   Q I                         +ST    P  ++              Y F L DE A+   I D D I++WK+N    + W N ++NP  +F +     +   L  I+    ++C +     G   D P+ K ++  DI     +  + +  I++ V  SD+EM ++L+E+           V  ++LY+Y
Sbjct: 1448 ARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQ-YVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDS-VGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAG-------EAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLD-------VEWRSGVAGHLI---------LSDEDVTSEVQGLWRR---LNTLQHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDVDEGGIRP-----WHLVKPSDEPEPPRPRRGSLRGGERE------RAKAIPEIYLTRLLSMKGTLQKFVDDLFQVI-------------------------LSTSRPVPLAVK--------------YFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLG--RDSPINKLLYARDIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKY 1911          
BLAST of plexin B-5 vs. Ensembl Human
Match: PLXNB1 (plexin B1 [Source:HGNC Symbol;Acc:HGNC:9103])

HSP 1 Score: 118.242 bits (295), Expect = 7.035e-26
Identity = 129/570 (22.63%), Postives = 236/570 (41.40%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIE-KYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIID---KAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSG---------TKLLLTQDSMMSIG-----FSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKV--SDEEMANILSEI-----------VQKNQLYRY 3462
              N+L  K  L ++I  +E       +D+  +AS LT+ L    +YF ++L+ L+  L+ +   KN K      ++  + E+++  W SIC++  ++ + +GE  + L+RGIK + + G VD  + KAKY L+ + LL  D++Y+ L ++  + V            E + + V +L  D+ISQ KEK++D   K +    + +  T                    +  +S +   L    D  + S +      +NT +HY +  G         TK +L ++     G        V++   +P      HL  P++     +    + R  + +      R     + YL  L++ K +L   +D   Q I                         +ST    P  ++              Y F L DE A+   I D D I++WK+N    + W N ++NP  +F +     +   L  I+    ++C +     G   D P+ K ++  DI     +  + +  I++ V  SD+EM ++L+E+           V  ++LY+Y
Sbjct: 1606 LSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPK--LMLRRTETVVEKLLTNWMSICLYTFVRDS-VGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAG-------EAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLD------------------VEWRSGVAGHL-ILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDVDEGGIRP-----WHLVKPSDEPEPPRPRRGSLRGGERE------RAKAIPEIYLTRLLSMKGTLQKFVDDLFQVI-------------------------LSTSRPVPLAVK--------------YFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLG--RDSPINKLLYARDIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKY 2094          
BLAST of plexin B-5 vs. Ensembl Human
Match: PLXNB1 (plexin B1 [Source:HGNC Symbol;Acc:HGNC:9103])

HSP 1 Score: 118.242 bits (295), Expect = 7.035e-26
Identity = 129/570 (22.63%), Postives = 236/570 (41.40%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIE-KYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIID---KAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSG---------TKLLLTQDSMMSIG-----FSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKV--SDEEMANILSEI-----------VQKNQLYRY 3462
              N+L  K  L ++I  +E       +D+  +AS LT+ L    +YF ++L+ L+  L+ +   KN K      ++  + E+++  W SIC++  ++ + +GE  + L+RGIK + + G VD  + KAKY L+ + LL  D++Y+ L ++  + V            E + + V +L  D+ISQ KEK++D   K +    + +  T                    +  +S +   L    D  + S +      +NT +HY +  G         TK +L ++     G        V++   +P      HL  P++     +    + R  + +      R     + YL  L++ K +L   +D   Q I                         +ST    P  ++              Y F L DE A+   I D D I++WK+N    + W N ++NP  +F +     +   L  I+    ++C +     G   D P+ K ++  DI     +  + +  I++ V  SD+EM ++L+E+           V  ++LY+Y
Sbjct: 1606 LSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPK--LMLRRTETVVEKLLTNWMSICLYTFVRDS-VGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAG-------EAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLD------------------VEWRSGVAGHL-ILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDVDEGGIRP-----WHLVKPSDEPEPPRPRRGSLRGGERE------RAKAIPEIYLTRLLSMKGTLQKFVDDLFQVI-------------------------LSTSRPVPLAVK--------------YFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLG--RDSPINKLLYARDIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKY 2094          
BLAST of plexin B-5 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 129.413 bits (324), Expect = 6.475e-30
Identity = 154/640 (24.06%), Postives = 266/640 (41.56%), Query Frame = 1
Query: 1702 KAFYEYQIAVQSFN-NIGLFTP-RHFYSFNDFLSKLL--------------NVDLILNEN-SFSCQDFENILLKKHTLVQWIEKVELNCKV--KDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTL--KSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPN----------ETNFGNKNESNNARDNKTKL--LFNPI-------RENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSL--WWQTFVSIQEKVSDEEM-ANILSEIVQK----------NQLYRY 3462
            +AF E Q ++  +  ++ L TP   F  + D+ +++L               VD    E      ++F  +L+ K  L+  +  +E N     KD+  + S L + L +   Y  E+LK L+R+LI EK    K   + L  +S  I+ER++  W +  +HD+LKT + G++ + L+ GIK + E G  D  + +A+Y+LS + LL    +Y+ L++ V+          + +    + I V +L  D+I+Q+KEK +D      AK      ++  P P    +            N K+ L D D +S     + K   +NT  HYN+ +   L LT  S      S ++ R    +   ++ ++ P            +   +   S+   DN  KL  L  P        +E    + YL  L+  K +L   I   ++SI                          S+    P                I Y+F   DE A+   I D ++++ WKSN    + W N ++NP  +F I   + + G L  ++  L ++C  +     +  D P  K +F  D+     L   + T +S+  ++ D  M AN+ +E  Q           N+LY+Y
Sbjct:  540 EAFAELQTSLNQYTADLPLGTPTAPFLEYKDYCARVLFPNAGKNHAVLKNLEVDTHKAEAIEAGLREFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELI-EKTVEKKFQPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSAS--------DSVYSSTQDIPVRVLDCDTITQVKEKCLD------AKYRGYRFAD-RPAPGDMELEWKT------GMNGKMALQDIDSSSRVEGGNWK--RLNTLAHYNVPNNAILTLTSKSNSLYNLSILSDR----SEKSSVSMKTPGVGSPKPWGAPPSVIADHASSSADTDNGFKLYHLVKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESI-------------------------FSSSTVPPC---------------IKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACSTQD--HQLTKDSPSSKLLFAKDMYQYRDLVDSYYTEISMTPRIDDATMGANLSAESRQHNGEFHVFSALNELYKY 1109          
BLAST of plexin B-5 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 128.642 bits (322), Expect = 1.413e-29
Identity = 155/641 (24.18%), Postives = 268/641 (41.81%), Query Frame = 1
Query: 1702 KAFYEYQIAVQSFN-NIGLFTP-RHFYSFNDFLSKLL--------------NVDLILNEN-SFSCQDFENILLKKHTLVQWIEKVELNCKV--KDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTL--KSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKS-NIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPN----------ETNFGNKNESNNARDNKTKL--LFNPI-------RENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSL--WWQTFVSIQEKVSDEEM-ANILSEIVQK----------NQLYRY 3462
            +AF E Q ++  +  ++ L TP   F  + D+ +++L               VD    E      ++F  +L+ K  L+  +  +E N     KD+  + S L + L +   Y  E+LK L+R+LI EK    K   + L  +S  I+ER++  W +  +HD+LKT + G++ + L+ GIK + E G  D  + +A+Y+LS + LL    +Y+ L++ V+          + +    + I V +L  D+I+Q+KEK +D      AK      ++  P P          +L +    N K+ L D D +S     + K   +NT  HYN+ +   L LT  S      S ++ R    +   ++ ++ P            +   +   S+   DN  KL  L  P        +E    + YL  L+  K +L   I   ++SI                          S+    P                I Y+F   DE A+   I D ++++ WKSN    + W N ++NP  +F I   + + G L  ++  L ++C  +     +  D P  K +F  D+     L   + T +S+  ++ D  M AN+ +E  Q           N+LY+Y
Sbjct: 1122 EAFAELQTSLNQYTADLPLGTPTAPFLEYKDYCARVLFPNAGKNHAVLKNLEVDTHKAEAIEAGLREFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELI-EKTVEKKFQPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSAS--------DSVYSSTQDIPVRVLDCDTITQVKEKCLD------AKYRGYRFAD-RPAP-------GDMELEWKTGMNGKMALQDIDSSSRVEGGNWK--RLNTLAHYNVPNNAILTLTSKSNSLYNLSILSDR----SEKSSVSMKTPGVGSPKPWGAPPSVIADHASSSADTDNGFKLYHLVKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESI-------------------------FSSSTVPPC---------------IKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACSTQD--HQLTKDSPSSKLLFAKDMYQYRDLVDSYYTEISMTPRIDDATMGANLSAESRQHNGEFHVFSALNELYKY 1691          
BLAST of plexin B-5 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 128.257 bits (321), Expect = 1.796e-29
Identity = 155/641 (24.18%), Postives = 268/641 (41.81%), Query Frame = 1
Query: 1702 KAFYEYQIAVQSFN-NIGLFTPRH-FYSFNDFLSKLL--------------NVDLILNEN-SFSCQDFENILLKKHTLVQWIEKVELNCKV--KDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTL--KSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKS-NIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPN----------ETNFGNKNESNNARDNKTKL--LFNPI-------RENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSL--WWQTFVSIQEKVSDEEM-ANILSEIVQK----------NQLYRY 3462
            +AF E Q ++  +  ++ L TP   F  + D+ +++L               VD    E      ++F  +L+ K  L+  +  +E N     KD+  + S L + L +   Y  E+LK L+R+LI EK    K   + L  +S  I+ER++  W +  +HD+LKT + G++ + L+ GIK + E G  D  + +A+Y+LS + LL    +Y+ L++ V+          + +    + I V +L  D+I+Q+KEK +D      AK      ++  P P          +L +    N K+ L D D +S     + K   +NT  HYN+ +   L LT  S      S ++ R    +   ++ ++ P            +   +   S+   DN  KL  L  P        +E    + YL  L+  K +L   I   ++SI                          S+    P                I Y+F   DE A+   I D ++++ WKSN    + W N ++NP  +F I   + + G L  ++  L ++C  +     +  D P  K +F  D+     L   + T +S+  ++ D  M AN+ +E  Q           N+LY+Y
Sbjct: 1311 EAFAELQTSLNQYTADLPLGTPTAPFLEYKDYCARVLFPNAGKNHAVLKNLEVDTHKAEAIEAGLREFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELI-EKTVEKKFQPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSAS--------DSVYSSTQDIPVRVLDCDTITQVKEKCLD------AKYRGYRFAD-RPAP-------GDMELEWKTGMNGKMALQDIDSSSRVEGGNWK--RLNTLAHYNVPNNAILTLTSKSNSLYNLSILSDR----SEKSSVSMKTPGVGSPKPWGAPPSVIADHASSSADTDNGFKLYHLVKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESI-------------------------FSSSTVPPC---------------IKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACSTQD--HQLTKDSPSSKLLFAKDMYQYRDLVDSYYTEISMTPRIDDATMGANLSAESRQHNGEFHVFSALNELYKY 1880          
BLAST of plexin B-5 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 95.9005 bits (237), Expect = 1.357e-19
Identity = 93/342 (27.19%), Postives = 159/342 (46.49%), Query Frame = 1
Query: 1702 KAFYEYQIAVQSFN-NIGLFTP-RHFYSFNDFLSKLL--------------NVDLILNEN-SFSCQDFENILLKKHTLVQWIEKVELNCKV--KDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTL--KSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDS 2664
            +AF E Q ++  +  ++ L TP   F  + D+ +++L               VD    E      ++F  +L+ K  L+  +  +E N     KD+  + S L + L +   Y  E+LK L+R+LI EK    K   + L  +S  I+ER++  W +  +HD+LKT + G++ + L+ GIK + E G  D  + +A+Y+LS + LL    +Y+ L++ V+          + +    + I V +L  D+I+Q+KEK +D      AK      ++  P P    +            N K+ L D D +S     + K   +NT  HYN+ +   L LT  S
Sbjct:  540 EAFAELQTSLNQYTADLPLGTPTAPFLEYKDYCARVLFPNAGKNHAVLKNLEVDTHKAEAIEAGLREFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELI-EKTVEKKFQPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSAS--------DSVYSSTQDIPVRVLDCDTITQVKEKCLD------AKYRGYRFAD-RPAPGDMELEWKT------GMNGKMALQDIDSSSRVEGGNWK--RLNTLAHYNVPNNAILTLTSKS 857          

HSP 2 Score: 61.6178 bits (148), Expect = 4.177e-9
Identity = 40/146 (27.40%), Postives = 69/146 (47.26%), Query Frame = 1
Query: 3064 IFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSL--WWQTFVSIQEKVSDEEM-ANILSEIVQK----------NQLYRY 3462
            I Y+F   DE A+   I D ++++ WKSN    + W N ++NP  +F I   + + G L  ++  L ++C  +     +  D P  K +F  D+     L   + T +S+  ++ D  M AN+ +E  Q           N+LY+Y
Sbjct:  977 IKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACSTQD--HQLTKDSPSSKLLFAKDMYQYRDLVDSYYTEISMTPRIDDATMGANLSAESRQHNGEFHVFSALNELYKY 1120          
BLAST of plexin B-5 vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 94.7449 bits (234), Expect = 3.454e-19
Identity = 94/343 (27.41%), Postives = 161/343 (46.94%), Query Frame = 1
Query: 1702 KAFYEYQIAVQSFN-NIGLFTPRH-FYSFNDFLSKLL--------------NVDLILNEN-SFSCQDFENILLKKHTLVQWIEKVELNCKV--KDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTL--KSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKS-NIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDS 2664
            +AF E Q ++  +  ++ L TP   F  + D+ +++L               VD    E      ++F  +L+ K  L+  +  +E N     KD+  + S L + L +   Y  E+LK L+R+LI EK    K   + L  +S  I+ER++  W +  +HD+LKT + G++ + L+ GIK + E G  D  + +A+Y+LS + LL    +Y+ L++ V+          + +    + I V +L  D+I+Q+KEK +D      AK      ++  P P          +L +    N K+ L D D +S     + K   +NT  HYN+ +   L LT  S
Sbjct: 1311 EAFAELQTSLNQYTADLPLGTPTAPFLEYKDYCARVLFPNAGKNHAVLKNLEVDTHKAEAIEAGLREFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELI-EKTVEKKFQPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSAS--------DSVYSSTQDIPVRVLDCDTITQVKEKCLD------AKYRGYRFAD-RPAP-------GDMELEWKTGMNGKMALQDIDSSSRVEGGNWK--RLNTLAHYNVPNNAILTLTSKS 1628          

HSP 2 Score: 61.6178 bits (148), Expect = 4.693e-9
Identity = 40/146 (27.40%), Postives = 69/146 (47.26%), Query Frame = 1
Query: 3064 IFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSL--WWQTFVSIQEKVSDEEM-ANILSEIVQK----------NQLYRY 3462
            I Y+F   DE A+   I D ++++ WKSN    + W N ++NP  +F I   + + G L  ++  L ++C  +     +  D P  K +F  D+     L   + T +S+  ++ D  M AN+ +E  Q           N+LY+Y
Sbjct: 1748 IKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQKPTKIEGCLSVVAQTLMDACSTQD--HQLTKDSPSSKLLFAKDMYQYRDLVDSYYTEISMTPRIDDATMGANLSAESRQHNGEFHVFSALNELYKY 1891          
BLAST of plexin B-5 vs. Ensembl Fly
Match: PlexB (gene:FBgn0025740 transcript:FBtr0308297)

HSP 1 Score: 124.79 bits (312), Expect = 3.215e-28
Identity = 138/576 (23.96%), Postives = 249/576 (43.23%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVEL---NCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPIS----HSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGT--KLLLTQDSMMSIGFSPVNKRNFQP----------------NNDVAIHLQIPNETNFGNKNESNNARDNKTKLL-----------FNPIRENTNK---DAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTF---VSIQEKVSDEEMANILSEI-VQKNQ 3450
            FE ++  K+ L+ +IE +E    +  ++D+  +AS + + LM   +Y  E+LK L+ +LI +   +        ++  + E+++  + +ICM+D LK    G   F L++ IK + E GLVD  ++ A+Y+LS + LL   + +  +I+ +       L +  +     E++   +   D+ISQ+K KI+D AI +N              P +  +     H          ++ +Q +D    ++  +  K+   +NT  HY +K      L+  Q+    I +S    +N  P                NND+   LQ P   +    N  ++  + K  +L            N   +  NK   + YL  L+ATK ++   +D F                         F  +++ +   P  ++              ++F L DE A+   I DTD+++ WKSNC   + W NF++NPD IF +    +V   L  I+    ++C       G   D P  K +F  DI N Y +  + F   VS   ++SD+EM+  + ++ V++N+
Sbjct: 1497 FEQLIGNKYFLLMFIETLEAQRSSFSIRDRVNVASLIMVVLMNKMEYATEILKSLLLRLIDKSLASKHPQLMLRRTESVVEKMLTNYLAICMYDYLKEY-AGSNLFLLFKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHI-------LQDDLD-----EKVQCRVNDWDTISQVKLKILD-AIFKNTPFSMR--------PSVNEVDLEWRHGR------GGHLTLQDEDLTTKTVNGW--KR---LNTLAHYGVKESAVMSLIARQNDNYHIPYS--KNQNSAPYHNFYFINNSQSHIIINNDIESGLQQPRVYHLVKPNIPDHYMNIKNSVLSGGSPAFQSHVVNNCNDRVNKTIPEVYLTRLLATKGTIQKFVDDF-------------------------FSIILTVNEELPPAVK--------------WLFDLLDEAARRHDIADTDIVHAWKSNCLPLRFWVNFIKNPDFIFDVNKTYSVDSCLSVIAQTFMDACSTSEHRLG--KDSPSNKLLFAKDIPN-YRIMVKEFYRDVSRLPQISDQEMSTAMQQLSVRQNE 1995          
BLAST of plexin B-5 vs. Ensembl Fly
Match: PlexB (gene:FBgn0025740 transcript:FBtr0089179)

HSP 1 Score: 124.79 bits (312), Expect = 3.215e-28
Identity = 138/576 (23.96%), Postives = 249/576 (43.23%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVEL---NCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPIS----HSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGT--KLLLTQDSMMSIGFSPVNKRNFQP----------------NNDVAIHLQIPNETNFGNKNESNNARDNKTKLL-----------FNPIRENTNK---DAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTF---VSIQEKVSDEEMANILSEI-VQKNQ 3450
            FE ++  K+ L+ +IE +E    +  ++D+  +AS + + LM   +Y  E+LK L+ +LI +   +        ++  + E+++  + +ICM+D LK    G   F L++ IK + E GLVD  ++ A+Y+LS + LL   + +  +I+ +       L +  +     E++   +   D+ISQ+K KI+D AI +N              P +  +     H          ++ +Q +D    ++  +  K+   +NT  HY +K      L+  Q+    I +S    +N  P                NND+   LQ P   +    N  ++  + K  +L            N   +  NK   + YL  L+ATK ++   +D F                         F  +++ +   P  ++              ++F L DE A+   I DTD+++ WKSNC   + W NF++NPD IF +    +V   L  I+    ++C       G   D P  K +F  DI N Y +  + F   VS   ++SD+EM+  + ++ V++N+
Sbjct: 1497 FEQLIGNKYFLLMFIETLEAQRSSFSIRDRVNVASLIMVVLMNKMEYATEILKSLLLRLIDKSLASKHPQLMLRRTESVVEKMLTNYLAICMYDYLKEY-AGSNLFLLFKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHI-------LQDDLD-----EKVQCRVNDWDTISQVKLKILD-AIFKNTPFSMR--------PSVNEVDLEWRHGR------GGHLTLQDEDLTTKTVNGW--KR---LNTLAHYGVKESAVMSLIARQNDNYHIPYS--KNQNSAPYHNFYFINNSQSHIIINNDIESGLQQPRVYHLVKPNIPDHYMNIKNSVLSGGSPAFQSHVVNNCNDRVNKTIPEVYLTRLLATKGTIQKFVDDF-------------------------FSIILTVNEELPPAVK--------------WLFDLLDEAARRHDIADTDIVHAWKSNCLPLRFWVNFIKNPDFIFDVNKTYSVDSCLSVIAQTFMDACSTSEHRLG--KDSPSNKLLFAKDIPN-YRIMVKEFYRDVSRLPQISDQEMSTAMQQLSVRQNE 1995          
BLAST of plexin B-5 vs. Ensembl Fly
Match: PlexA (gene:FBgn0025741 transcript:FBtr0309865)

HSP 1 Score: 105.145 bits (261), Expect = 3.164e-22
Identity = 127/558 (22.76%), Postives = 233/558 (41.76%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVELN--CKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTL--KSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVN-VKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFD--------------DTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETN------FGNKNESNNARDNKTKLLFNPIRENTNK---DAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTF---VSIQEKVSDEEMANILSE 3432
            F  +++ K  L+ +I  +E N    ++++  +AS + + L    +Y  ++LK L+  LI EK    K   + L  ++  ++E+++  W +  ++  LK    GE  + L+R +K + + G VD  + +A+Y+LS + L+   ID++ + +  + ++  I   N + L    E ++V +L  D+I Q+KEK           LE+I ++                    I S+ + + DD D              D  + S  + +   +NT +HYN+  G  L L         FS ++ +N + +N     L      N          ++S+  ++           E  NK   + YL  L+ATK +L   +D                           FE + ST           S L L    +I Y+F   D+ A+   I D ++++ WKSN    + W N ++NP+ +F I   + V   L  ++    +SC       G   D P  K ++  DI  +Y  W   +   +     +SD++M  +L+E
Sbjct: 1394 FGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLI-EKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKEC-AGEPLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPSHTENVSVKVLDCDTIGQVKEKC----------LETIYRN--------------------IPSSQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHNRAGSPLNNDMHENGLRYWHLVKHHDSDMQKEG----------ERVNKLVSEIYLTRLLATKGTLQKFVDDL-------------------------FETIFST-------AHRGSALPL----AIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLG--KDSPSSKLLYAKDIP-EYRKWVDRYYRDIRDMSPISDQDMNAMLAE 1870          
BLAST of plexin B-5 vs. Ensembl Fly
Match: PlexA (gene:FBgn0025741 transcript:FBtr0089223)

HSP 1 Score: 101.293 bits (251), Expect = 4.185e-21
Identity = 124/565 (21.95%), Postives = 235/565 (41.59%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVELN--CKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTL--KSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVN-VKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFD--------------DTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQ--IPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDA--------------YLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTF---VSIQEKVSDEEMANILSE 3432
            F  +++ K  L+ +I  +E N    ++++  +AS + + L    +Y  ++LK L+  LI EK    K   + L  ++  ++E+++  W +  ++  LK    GE  + L+R +K + + G VD  + +A+Y+LS + L+   ID++ + +  + ++  I   N + L    E ++V +L  D+I Q+KEK           LE+I ++                    I S+ + + DD D              D  + S  + +   +NT +HYN+  G  L L         FS ++ +N + +    +++     +   F       N   ++  L +  + ++ + D               YL  L+ATK +L   +D                           FE + ST           S L L    +I Y+F   D+ A+   I D ++++ WKSN    + W N ++NP+ +F I   + V   L  ++    +SC       G   D P  K ++  DI  +Y  W   +   +     +SD++M  +L+E
Sbjct: 1394 FGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLI-EKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKEC-AGEPLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPSHTENVSVKVLDCDTIGQVKEKC----------LETIYRN--------------------IPSSQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYTSSSPTFSRAGSPLNNDMHENGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTLQKFVDDL-------------------------FETIFST-------AHRGSALPL----AIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLG--KDSPSSKLLYAKDIP-EYRKWVDRYYRDIRDMSPISDQDMNAMLAE 1887          
BLAST of plexin B-5 vs. Ensembl Fly
Match: PlexA (gene:FBgn0025741 transcript:FBtr0089224)

HSP 1 Score: 100.523 bits (249), Expect = 6.207e-21
Identity = 124/565 (21.95%), Postives = 235/565 (41.59%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVELN--CKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTL--KSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVN-VKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFD--------------DTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQ--IPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDA--------------YLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTF---VSIQEKVSDEEMANILSE 3432
            F  +++ K  L+ +I  +E N    ++++  +AS + + L    +Y  ++LK L+  LI EK    K   + L  ++  ++E+++  W +  ++  LK    GE  + L+R +K + + G VD  + +A+Y+LS + L+   ID++ + +  + ++  I   N + L    E ++V +L  D+I Q+KEK           LE+I ++                    I S+ + + DD D              D  + S  + +   +NT +HYN+  G  L L         FS ++ +N + +    +++     +   F       N   ++  L +  + ++ + D               YL  L+ATK +L   +D                           FE + ST           S L L    +I Y+F   D+ A+   I D ++++ WKSN    + W N ++NP+ +F I   + V   L  ++    +SC       G   D P  K ++  DI  +Y  W   +   +     +SD++M  +L+E
Sbjct:  954 FGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLI-EKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKEC-AGEPLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPSHTENVSVKVLDCDTIGQVKEKC----------LETIYRN--------------------IPSSQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSIYNFSILSDKNEKSHKYETLNISKYTSSSPTFSRAGSPLNNDMHENGLRYWHLVKHHDSDMQKEGERVNKLVSEIYLTRLLATKGTLQKFVDDL-------------------------FETIFST-------AHRGSALPL----AIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQTFMDSCSTSDHRLG--KDSPSSKLLYAKDIP-EYRKWVDRYYRDIRDMSPISDQDMNAMLAE 1447          
BLAST of plexin B-5 vs. Ensembl Zebrafish
Match: plxnb1a (plexin b1a [Source:ZFIN;Acc:ZDB-GENE-050302-63])

HSP 1 Score: 129.798 bits (325), Expect = 4.571e-30
Identity = 140/559 (25.04%), Postives = 237/559 (42.40%), Query Frame = 1
Query: 1858 NILLKKHTLVQWIEKVELN--CKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSI-----GFSPVNKRNFQPNNDVAI----HLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSE-----------IVQKNQLYRY 3462
            N+L  K  L ++I  +E       +D+  +AS LT+ L    +YF ++LK L+  L+ E+Y          ++  + E+++  W SIC++  L+ T  GE F+ L+R IK + + G VD  + KAKY L+ + LL  D++Y+TL ++V       L+N      E + +   +L  D+I+Q+KEKI+++A     K  S ++        +   +  A  LI         L D D TS+     K+   +NT +HY +  G  + L       I      + P  K     + D       HL   NE     K+   + RD + +      R     + YL  L++ K +L   +D                           F  ++ST    P  ++              Y F L D+ A    I D + I++WK+N    + W N ++NP  IF +     V   L  I+    +SC +     G   D P+ K ++  DI     +  + +  I++   VSD+EM + L+E           +V  ++LY+Y
Sbjct:  286 NLLNSKLFLTKFIHTLEAQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLSHLV-EQYTTKNPKLMLRRTESVVEKLLTNWMSICLYTFLRDT-AGESFYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYRTLTLNV-------LVNNGG-AGESQTLPTKVLDCDTITQVKEKILEQAW----KSTSFSQRPSADSVHLEWRAGMAGHLI---------LSDQDLTSVVQGSWKR---LNTLQHYKVPDGATVTLVSRQSKQIHHDSHDYIPGEKTPMLEDGDEGGVKQWHLVKANEEAELPKHRRGSLRDKERE------RAKAIPEIYLTRLLSVKGTLQKFVDDL-------------------------FTVILSTSRPVPLAVK--------------YFFDLLDDQAAQHNITDPETIHIWKTNSLPLRFWINILKNPQFIFDVQASDNVDAVLSVIAQTFMDSCTIADHKLG--RDSPINKLLYARDIPRYKQMVERYYSDIKQTISVSDQEMNSSLAELSRNYSNEVNHLVALHELYKY 771          
BLAST of plexin B-5 vs. Ensembl Zebrafish
Match: plxnb2a (plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917])

HSP 1 Score: 124.79 bits (312), Expect = 2.269e-28
Identity = 144/576 (25.00%), Postives = 246/576 (42.71%), Query Frame = 1
Query: 1810 VDLILNENSFSCQDFENILLKKHTLVQWIEKVELNCK--VKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVT---ILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSP----VNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEIVQK-----------NQLYRYKS 3468
            VD  LN+       F N+L  K  L+ +I  +E   +   ++K   AS LT+ L    +Y+ ++++ L+ +L+ E+Y + K     L+ S  + ER++  W SIC++  LK +  GE  + L++ IK + E G VD    KAKY L+   LL  D++Y  L + V              ++  E  +VT   +L+ D+ISQ+KEKII++         ++  S+    P +  ++     L +   +    L D D TS K    K+   INT  HYN++ G  L+L++       F        +RN    +D   HL  P +     K++  + +D  T      I        YL  L++ K +L   +D F +S+                        L S  +  P               ++ Y F   DE A+     D + I++WK+N    + W N ++NP  IF + +   V  SL  I+    ++C        +  + P  K ++  +I     +    +  I++   VSD++M   L+EI +            +QLY+Y S
Sbjct:  392 VDQALNQ-------FSNLLNSKTFLINFIRTLEGRQEFNARNKVYFASLLTVALHGKLEYYTDIMRTLLLELM-EEYVHSKNPKLMLRRSETVVERMLCNWMSICLYQFLKDS-AGEPLYKLFKAIKHQVEKGPVDAKMKKAKYTLNDTGLLGDDVEYSILTLQV--------------LVHGEGPDVTPVKVLNCDTISQVKEKIIEQV------YRNLPYSQR---PVVDSVA-----LEWRPGSTGQILSDLDLTSQKEGRWKR---INTLAHYNVRDGATLVLSRVLHTQQSFDQNMDNHEERNALLEDDKVFHLVRPADELEEVKSKRGSMKDKATTKAITEI--------YLTRLLSMKGTLQQFVDDFFRSV------------------------LCSGTVVPP---------------AVKYFFDFLDEQAQKHDNVDDETIHIWKTNSLPLRFWVNILKNPHFIFDVHLTEVVDASLSVIAQTFMDAC--TKTEHKLTRESPSNKLLYAKEISTYKKMVDDYYKGIRQMVPVSDQDMNTHLAEISRSHTDKLNTQAALHQLYQYAS 878          
BLAST of plexin B-5 vs. Ensembl Zebrafish
Match: plxnb2a (plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917])

HSP 1 Score: 125.176 bits (313), Expect = 3.384e-28
Identity = 145/576 (25.17%), Postives = 243/576 (42.19%), Query Frame = 1
Query: 1810 VDLILNENSFSCQDFENILLKKHTLVQWIEKVELNCK--VKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVT---ILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSP----VNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEIVQK-----------NQLYRYKS 3468
            VD  LN+       F N+L  K  L+ +I  +E   +   ++K   AS LT+ L    +Y+ ++++ L+ +L+ E+Y + K     L+ S  + ER++  W SIC++  LK +  GE  + L++ IK + E G VD    KAKY L+   LL  D++Y  L + V              ++  E  +VT   +L+ D+ISQ+KEKII++ +  N                  P+  S   L +   +    L D D TS K    K+   INT  HYN++ G  L+L++       F        +RN    +D   HL  P +     K++  + +D  T      I        YL  L++ K +L   +D F +S+                        L S  +  P               ++ Y F   DE A+     D + I++WK+N    + W N ++NP  IF + +   V  SL  I+    ++C        +  + P  K ++  +I     +    +  I++   VSD++M   L+EI +            +QLY+Y S
Sbjct: 1339 VDQALNQ-------FSNLLNSKTFLINFIRTLEGRQEFNARNKVYFASLLTVALHGKLEYYTDIMRTLLLELM-EEYVHSKNPKLMLRRSETVVERMLCNWMSICLYQFLKDS-AGEPLYKLFKAIKHQVEKGPVDAKMKKAKYTLNDTGLLGDDVEYSILTLQV--------------LVHGEGPDVTPVKVLNCDTISQVKEKIIEQ-VYRNLPYSQ------------RPVVDSV-ALEWRPGSTGQILSDLDLTSQKEGRWKR---INTLAHYNVRDGATLVLSRVLHTQQSFDQNMDNHEERNALLEDDKVFHLVRPADELEEVKSKRGSMKDKATTKAITEI--------YLTRLLSMKGTLQQFVDDFFRSV------------------------LCSGTVVPP---------------AVKYFFDFLDEQAQKHDNVDDETIHIWKTNSLPLRFWVNILKNPHFIFDVHLTEVVDASLSVIAQTFMDAC--TKTEHKLTRESPSNKLLYAKEISTYKKMVDDYYKGIRQMVPVSDQDMNTHLAEISRSHTDKLNTQAALHQLYQYAS 1825          
BLAST of plexin B-5 vs. Ensembl Zebrafish
Match: plxnb2a (plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917])

HSP 1 Score: 125.176 bits (313), Expect = 3.384e-28
Identity = 145/576 (25.17%), Postives = 243/576 (42.19%), Query Frame = 1
Query: 1810 VDLILNENSFSCQDFENILLKKHTLVQWIEKVELNCK--VKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVT---ILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSP----VNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEIVQK-----------NQLYRYKS 3468
            VD  LN+       F N+L  K  L+ +I  +E   +   ++K   AS LT+ L    +Y+ ++++ L+ +L+ E+Y + K     L+ S  + ER++  W SIC++  LK +  GE  + L++ IK + E G VD    KAKY L+   LL  D++Y  L + V              ++  E  +VT   +L+ D+ISQ+KEKII++ +  N                  P+  S   L +   +    L D D TS K    K+   INT  HYN++ G  L+L++       F        +RN    +D   HL  P +     K++  + +D  T      I        YL  L++ K +L   +D F +S+                        L S  +  P               ++ Y F   DE A+     D + I++WK+N    + W N ++NP  IF + +   V  SL  I+    ++C        +  + P  K ++  +I     +    +  I++   VSD++M   L+EI +            +QLY+Y S
Sbjct: 1339 VDQALNQ-------FSNLLNSKTFLINFIRTLEGRQEFNARNKVYFASLLTVALHGKLEYYTDIMRTLLLELM-EEYVHSKNPKLMLRRSETVVERMLCNWMSICLYQFLKDS-AGEPLYKLFKAIKHQVEKGPVDAKMKKAKYTLNDTGLLGDDVEYSILTLQV--------------LVHGEGPDVTPVKVLNCDTISQVKEKIIEQ-VYRNLPYSQ------------RPVVDSV-ALEWRPGSTGQILSDLDLTSQKEGRWKR---INTLAHYNVRDGATLVLSRVLHTQQSFDQNMDNHEERNALLEDDKVFHLVRPADELEEVKSKRGSMKDKATTKAITEI--------YLTRLLSMKGTLQQFVDDFFRSV------------------------LCSGTVVPP---------------AVKYFFDFLDEQAQKHDNVDDETIHIWKTNSLPLRFWVNILKNPHFIFDVHLTEVVDASLSVIAQTFMDAC--TKTEHKLTRESPSNKLLYAKEISTYKKMVDDYYKGIRQMVPVSDQDMNTHLAEISRSHTDKLNTQAALHQLYQYAS 1825          
BLAST of plexin B-5 vs. Ensembl Zebrafish
Match: plxnb2a (plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917])

HSP 1 Score: 124.79 bits (312), Expect = 4.249e-28
Identity = 145/576 (25.17%), Postives = 243/576 (42.19%), Query Frame = 1
Query: 1810 VDLILNENSFSCQDFENILLKKHTLVQWIEKVELNCK--VKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVT---ILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSP----VNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEIVQK-----------NQLYRYKS 3468
            VD  LN+       F N+L  K  L+ +I  +E   +   ++K   AS LT+ L    +Y+ ++++ L+ +L+ E+Y + K     L+ S  + ER++  W SIC++  LK +  GE  + L++ IK + E G VD    KAKY L+   LL  D++Y  L + V              ++  E  +VT   +L+ D+ISQ+KEKII++ +  N                  P+  S   L +   +    L D D TS K    K+   INT  HYN++ G  L+L++       F        +RN    +D   HL  P +     K++  + +D  T      I        YL  L++ K +L   +D F +S+                        L S  +  P               ++ Y F   DE A+     D + I++WK+N    + W N ++NP  IF + +   V  SL  I+    ++C        +  + P  K ++  +I     +    +  I++   VSD++M   L+EI +            +QLY+Y S
Sbjct: 1296 VDQALNQ-------FSNLLNSKTFLINFIRTLEGRQEFNARNKVYFASLLTVALHGKLEYYTDIMRTLLLELM-EEYVHSKNPKLMLRRSETVVERMLCNWMSICLYQFLKDS-AGEPLYKLFKAIKHQVEKGPVDAKMKKAKYTLNDTGLLGDDVEYSILTLQV--------------LVHGEGPDVTPVKVLNCDTISQVKEKIIEQ-VYRNLPYSQ------------RPVVDSV-ALEWRPGSTGQILSDLDLTSQKEGRWKR---INTLAHYNVRDGATLVLSRVLHTQQSFDQNMDNHEERNALLEDDKVFHLVRPADELEEVKSKRGSMKDKATTKAITEI--------YLTRLLSMKGTLQQFVDDFFRSV------------------------LCSGTVVPP---------------AVKYFFDFLDEQAQKHDNVDDETIHIWKTNSLPLRFWVNILKNPHFIFDVHLTEVVDASLSVIAQTFMDAC--TKTEHKLTRESPSNKLLYAKEISTYKKMVDDYYKGIRQMVPVSDQDMNTHLAEISRSHTDKLNTQAALHQLYQYAS 1782          
BLAST of plexin B-5 vs. Ensembl Xenopus
Match: PLXNB2 (plexin B2 [Source:NCBI gene;Acc:550076])

HSP 1 Score: 136.346 bits (342), Expect = 1.377e-31
Identity = 138/562 (24.56%), Postives = 243/562 (43.24%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQ----------PNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEI-----------VQKNQLYRY 3462
            F N+L  K  L  +I  +E   +   ++K  LAS LT+ L    +Y+ ++++ L+ +L+ ++Y          +S  + ER++  W SIC++  LK T +GE  + L++ IK + E G VD   +KAKY L+   LL  D++Y+ L ++V V+ + +           E + V +L+ D+I+Q+KEKI+D+ +  N       K++             +  L +   +    L D D TS K    K+    NT  HYN++    L+L++     +G S   + N Q           + + A HL  P +     K++  + ++ +        R     + YL  L++ K +L   +D F QS+        N N   P                                 ++ Y F   DE A+   I D D +++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C        +  + P  K ++  +I     +    +  I++  +VSD++M   L+EI           V  +QLY+Y
Sbjct: 1180 FSNLLNSKSFLTIFIHTLESQKDFSAREKLYLASLLTVALHGKLEYYTDIMRALLMELM-DQYVAKNPKLLLRRSETVVERMLSNWMSICLYQYLKDT-VGEPLYKLFKAIKHQVEKGPVDALQAKAKYTLNDTGLLGDDVEYKQLTVNVIVQEEGA-----------EPVPVKVLNCDTITQVKEKIVDQ-VYRNIPYSLRPKAD-------------SLALEWRPGSTAQILSDLDLTSQKEGRLKR---YNTLMHYNVRDNATLILSR-----MGISQQQEENHQDFPGERNALLEDENKAWHLVRPADEVDEVKSKRGSMKEKE--------RTKAITEIYLTRLLSVKGTLQQFVDNFFQSVL-------NSNQVVP--------------------------------PAVKYFFDFLDEQAEKYEIKDEDTVHIWKTNSLSLRFWVNILKNPHFIFDVHVHQVVDASLSVIAQTFMDAC--SRTEHKLSRESPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTESLNTLVALHQLYQY 1657          
BLAST of plexin B-5 vs. Ensembl Xenopus
Match: PLXNB2 (plexin B2 [Source:NCBI gene;Acc:550076])

HSP 1 Score: 136.346 bits (342), Expect = 1.397e-31
Identity = 140/562 (24.91%), Postives = 243/562 (43.24%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQ----------PNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEI-----------VQKNQLYRY 3462
            F N+L  K  L  +I  +E   +   ++K  LAS LT+ L    +Y+ ++++ L+ +L+ ++Y          +S  + ER++  W SIC++  LK T +GE  + L++ IK + E G VD   +KAKY L+   LL  D++Y+ L ++V V+        EE     E + V +L+ D+I+Q+KEKI+D+ +  N       K++             +  L +   +    L D D TS K    K+    NT  HYN++    L+L++     +G S   + N Q           + + A HL  P +     K++  + ++ +        R     + YL  L++ K +L   +D F QS+        N N   P                                 ++ Y F   DE A+   I D D +++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C        +  + P  K ++  +I     +    +  I++  +VSD++M   L+EI           V  +QLY+Y
Sbjct: 1123 FSNLLNSKSFLTIFIHTLESQKDFSAREKLYLASLLTVALHGKLEYYTDIMRALLMELM-DQYVAKNPKLLLRRSETVVERMLSNWMSICLYQYLKDT-VGEPLYKLFKAIKHQVEKGPVDALQAKAKYTLNDTGLLGDDVEYKQLTVNVIVQ--------EE---GAEPVPVKVLNCDTITQVKEKIVDQ-VYRNIPYSLRPKAD-------------SLALEWRPGSTAQILSDLDLTSQKEGRLKR---YNTLMHYNVRDNATLILSR-----MGISQQQEENHQDFPGERNALLEDENKAWHLVRPADEVDEVKSKRGSMKEKE--------RTKAITEIYLTRLLSVKGTLQQFVDNFFQSVL-------NSNQVVP--------------------------------PAVKYFFDFLDEQAEKYEIKDEDTVHIWKTNSLSLRFWVNILKNPHFIFDVHVHQVVDASLSVIAQTFMDAC--SRTEHKLSRESPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTESLNTLVALHQLYQY 1600          
BLAST of plexin B-5 vs. Ensembl Xenopus
Match: PLXNB2 (plexin B2 [Source:NCBI gene;Acc:550076])

HSP 1 Score: 136.346 bits (342), Expect = 1.547e-31
Identity = 140/562 (24.91%), Postives = 243/562 (43.24%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQ----------PNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEI-----------VQKNQLYRY 3462
            F N+L  K  L  +I  +E   +   ++K  LAS LT+ L    +Y+ ++++ L+ +L+ ++Y          +S  + ER++  W SIC++  LK T +GE  + L++ IK + E G VD   +KAKY L+   LL  D++Y+ L ++V V+        EE     E + V +L+ D+I+Q+KEKI+D+ +  N       K++             +  L +   +    L D D TS K    K+    NT  HYN++    L+L++     +G S   + N Q           + + A HL  P +     K++  + ++ +        R     + YL  L++ K +L   +D F QS+        N N   P                                 ++ Y F   DE A+   I D D +++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C        +  + P  K ++  +I     +    +  I++  +VSD++M   L+EI           V  +QLY+Y
Sbjct: 1099 FSNLLNSKSFLTIFIHTLESQKDFSAREKLYLASLLTVALHGKLEYYTDIMRALLMELM-DQYVAKNPKLLLRRSETVVERMLSNWMSICLYQYLKDT-VGEPLYKLFKAIKHQVEKGPVDALQAKAKYTLNDTGLLGDDVEYKQLTVNVIVQ--------EE---GAEPVPVKVLNCDTITQVKEKIVDQ-VYRNIPYSLRPKAD-------------SLALEWRPGSTAQILSDLDLTSQKEGRLKR---YNTLMHYNVRDNATLILSR-----MGISQQQEENHQDFPGERNALLEDENKAWHLVRPADEVDEVKSKRGSMKEKE--------RTKAITEIYLTRLLSVKGTLQQFVDNFFQSVL-------NSNQVVP--------------------------------PAVKYFFDFLDEQAEKYEIKDEDTVHIWKTNSLSLRFWVNILKNPHFIFDVHVHQVVDASLSVIAQTFMDAC--SRTEHKLSRESPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTESLNTLVALHQLYQY 1576          
BLAST of plexin B-5 vs. Ensembl Xenopus
Match: PLXNB2 (plexin B2 [Source:NCBI gene;Acc:550076])

HSP 1 Score: 136.346 bits (342), Expect = 1.639e-31
Identity = 140/562 (24.91%), Postives = 243/562 (43.24%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQ----------PNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEI-----------VQKNQLYRY 3462
            F N+L  K  L  +I  +E   +   ++K  LAS LT+ L    +Y+ ++++ L+ +L+ ++Y          +S  + ER++  W SIC++  LK T +GE  + L++ IK + E G VD   +KAKY L+   LL  D++Y+ L ++V V+        EE     E + V +L+ D+I+Q+KEKI+D+ +  N       K++             +  L +   +    L D D TS K    K+    NT  HYN++    L+L++     +G S   + N Q           + + A HL  P +     K++  + ++ +        R     + YL  L++ K +L   +D F QS+        N N   P                                 ++ Y F   DE A+   I D D +++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C        +  + P  K ++  +I     +    +  I++  +VSD++M   L+EI           V  +QLY+Y
Sbjct: 1143 FSNLLNSKSFLTIFIHTLESQKDFSAREKLYLASLLTVALHGKLEYYTDIMRALLMELM-DQYVAKNPKLLLRRSETVVERMLSNWMSICLYQYLKDT-VGEPLYKLFKAIKHQVEKGPVDALQAKAKYTLNDTGLLGDDVEYKQLTVNVIVQ--------EE---GAEPVPVKVLNCDTITQVKEKIVDQ-VYRNIPYSLRPKAD-------------SLALEWRPGSTAQILSDLDLTSQKEGRLKR---YNTLMHYNVRDNATLILSR-----MGISQQQEENHQDFPGERNALLEDENKAWHLVRPADEVDEVKSKRGSMKEKE--------RTKAITEIYLTRLLSVKGTLQQFVDNFFQSVL-------NSNQVVP--------------------------------PAVKYFFDFLDEQAEKYEIKDEDTVHIWKTNSLSLRFWVNILKNPHFIFDVHVHQVVDASLSVIAQTFMDAC--SRTEHKLSRESPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTESLNTLVALHQLYQY 1620          
BLAST of plexin B-5 vs. Ensembl Xenopus
Match: PLXNB2 (plexin B2 [Source:NCBI gene;Acc:550076])

HSP 1 Score: 135.961 bits (341), Expect = 1.956e-31
Identity = 138/562 (24.56%), Postives = 243/562 (43.24%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQ----------PNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEI-----------VQKNQLYRY 3462
            F N+L  K  L  +I  +E   +   ++K  LAS LT+ L    +Y+ ++++ L+ +L+ ++Y          +S  + ER++  W SIC++  LK T +GE  + L++ IK + E G VD   +KAKY L+   LL  D++Y+ L ++V V+ + +           E + V +L+ D+I+Q+KEKI+D+ +  N       K++             +  L +   +    L D D TS K    K+    NT  HYN++    L+L++     +G S   + N Q           + + A HL  P +     K++  + ++ +        R     + YL  L++ K +L   +D F QS+        N N   P                                 ++ Y F   DE A+   I D D +++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C        +  + P  K ++  +I     +    +  I++  +VSD++M   L+EI           V  +QLY+Y
Sbjct: 1114 FSNLLNSKSFLTIFIHTLESQKDFSAREKLYLASLLTVALHGKLEYYTDIMRALLMELM-DQYVAKNPKLLLRRSETVVERMLSNWMSICLYQYLKDT-VGEPLYKLFKAIKHQVEKGPVDALQAKAKYTLNDTGLLGDDVEYKQLTVNVIVQEEGA-----------EPVPVKVLNCDTITQVKEKIVDQ-VYRNIPYSLRPKAD-------------SLALEWRPGSTAQILSDLDLTSQKEGRLKR---YNTLMHYNVRDNATLILSR-----MGISQQQEENHQDFPGERNALLEDENKAWHLVRPADEVDEVKSKRGSMKEKE--------RTKAITEIYLTRLLSVKGTLQQFVDNFFQSVL-------NSNQVVP--------------------------------PAVKYFFDFLDEQAEKYEIKDEDTVHIWKTNSLSLRFWVNILKNPHFIFDVHVHQVVDASLSVIAQTFMDAC--SRTEHKLSRESPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTESLNTLVALHQLYQY 1591          
BLAST of plexin B-5 vs. Ensembl Mouse
Match: Plxnb2 (plexin B2 [Source:MGI Symbol;Acc:MGI:2154239])

HSP 1 Score: 144.436 bits (363), Expect = 4.444e-34
Identity = 149/562 (26.51%), Postives = 239/562 (42.53%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAI--------HLQIP-NETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEI-----------VQKNQLYRY 3462
            F N+L  K  L+ +I  +E       + K   AS LT+ L    +Y+ ++++ L  +L+ E+Y   K     L+ S  + ER++  W SIC++  LK +  GE  + L++ IK + E G VD    KAKY L+   LL  D++Y  L + V V+        +E I   + I V +L+ D+ISQ+KEKIID+                 PC C  P   S        S  +I L D D TS +    K+   INT  HYN++ G  L+L   S + +   P + +   P    A+        HL  P +E + G     +     +TK +          + YL  L++ K +L   +D F QS+                         ++   + P  ++              Y F   DE A+   I D D I++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C        +  D P  K ++  +I     +    +  I++  +VSD++M   L+EI           V  +QLY+Y
Sbjct: 1323 FSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELM-EQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDS-AGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQ--------DEGI---DAIPVKVLNCDTISQVKEKIIDQVYRTQ------------PCSCW-PKPDSVVLEWRPGSTAQI-LSDLDLTSQREGRWKR---INTLMHYNVRDGATLIL---SKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSMKEKERTKAI---------TEIYLTRLLSVKGTLQQFVDNFFQSV-------------------------LAPGHAVPPAVK--------------YFFDFLDEQAEKHDIRDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDAC--TRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQY 1801          
BLAST of plexin B-5 vs. Ensembl Mouse
Match: Plxnb2 (plexin B2 [Source:MGI Symbol;Acc:MGI:2154239])

HSP 1 Score: 144.436 bits (363), Expect = 4.444e-34
Identity = 149/562 (26.51%), Postives = 239/562 (42.53%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAI--------HLQIP-NETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEI-----------VQKNQLYRY 3462
            F N+L  K  L+ +I  +E       + K   AS LT+ L    +Y+ ++++ L  +L+ E+Y   K     L+ S  + ER++  W SIC++  LK +  GE  + L++ IK + E G VD    KAKY L+   LL  D++Y  L + V V+        +E I   + I V +L+ D+ISQ+KEKIID+                 PC C  P   S        S  +I L D D TS +    K+   INT  HYN++ G  L+L   S + +   P + +   P    A+        HL  P +E + G     +     +TK +          + YL  L++ K +L   +D F QS+                         ++   + P  ++              Y F   DE A+   I D D I++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C        +  D P  K ++  +I     +    +  I++  +VSD++M   L+EI           V  +QLY+Y
Sbjct: 1323 FSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELM-EQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDS-AGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQ--------DEGI---DAIPVKVLNCDTISQVKEKIIDQVYRTQ------------PCSCW-PKPDSVVLEWRPGSTAQI-LSDLDLTSQREGRWKR---INTLMHYNVRDGATLIL---SKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSMKEKERTKAI---------TEIYLTRLLSVKGTLQQFVDNFFQSV-------------------------LAPGHAVPPAVK--------------YFFDFLDEQAEKHDIRDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDAC--TRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQY 1801          
BLAST of plexin B-5 vs. Ensembl Mouse
Match: Plxnb1 (plexin B1 [Source:MGI Symbol;Acc:MGI:2154238])

HSP 1 Score: 120.168 bits (300), Expect = 1.213e-26
Identity = 133/569 (23.37%), Postives = 239/569 (42.00%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIID---KAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSG---------TKLLLTQDSMMSIG-----FSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKV--SDEEMANILSEI-----------VQKNQLYRY 3462
              N+L  K  L ++I  +E       +D+  +AS LT+ L    +YF ++L+ L+  L+ + Y          ++  + E+++  W SIC++  ++ + +GE  + L+RGIK + + G VD  + KAKY L+ + LL  D++Y+ L ++  + V            E + + V +L  D+ISQ KEK++D   K +    + +S T         +   S  A  LI         L D D TS    + ++   +NT +HY +  G         TK +L ++     G        V++   +P      HL  P++     +    + R  + +      R     + YL  L++ K +L   +D   Q I                         +ST    P  ++              Y F L DE A+   I D D I++WK+N    + W N ++NP  +F +     +   L  I+    ++C +     G   D P+ K ++  DI     +  + +  I++ V  SD+EM ++L+E+           V  ++LY+Y
Sbjct: 1590 LSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQ-YVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDS-VGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAG-------EAQCVPVKVLDCDTISQAKEKMLDQLYKGVPLAQRPDSCTLD-------VEWRSGVAGHLI---------LSDEDVTSELQGLWRR---LNTLQHYKVPDGATVALVPCLTKHILRENQDYVPGERTPMLEDVDEGGIRP-----WHLVKPSDEPEPPRPRRGSLRGGERE------RAKAIPEIYLTRLLSMKGTLQKFVDDLFQVI-------------------------LSTSRPVPLAVK--------------YFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLG--RDSPINKLLYARDIPRYKQMVERYYADIRQTVPASDQEMNSVLAELSRNCSADLGARVALHELYKY 2078          
BLAST of plexin B-5 vs. Ensembl Mouse
Match: Plxna1 (plexin A1 [Source:MGI Symbol;Acc:MGI:107685])

HSP 1 Score: 116.701 bits (291), Expect = 1.127e-25
Identity = 143/561 (25.49%), Postives = 234/561 (41.71%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVEL--NCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTL--KSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNI-KIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSG---------------------TKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGN--KNESN---NARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTF---VSIQEKVSDEEMANILSE 3432
            F  +L KKH L+ +I  +E   +  ++D+  +AS +   L    +Y   VLK L+  LI EK    K   + L  ++  ++E+++  W +  ++  LK    GE  F LY  IK + E G +D  + +A+Y+LS D L+   IDY+TL ++    V     N  E       + V  L+ D+++Q+KEK++D A+ +        K+ GD              L + +  + +I L D D   + + ID     +NT  HY +  G                     TK L   +SM+    SP + R+  P     I   + + T   +  KN  +      D  +K++          + YL  L+ATK +L   +D                           FE + ST           S L L    +I Y+F   DE A    I D+D+ + WKSNC   + W N ++NP  +F I   S     L  ++    +SC       G   D P  K ++  DI N Y  W + +   ++    +SD++M+  L+E
Sbjct: 1356 FGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLI-EKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNC---VNPEHENAPE-------VPVKGLNCDTVTQVKEKLLD-AVYKGVPYSQRPKA-GD------------MDLEWRQGRMARIILQDED---VTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTP----MITPDLESGTKLWHLVKNHDHLDQREGDRGSKMV---------SEIYLTRLLATKGTLQKFVDDL-------------------------FETIFST-------AHRGSALPL----AIKYMFDFLDEQADKHQIHDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLG--KDSPSNKLLYAKDIPN-YKSWVERYYADIAKMPAISDQDMSAYLAE 1835          
BLAST of plexin B-5 vs. Ensembl Mouse
Match: Plxna1 (plexin A1 [Source:MGI Symbol;Acc:MGI:107685])

HSP 1 Score: 116.701 bits (291), Expect = 1.127e-25
Identity = 143/561 (25.49%), Postives = 234/561 (41.71%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVEL--NCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTL--KSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNI-KIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSG---------------------TKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGN--KNESN---NARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTF---VSIQEKVSDEEMANILSE 3432
            F  +L KKH L+ +I  +E   +  ++D+  +AS +   L    +Y   VLK L+  LI EK    K   + L  ++  ++E+++  W +  ++  LK    GE  F LY  IK + E G +D  + +A+Y+LS D L+   IDY+TL ++    V     N  E       + V  L+ D+++Q+KEK++D A+ +        K+ GD              L + +  + +I L D D   + + ID     +NT  HY +  G                     TK L   +SM+    SP + R+  P     I   + + T   +  KN  +      D  +K++          + YL  L+ATK +L   +D                           FE + ST           S L L    +I Y+F   DE A    I D+D+ + WKSNC   + W N ++NP  +F I   S     L  ++    +SC       G   D P  K ++  DI N Y  W + +   ++    +SD++M+  L+E
Sbjct: 1356 FGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLI-EKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNC---VNPEHENAPE-------VPVKGLNCDTVTQVKEKLLD-AVYKGVPYSQRPKA-GD------------MDLEWRQGRMARIILQDED---VTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTP----MITPDLESGTKLWHLVKNHDHLDQREGDRGSKMV---------SEIYLTRLLATKGTLQKFVDDL-------------------------FETIFST-------AHRGSALPL----AIKYMFDFLDEQADKHQIHDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLG--KDSPSNKLLYAKDIPN-YKSWVERYYADIAKMPAISDQDMSAYLAE 1835          
BLAST of plexin B-5 vs. UniProt/SwissProt
Match: sp|O15031|PLXB2_HUMAN (Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 SV=3)

HSP 1 Score: 145.591 bits (366), Expect = 1.111e-33
Identity = 147/562 (26.16%), Postives = 238/562 (42.35%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAI--------HLQIP-NETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEI-----------VQKNQLYRY 3462
            F N+L  K  L+ +I  +E       + K   AS LT+ L    +Y+ +++  L  +L+ E+Y   K     L+ S  + ER++  W SIC++  LK +  GE  + L++ IK + E G VD    KAKY L+   LL  D++Y  L + V V+ +            ++ I V +L+ D+ISQ+KEKIID+               G PC C  P   S        S  +I L D D TS +    K+   +NT  HYN++ G  L+L   S + +   P + +   P    A+        HL  P +E + G     +     +TK +          + YL  L++ K +L   +D F QS+                         ++   + P  ++              Y F   DE A+   I D D I++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C        +  D P  K ++  +I     +    +  I++  +VSD++M   L+EI           V  +QLY+Y
Sbjct: 1319 FSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMHTLFLELL-EQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDS-AGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDE-----------GVDAIPVKVLNCDTISQVKEKIIDQVY------------RGQPCSCW-PRPDSVVLEWRPGSTAQI-LSDLDLTSQREGRWKR---VNTLMHYNVRDGATLIL---SKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAI---------TEIYLTRLLSVKGTLQQFVDNFFQSV-------------------------LAPGHAVPPAVK--------------YFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDAC--TRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQY 1797          
BLAST of plexin B-5 vs. UniProt/SwissProt
Match: sp|B2RXS4|PLXB2_MOUSE (Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 3.109e-33
Identity = 149/562 (26.51%), Postives = 239/562 (42.53%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAI--------HLQIP-NETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEI-----------VQKNQLYRY 3462
            F N+L  K  L+ +I  +E       + K   AS LT+ L    +Y+ ++++ L  +L+ E+Y   K     L+ S  + ER++  W SIC++  LK +  GE  + L++ IK + E G VD    KAKY L+   LL  D++Y  L + V V+        +E I   + I V +L+ D+ISQ+KEKIID+                 PC C  P   S        S  +I L D D TS +    K+   INT  HYN++ G  L+L   S + +   P + +   P    A+        HL  P +E + G     +     +TK +          + YL  L++ K +L   +D F QS+                         ++   + P  ++              Y F   DE A+   I D D I++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C        +  D P  K ++  +I     +    +  I++  +VSD++M   L+EI           V  +QLY+Y
Sbjct: 1323 FSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELM-EQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDS-AGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQ--------DEGI---DAIPVKVLNCDTISQVKEKIIDQVYRTQ------------PCSCW-PKPDSVVLEWRPGSTAQI-LSDLDLTSQREGRWKR---INTLMHYNVRDGATLIL---SKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSMKEKERTKAI---------TEIYLTRLLSVKGTLQQFVDNFFQSV-------------------------LAPGHAVPPAVK--------------YFFDFLDEQAEKHDIRDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDAC--TRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQY 1801          
BLAST of plexin B-5 vs. UniProt/SwissProt
Match: sp|Q9V4A7|PLXB_DROME (Plexin-B OS=Drosophila melanogaster OX=7227 GN=PlexB PE=1 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 3.222e-27
Identity = 138/576 (23.96%), Postives = 249/576 (43.23%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVEL---NCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPIS----HSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGT--KLLLTQDSMMSIGFSPVNKRNFQP----------------NNDVAIHLQIPNETNFGNKNESNNARDNKTKLL-----------FNPIRENTNK---DAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTF---VSIQEKVSDEEMANILSEI-VQKNQ 3450
            FE ++  K+ L+ +IE +E    +  ++D+  +AS + + LM   +Y  E+LK L+ +LI +   +        ++  + E+++  + +ICM+D LK    G   F L++ IK + E GLVD  ++ A+Y+LS + LL   + +  +I+ +       L +  +     E++   +   D+ISQ+K KI+D AI +N              P +  +     H          ++ +Q +D    ++  +  K+   +NT  HY +K      L+  Q+    I +S    +N  P                NND+   LQ P   +    N  ++  + K  +L            N   +  NK   + YL  L+ATK ++   +D F                         F  +++ +   P  ++              ++F L DE A+   I DTD+++ WKSNC   + W NF++NPD IF +    +V   L  I+    ++C       G   D P  K +F  DI N Y +  + F   VS   ++SD+EM+  + ++ V++N+
Sbjct: 1497 FEQLIGNKYFLLMFIETLEAQRSSFSIRDRVNVASLIMVVLMNKMEYATEILKSLLLRLIDKSLASKHPQLMLRRTESVVEKMLTNYLAICMYDYLKEY-AGSNLFLLFKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHI-------LQDDLD-----EKVQCRVNDWDTISQVKLKILD-AIFKNTPFSMR--------PSVNEVDLEWRHGR------GGHLTLQDEDLTTKTVNGW--KR---LNTLAHYGVKESAVMSLIARQNDNYHIPYS--KNQNSAPYHNFYFINNSQSHIIINNDIESGLQQPRVYHLVKPNIPDHYMNIKNSVLSGGSPAFQSHVVNNCNDRVNKTIPEVYLTRLLATKGTIQKFVDDF-------------------------FSIILTVNEELPPAVK--------------WLFDLLDEAARRHDIADTDIVHAWKSNCLPLRFWVNFIKNPDFIFDVNKTYSVDSCLSVIAQTFMDACSTSEHRLG--KDSPSNKLLFAKDIPN-YRIMVKEFYRDVSRLPQISDQEMSTAMQQLSVRQNE 1995          
BLAST of plexin B-5 vs. UniProt/SwissProt
Match: sp|Q8CJH3|PLXB1_MOUSE (Plexin-B1 OS=Mus musculus OX=10090 GN=Plxnb1 PE=1 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 8.484e-26
Identity = 133/569 (23.37%), Postives = 239/569 (42.00%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIID---KAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSG---------TKLLLTQDSMMSIG-----FSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKV--SDEEMANILSEI-----------VQKNQLYRY 3462
              N+L  K  L ++I  +E       +D+  +AS LT+ L    +YF ++L+ L+  L+ + Y          ++  + E+++  W SIC++  ++ + +GE  + L+RGIK + + G VD  + KAKY L+ + LL  D++Y+ L ++  + V            E + + V +L  D+ISQ KEK++D   K +    + +S T         +   S  A  LI         L D D TS    + ++   +NT +HY +  G         TK +L ++     G        V++   +P      HL  P++     +    + R  + +      R     + YL  L++ K +L   +D   Q I                         +ST    P  ++              Y F L DE A+   I D D I++WK+N    + W N ++NP  +F +     +   L  I+    ++C +     G   D P+ K ++  DI     +  + +  I++ V  SD+EM ++L+E+           V  ++LY+Y
Sbjct: 1590 LSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQ-YVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDS-VGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAG-------EAQCVPVKVLDCDTISQAKEKMLDQLYKGVPLAQRPDSCTLD-------VEWRSGVAGHLI---------LSDEDVTSELQGLWRR---LNTLQHYKVPDGATVALVPCLTKHILRENQDYVPGERTPMLEDVDEGGIRP-----WHLVKPSDEPEPPRPRRGSLRGGERE------RAKAIPEIYLTRLLSMKGTLQKFVDDLFQVI-------------------------LSTSRPVPLAVK--------------YFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLG--RDSPINKLLYARDIPRYKQMVERYYADIRQTVPASDQEMNSVLAELSRNCSADLGARVALHELYKY 2078          
BLAST of plexin B-5 vs. UniProt/SwissProt
Match: sp|O43157|PLXB1_HUMAN (Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3)

HSP 1 Score: 118.242 bits (295), Expect = 3.379e-25
Identity = 129/570 (22.63%), Postives = 236/570 (41.40%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIE-KYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIID---KAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSG---------TKLLLTQDSMMSIG-----FSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKV--SDEEMANILSEI-----------VQKNQLYRY 3462
              N+L  K  L ++I  +E       +D+  +AS LT+ L    +YF ++L+ L+  L+ +   KN K      ++  + E+++  W SIC++  ++ + +GE  + L+RGIK + + G VD  + KAKY L+ + LL  D++Y+ L ++  + V            E + + V +L  D+ISQ KEK++D   K +    + +  T                    +  +S +   L    D  + S +      +NT +HY +  G         TK +L ++     G        V++   +P      HL  P++     +    + R  + +      R     + YL  L++ K +L   +D   Q I                         +ST    P  ++              Y F L DE A+   I D D I++WK+N    + W N ++NP  +F +     +   L  I+    ++C +     G   D P+ K ++  DI     +  + +  I++ V  SD+EM ++L+E+           V  ++LY+Y
Sbjct: 1606 LSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPK--LMLRRTETVVEKLLTNWMSICLYTFVRDS-VGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAG-------EAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLD------------------VEWRSGVAGHL-ILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDVDEGGIRP-----WHLVKPSDEPEPPRPRRGSLRGGERE------RAKAIPEIYLTRLLSMKGTLQKFVDDLFQVI-------------------------LSTSRPVPLAVK--------------YFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLG--RDSPINKLLYARDIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKY 2094          
BLAST of plexin B-5 vs. TrEMBL
Match: A0A0K0LJ04 (Plexin B-5 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=plxnB-5 PE=2 SV=1)

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 278/281 (98.93%), Postives = 280/281 (99.64%), Query Frame = 1
Query: 1885 VQWIEKVELNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVA 2727
            VQWIEKVELNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMN EELIIEMERINVTILSLDSISQIKEKIIDKAIMEN+KLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDK+CIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVA
Sbjct:    1 VQWIEKVELNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNGEELIIEMERINVTILSLDSISQIKEKIIDKAIMENSKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKRCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVA 281          
BLAST of plexin B-5 vs. TrEMBL
Match: A0A0K0LJ73 (Plexin B-4 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=plxnB-4 PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 8.420e-69
Identity = 168/474 (35.44%), Postives = 267/474 (56.33%), Query Frame = 1
Query: 2065 KSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNRE--ELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVA-IHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISL 3477
            K   I+E I+  W +ICM++N K    G+  F+LYR +K +  SGLVD FS K++Y+LS   LL  ++DY+TL + V+V V+I +M+       I +  I + ILSLD++SQ+K KI+DKAIM   K E    ++ +    IA  +   F L F  + +K+ L +FD TSI     KK I+ NT KHYNIKS  KLLLT +++++      N+R+   ++ +  IHL IP E          N +++K KL+F P  +  N ++ LF+L+ TKK++   I  F +S+T   P   N   FS  S+                QI +E +        +FY+FS+ ++IA S+ I DT+ I  WK N +I+  WS  +RNP+ IF + V+S++  SL  I+ +L  SC  ES     +    +  Q+F +DI   Y  WW +F++ + K+ +E++ +++S+IV+K +L  +K+ +L
Sbjct:    2 KPESIAELIVENWLTICMYENFKACEEGQTLFSLYRALKCQINSGLVDEFSKKSQYSLSPSYLLPNNLDYETLNVFVSVNVQIKMMDASINPWTISLINIPIIILSLDTVSQVKAKILDKAIMMYLKGEHSLFTDSENKQTIAESNLDNFLLYFFHNKVKVNLANFDKTSILLPGKKKFIVANTMKHYNIKSDNKLLLTSENLLNF-----NERHLLTDDKLTKIHLLIPKEAEIST---IENKKNSKKKLIFQPAVDKENINSSLFILLTTKKNINDFIHNFFKSLTTDIPCQSNSKVFSSQSSY---------------QINQERKF-----FHVFYLFSMLEDIATSISINDTEEIKSWKINSFINAFWSKAIRNPNKIFSVEVDSSLFASLNVIAEVLLTSCSQESSILSFKTGSSISTQIFHEDITTTYIHWWNSFLNSKRKIPEEDIVSLMSDIVEKYELEEFKANAL 447          
BLAST of plexin B-5 vs. TrEMBL
Match: A0A2K5I0Q9 (Plexin_cytopl domain-containing protein OS=Colobus angolensis palliatus OX=336983 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 8.136e-33
Identity = 147/562 (26.16%), Postives = 239/562 (42.53%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAI--------HLQIP-NETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEI-----------VQKNQLYRY 3462
            F N+L  K  L+ +I  +E       + K   AS LT+ L    +Y+ ++++ L  +L+ E+Y   K     L+ S  + ER++  W SIC++  LK +  GE  + L++ IK + E G VD    KAKY L+   LL  D++Y  L + V V+ +            ++ I V +L+ D+ISQ+KEKIID+               G PC C  P   S        S  +I L D D TS +    K+   +NT  HYN++ G  L+L   S + +   P + +   P    A+        HL  P +E + G     +     +TK +          + YL  L++ K +L   +D F QS+                         ++   + P  ++              Y F   DE A+   I D D I++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C        +  D P  K ++  +I     +    +  I++  +VSD++M   L+EI           V  +QLY+Y
Sbjct:  111 FSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELL-EQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDS-AGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDE-----------GVDAIPVKVLNCDTISQVKEKIIDQVY------------RGQPCSCW-PRPDSVVLEWRPGSTAQI-LSDLDLTSQREGRWKR---VNTLMHYNVRDGATLIL---SKVGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAI---------TEIYLTRLLSVKGTLQQFVDNFFQSV-------------------------LAPGHAVPPAVK--------------YFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDAC--TRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQY 589          
BLAST of plexin B-5 vs. TrEMBL
Match: A0A2K6KJ83 (Plexin B2 OS=Rhinopithecus bieti OX=61621 GN=PLXNB2 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 9.114e-33
Identity = 146/562 (25.98%), Postives = 242/562 (43.06%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNE-------SNNARDNKTKLLFNPIRENTNK--DAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEI-----------VQKNQLYRY 3462
            F N+L  K  L+ +I  +E       + K   AS LT+ L    +Y+ ++++ L  +L+ E+Y   K     L+ S  + ER++  W SIC++  LK +  GE  + L++ IK + E G VD    KAKY L+   LL  D++Y  L + V V+ +            ++ I V +L+ D+ISQ+KEKIID+               G PC C  P   S        S  +I L D D TS +    K+   +NT  HYN++ G  L+L   S + +   P + +   P    ++ L+ P  +    +N        ++   + K+K      +E T    + YL  L++ K +L   +D F QS+                         ++   + P  ++              Y F   DE A+   I D D I++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C        +  D P  K ++  +I     +    +  I++  +VSD++M   L+EI           V  +QLY+Y
Sbjct:  111 FSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELL-EQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDS-AGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDE-----------GVDAIPVKVLNCDTISQVKEKIIDQVY------------RGQPCSCW-PRPDSVVLEWRPGSTAQI-LSDLDLTSQREGRWKR---VNTLMHYNVRDGATLIL---SKVGVSQQPEDSQQDLPGERESLPLRGPRPSWRHEENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAITEIYLTRLLSVKGTLQQFVDNFFQSV-------------------------LAPGHAVPPAVK--------------YFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDAC--TRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQY 598          
BLAST of plexin B-5 vs. TrEMBL
Match: A0A2K5LGS1 (Plexin B2 OS=Cercocebus atys OX=9531 GN=PLXNB2 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.141e-32
Identity = 146/567 (25.75%), Postives = 240/567 (42.33%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE--LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLT--------QDSMMSIGFSPVNKRN------FQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEI-----------VQKNQLYRY 3462
            F N+L  K  L+ +I  +E       + K   AS LT+ L    +Y+ ++++ L  +L+ E+Y   K     L+ S  + ER++  W SIC++  LK +  GE  + L++ IK + E G VD    KAKY L+   LL  D++Y  L + V V+ +            ++ I V +L+ D+ISQ+KEKIID+               G PC C  P   S        S  +I L D D TS +    K+   +NT  HYN++ G  L+L+        +DS   +   P   R+       +  N V   ++  +E + G     +     +TK +          + YL  L++ K +L   +D F QS+                         ++   + P  ++              Y F   DE A+   I D D I++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C        +  D P  K ++  +I     +    +  I++  +VSD++M   L+EI           V  +QLY+Y
Sbjct:  111 FSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELL-EQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDS-AGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDE-----------GVDAIPVKVLNCDTISQVKEKIIDQVY------------RGQPCSCW-PRPDSVVLEWRPGSTAQI-LSDLDLTSQREGRWKR---VNTLMHYNVRDGATLILSKVGVSQQPEDSQQDLPGEPPGGRHGPRHALLEEENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAI---------TEIYLTRLLSVKGTLQQFVDNFFQSV-------------------------LAPGHAVPPAVK--------------YFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDAC--TRTEHKLSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQY 597          
BLAST of plexin B-5 vs. Ensembl Cavefish
Match: plxnb1a (plexin b1a [Source:ZFIN;Acc:ZDB-GENE-050302-63])

HSP 1 Score: 119.398 bits (298), Expect = 1.439e-26
Identity = 127/535 (23.74%), Postives = 226/535 (42.24%), Query Frame = 1
Query: 1924 KDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLT-----QDSMMSIGFSPVNKRNFQPNNDVAI----HLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKV--SDEEMANILSE-----------IVQKNQLYRY 3462
            +D+  +AS LT+ L    +YF ++LK L+  L+ E+Y N        ++  + E+++  W SIC++  L+ +  GE F+ L+R IK + + G VD  + KAKY L+ + LL  D++Y+TL      K  +++++    I +   +   +L  D+I+Q+KEKI+++     +  +              P + S            + L D D TS+     K+   +NT +HY +  G  + L      Q    S  + P  K     + D       HL   NE    +K+   + R+ + +      R     + YL  L++ K +L   +D                           F  ++ST    P  ++              Y F L D+ A    I D + I++WK+N    + W N ++NP  IF +     V   L  I+    +SC +     G   D P+ K ++  DI     +  + +  I++ +  SD+EM + L+E           +V  ++LY+Y
Sbjct: 1600 RDRANVASLLTVALHGKLEYFTDILKTLLSHLV-EQYTNKNPKLMLRRTESVVEKLLTNWMSICLYTFLRDS-AGESFYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYRTLPSFQFGKTLLTMIS--PGIGKALTVPTKVLDCDTITQVKEKILEQTWKGTSYSQR-------------PSTDSVHLEWRAGMAGHLILSDEDLTSVVQGTWKR---LNTLQHYKVPDGATVTLVSRQSKQVHHDSHDYIPGEKTPMLEDGDEGGMRLWHLVKANEEPELSKHRRGSLRERERE------RAKAIPEIYLTRLLSMKGTLQKFVDDL-------------------------FTVILSTSRPVPLAVK--------------YFFDLLDDQAAQHNITDPETIHIWKTNSLPLRFWINILKNPQFIFDVQASDNVDAVLSVIAQTFMDSCTIAEHKLG--RDSPINKLLYARDIPRYKQMVERYYSDIRQTISASDQEMNSALAELSRNYSSEVNHLVALHELYKY 2067          
BLAST of plexin B-5 vs. Ensembl Cavefish
Match: PLXND1 (plexin D1 [Source:HGNC Symbol;Acc:HGNC:9107])

HSP 1 Score: 119.398 bits (298), Expect = 1.548e-26
Identity = 138/539 (25.60%), Postives = 235/539 (43.60%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVEL--NCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLI-IEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMM--SIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFV-SIQE--KVSDEEMANILSEIVQK 3444
            F  +L  KH L+ ++  +E   +  V+D+C LAS LT+ L    +Y+  ++K L+  LI     KN K      ++  + E+++  W SICM+  LK T +GE FF L   IK +   G +D  + KA+Y L+ + LL  +I+ + + I+V+ +              M+ ++V +++ D+I Q+KEKI++ A  +N         E         +    F      S I   L D D+TSI     KK   +NT  HY I  G  L ++       ++G      R    + +  +HL  P++     K    ++  ++ K+L          + YL  L++TK +L   +D   Q+I                             LS P   +E+  L      ++ Y F   +E A    I D D +++WK+N    + W N ++NP  +F I     +   L  I+    ++C +  +  G   D P  K ++  +I  +Y    Q F   IQE   +S++EM   L+E  +K
Sbjct: 1231 FSTLLNNKHFLITFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKELLVDLIDASASKNPK--LMLRRTESVVEKMLTNWMSICMYSYLKET-VGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPVNINVSFQG-----------FGMDSVSVRVMNTDTICQVKEKILE-AFYKNLPFSQWPHEED--------VDLEWFPGGGCSSRI---LQDLDNTSIMEDGRKK---LNTVFHYKIPEGASLAMSMKDKRENTLG------RAKDLDTEKYVHLVPPHDELIEPKKSHRHS--HRKKVL---------PEIYLTRLLSTKGTLQKFLDDLFQAI-----------------------------LSIP---QEKPPL------AVKYFFDFLEEQADKRGITDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLG--KDSPTNKLLYAKEIP-EYKKRVQCFYKQIQEMAPLSEQEMNAHLAEESRK 1682          
BLAST of plexin B-5 vs. Ensembl Cavefish
Match: plxnb1b (plexin b1b [Source:ZFIN;Acc:ZDB-GENE-090812-4])

HSP 1 Score: 119.398 bits (298), Expect = 1.731e-26
Identity = 123/536 (22.95%), Postives = 220/536 (41.04%), Query Frame = 1
Query: 1924 KDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIP--NETNFGN--------KNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKV--SDEEMANILSE-----------IVQKNQLYRY 3462
            +D+  +AS LT+ L    +YF ++LK L+  L+ E+Y          ++  + E+++  W SIC++  L+ +  GE  + L+R IK + + G VD  + KAKY L+ + LL  D++Y+TL   VNV ++   +N      E + +   +L  D+I+Q+KEKI+D+     +                    H+    +  +S +   L    D  + S +      +NT +HY +  G  + L             +K     N+D     + P   + + G          +E      ++   L    R     + YL  L++ K +L   +D                           F  ++ST    P  ++              Y F L D+ A    I D++ I++WK+N    + W N V+NP  IF +     V   L  I+    +SC +     G   D P+ K ++  DI     +  + +  I++ +  SD+EM + L+E           +V  ++LY+Y
Sbjct: 1596 RDRAYVASLLTVALHGKLEYFTDILKTLLNDLV-EQYVAKNPKLMLRRTETVVEKLLTNWMSICLYAFLRDS-AGECLYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDLEYRTLT--VNVLMQGVGVN------ETQPVAAKVLDCDTITQVKEKILDQVYKGTSYSHR---------------PHTDSLDLEWRSGVAGHL-ILSDEDLTSVVQGNWKRLNTLQHYKVPDGATVALVPRH---------SKHIHHDNHDYVAGEKTPMLEDADEGGVRLWHLVKASEEPELPKHRRGSLRERERAKAIPEIYLTRLLSMKGTLQKFVDDL-------------------------FTVILSTSRPVPLAVK--------------YFFDLLDDQAAHHGISDSETIHIWKTNSLPLRFWINIVKNPQFIFDVQASDNVDAVLSVIAQTFMDSCTIAEHKLG--RDSPINKLLYARDIPRYKQMVERYYADIRQTISASDQEMNSALAELSRNYSGELNYLVALHELYKY 2055          
BLAST of plexin B-5 vs. Ensembl Cavefish
Match: plxna1a (plexin-A1-like [Source:NCBI gene;Acc:103026658])

HSP 1 Score: 118.242 bits (295), Expect = 2.840e-26
Identity = 138/559 (24.69%), Postives = 233/559 (41.68%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVEL--NCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNI-KIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSG---------------------TKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNF----GNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTF---VSIQEKVSDEEMANILSE 3432
            F  +L K+H L+ +I  +E   +  ++D+  +AS +   L    +Y   VLK L+  LI    ++       L+ +  ++E+++  W +  ++  LK    GE  F LY  +K + E G +D  + +A+Y+LS D L+   IDY+TL +          +N E        ++V  L+ D+I+Q+KEK++D A+ + +      K+ GD              + + +S + +I L D D   + + ID     +NT  HY +  G                     TK L   +SM+    SP + R+  P     I   + + T       N + S+    +++  + + I        YL  L+ATK +L   +D                           FE + ST           S L L    +I Y+F   DE A    I D D+ + WKSNC   + W N ++NP  +F I   S     L  ++    +SC       G   D P  K ++  DI N Y  W + +   +S    +SD++M+  L+E
Sbjct:  713 FGQLLAKQHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIDRNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAMKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHC--------VNPENE--SAPEVSVKCLNCDTITQVKEKLLD-AVYKGSPYSQRPKA-GD------------MDMEWRQSRMARIVLQDED---VTTKIDNDWKRLNTLSHYQVTDGSVIALVPKQNSAYNICNSSTFTKSLSRYESMLRTASSPDSLRSRTP----MITPDLESGTKLWHLVKNHDHSDQREGDRSSKMVSEI--------YLTRLLATKGTLQKFVDDL-------------------------FETIFST-------AHRGSALPL----AIKYMFDFLDEQADKHQITDADVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLG--KDSPSNKLLYAKDIPN-YKSWVERYYADISRMPTISDQDMSAYLAE 1192          
BLAST of plexin B-5 vs. Ensembl Cavefish
Match: plxna1a (plexin-A1-like [Source:NCBI gene;Acc:103026658])

HSP 1 Score: 117.857 bits (294), Expect = 4.136e-26
Identity = 138/559 (24.69%), Postives = 233/559 (41.68%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVEL--NCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNI-KIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSG---------------------TKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNF----GNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTF---VSIQEKVSDEEMANILSE 3432
            F  +L K+H L+ +I  +E   +  ++D+  +AS +   L    +Y   VLK L+  LI    ++       L+ +  ++E+++  W +  ++  LK    GE  F LY  +K + E G +D  + +A+Y+LS D L+   IDY+TL +          +N E        ++V  L+ D+I+Q+KEK++D A+ + +      K+ GD              + + +S + +I L D D   + + ID     +NT  HY +  G                     TK L   +SM+    SP + R+  P     I   + + T       N + S+    +++  + + I        YL  L+ATK +L   +D                           FE + ST           S L L    +I Y+F   DE A    I D D+ + WKSNC   + W N ++NP  +F I   S     L  ++    +SC       G   D P  K ++  DI N Y  W + +   +S    +SD++M+  L+E
Sbjct: 1361 FGQLLAKQHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIDRNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAMKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHC--------VNPENE--SAPEVSVKCLNCDTITQVKEKLLD-AVYKGSPYSQRPKA-GD------------MDMEWRQSRMARIVLQDED---VTTKIDNDWKRLNTLSHYQVTDGSVIALVPKQNSAYNICNSSTFTKSLSRYESMLRTASSPDSLRSRTP----MITPDLESGTKLWHLVKNHDHSDQREGDRSSKMVSEI--------YLTRLLATKGTLQKFVDDL-------------------------FETIFST-------AHRGSALPL----AIKYMFDFLDEQADKHQITDADVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHKLG--KDSPSNKLLYAKDIPN-YKSWVERYYADISRMPTISDQDMSAYLAE 1840          
BLAST of plexin B-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009284.1 (pep scaffold:Pmarinus_7.0:GL476385:264710:288126:-1 gene:ENSPMAG00000008378.1 transcript:ENSPMAT00000009284.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 91.6633 bits (226), Expect = 6.726e-19
Identity = 75/266 (28.20%), Postives = 125/266 (46.99%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVELNCK--VKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTK 2643
              N+L  K  L   I  +E   K   +D+  +AS LT+ L    +Y+ ++LK L+  L+  +Y          ++  ++E+++  W S+C++  LK T  GE  F L+R IK + E G VD    KAKY+L+   LL  D+DYQ+L+I+  V+        E  +I      V +L  DSI Q+K+KI+D+         ++  S+      +     S F   F  S          D  + S +  + + INT +HY +   ++
Sbjct:  382 LSNLLNSKLFLTTMIHTLEGQPKFSARDRGCVASLLTVALQDKLEYYTDILKTLLGDLV-GQYVAKNPKLMLRRTETVAEKMLTNWMSVCLYKFLKDT-AGEPLFMLFRAIKQQVEKGPVDGVLRKAKYSLNDTRLLGEDVDYQSLVINATVENS----GEEGPVI------VRVLDCDSIGQVKDKILDQV------YRNVPYSQRPSVDTVELEWRSTFAGQFTLS----------DEDLTSVVQGRWLRINTLRHYRVSGHSQ 619          
BLAST of plexin B-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006876.1 (pep scaffold:Pmarinus_7.0:GL486582:611:5415:1 gene:ENSPMAG00000006217.1 transcript:ENSPMAT00000006876.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 3.984e-13
Identity = 48/136 (35.29%), Postives = 70/136 (51.47%), Query Frame = 1
Query: 1876 HTLVQWIEKVELNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTL 2283
            HTL Q     + +  VKD+C LAS+LT  L    +Y+  VLK L+  LI     N        ++  + E+++  W SICM+  L+   +GE FF L   I+ +   G VD  + +AKY LS D LL  +I+   L
Sbjct:   76 HTLEQ-----QKDFTVKDRCYLASWLTAALQGNLEYYTAVLKELLVDLI-RSSTNKHPKLMLRRTESVVEKMLTNWMSICMYGFLRD-RVGEPFFLLLTAIRQQISKGPVDAVTGRAKYTLSEDWLLRENIEATAL 204          
BLAST of plexin B-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007728.1 (pep scaffold:Pmarinus_7.0:GL483331:9686:16681:-1 gene:ENSPMAG00000006984.1 transcript:ENSPMAT00000007728.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.147e-10
Identity = 38/131 (29.01%), Postives = 64/131 (48.85%), Query Frame = 1
Query: 3061 SIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEIVQKN 3447
            ++ Y F   DE A+   I D + I++WK+N    + W N ++NP+ +F + V   V  SL  I+    +SC  +    G   D P+ K ++  +I     +  + +  I++   V DE+M   LSE  Q N
Sbjct:   52 AVKYFFDFLDEAAERHGIEDPETIHIWKTNSLPLRFWVNILKNPNFVFDVQVSDIVDASLSVIAQTFMDSCTTQEQKLG--RDSPINKLLYAREISGYKKMVEKYYADIRQMVPVRDEDMRTELSEESQNN 180          
BLAST of plexin B-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004433.1 (pep scaffold:Pmarinus_7.0:GL481384:28210:40565:1 gene:ENSPMAG00000004038.1 transcript:ENSPMAT00000004433.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 7.238e-9
Identity = 64/286 (22.38%), Postives = 118/286 (41.26%), Query Frame = 1
Query: 2602 INTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPN------NDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIH-QVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSE 3432
            IN+   Y I  G           S+  S  +K+N  PN      ND   HL  P +     K +S + +  + K+L          + YL  L++TK +L   +    ++I  +  P+E      PM+                                I + F   +E A+S  I D + +++WK+N Y+  + W N ++NP  +F +   + +   L  I+    ++C + S+  G   D P  K ++  +I    SL ++ +  IQ+   +S++EM + ++E
Sbjct:   81 INSVSAYQIPDGA----------SLALSFKDKKNICPNEDNLKDNDNYFHLVTPADEMMEVK-KSKSQQGKRKKVL---------PEVYLTRLLSTKGTLQKFVTDLFRAILTY--PAEQ----PPMA--------------------------------IKFFFDFLEEQAESRGIVDPETVHIWKTNRYLPLRFWVNILKNPQFVFDLEKTTHMDACLSVIAQAFIDACSLSSLTLG--KDSPTNKLLYAKEIPEYKSLVFEYYNDIQQLPMLSEQEMNSYMAE 306          
BLAST of plexin B-5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006110.1 (pep scaffold:Pmarinus_7.0:GL484765:748:3341:1 gene:ENSPMAG00000005524.1 transcript:ENSPMAT00000006110.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 6.489e-8
Identity = 37/127 (29.13%), Postives = 56/127 (44.09%), Query Frame = 1
Query: 3061 SIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLW---WQTFVSIQEKVSDEEMANILSE 3432
            +I Y+F   DE A    I D  + + WKSN    + W N ++NP  +F I   S     L  ++    +SC       G   D P  K ++  DI N Y  W   + T +     +SD++M   L+E
Sbjct:  105 AIKYMFDFLDEQADRHAIHDPAVRHTWKSNSLPLRFWVNVIKNPQFVFDIHKTSITDACLSVVAQTFMDSCSTSEHRLG--KDSPSNKLLYAKDIPN-YKHWVERYYTDIGKMPAISDQDMNAYLAE 228          
BLAST of plexin B-5 vs. Ensembl Nematostella
Match: EDO39009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBD7])

HSP 1 Score: 127.487 bits (319), Expect = 1.736e-29
Identity = 139/612 (22.71%), Postives = 256/612 (41.83%), Query Frame = 1
Query: 1651 IENHLTELSTDF--SNIQYKAFYEYQIAVQSFNNIGLFTPRHFYSFNDFLSKLLNVDLILNENSFSCQDFENILLKKHTLVQWIEKVELN--CKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNK----TKLLFNPIRENTNKDA------YLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDI---KNKYSLWWQTFVSIQEKVSDEEMANILSEI 3435
            ++  +T+L +D   S + +  F  Y + V  F  +   +  HF   N  LS +    L         + F  ++  K  L+ ++  VE      +KD+C LAS L + L     Y  E+L  L+  LI +            ++  ++E+++  W + CM+++LK  + GE  F +++ IK +   G VD  + +A+Y+LS D LL   IDY+ + ++V  + +   M             VT+L  DS+SQ K K++D A+ +N    S  ++E               +L +  ++  ++    DD S  S ++ +   +NT  HY +  G  L L+         S  ++R     +   +     N T     +  +     +     KLL  P  ++  + +      YL  L+ATK +L   +DG                          F  + +++   P  ++              Y+F L D  AK L + D+++++ WK+N    + W N V+NP+ IF I     V   L  I+ +  ++C +     GI    P  K ++  +I   K +   ++Q   ++    S EEMA+  +++
Sbjct: 1297 LQTDMTDLKSDLTTSGMPFLDFRTYALNVL-FPGVDDHSVTHFKDAN--LSPVWEQGL---------RKFSQLIYNKEFLLIFVRTVESQKTFSMKDRCNLASLLMVTLQGKMDYATEILWQLLCDLIRKSVAQSHPKLLLRRTESVAEKLLTNWLAFCMYNHLKVES-GEPLFMMFKAIKRQVGKGPVDAVTGEARYSLSEDKLLRQTIDYEEIRVNVTFEDQPPTM-------------VTVLDCDSVSQAKSKMLD-AVYKNVPFSSRVEAE-------------TLQLDWHLTDGSVKPLRDDDAS--SVVEGQWRKLNTLGHYKVTDGANLKLSPRQSYFYSSSNNSERQHHHRSLPRVVFSPFNYTPISRGSREDLDEGGRIWHLVKLLDYPTDKDDTQHSKMLAEIYLTRLLATKGTLQQFVDGL-------------------------FNSMFNSNCRPPVPVK--------------YLFDLLDSQAKELNLSDSEVLHTWKNNSLPLRFWINIVKNPNFIFDIEKSGTVDSCLSVIAQLFMDACSISEHRLGIHS--PSNKLLYAKEIPAYKQRVEQFYQNITALPSP-SGEEMADYFADL 1824          
BLAST of plexin B-5 vs. Ensembl Medaka
Match: plxnb2b (plexin-B2 [Source:NCBI gene;Acc:101169201])

HSP 1 Score: 125.561 bits (314), Expect = 1.872e-28
Identity = 146/565 (25.84%), Postives = 245/565 (43.36%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVE----LNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLK-SSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVT---ILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNN-----DVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQ--EKVSDEEMANILSEI-----------VQKNQLYRYKS 3468
            F N+L  K  L+ +I  +E     N + +  C  AS LT+ L    +Y+ ++++ L+ +L+ E+Y + K     L+ S  + ER++  W SIC++  LK +  GE  + L+R IK + E G VD    KAKY L+   LL  D++Y  L + V              +++ E ++VT   +L+ D+ISQ+KEKII++ +  N       K++G               L +   +    L D D TS K   + +   INT  HYN++    ++L++ S     +   N+ N +  N     D   HL  P E     K++  + +D   K +   I E      YL  L++ K +L   +D F +S+                        L S  +  P               ++ Y F   DE A      D + I++WK+N    + W N ++NP  IF + V   V  SL  I+    ++C  +S +  +  D P  K ++  +I     +    +  I+    VSD++M   L+E+           V  +QLY+Y S
Sbjct: 1324 FSNLLNSKTFLINFIRTLERSHDFNARARVYC--ASLLTVALHGKLEYYTDIMRTLLLELM-EEYVHSKNPKLMLRRSETVVERMLCNWMSICLYQFLKDS-AGEPLYKLFRAIKHQIEKGPVDARVKKAKYTLNDTGLLGDDVEYSVLNLQV--------------LVQGEGLDVTYVKVLNCDTISQVKEKIIEQ-VYRNLPYSQRPKADG-------------VTLEWRPGSTGQILSDLDLTSQK---EGRWRRINTLAHYNVRDNATVVLSKVSHTLHNYD-QNQENHEERNALLDDDKVFHLVRPAEELDEFKSKRGSIKD---KSMTKAITE-----IYLTRLLSVKGTLQQFVDNFFRSV------------------------LCSGAVVPP---------------AVKYFFDFLDEQALKHNNVDEETIHIWKTNSLPLRFWVNILKNPHFIFDVHVSEVVDASLSVIAQTFMDAC-TKSEHK-LSRDSPSNKLLYAKEISTYKKMVDDYYKDIRLMVPVSDQDMNTHLAEVSRSHTSKLNTQVALHQLYQYAS 1803          
BLAST of plexin B-5 vs. Ensembl Medaka
Match: plxnb1a (plexin-B1 [Source:NCBI gene;Acc:101162124])

HSP 1 Score: 123.635 bits (309), Expect = 7.776e-28
Identity = 132/566 (23.32%), Postives = 238/566 (42.05%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVELN--CKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDK-----AIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDS-----MMSIGFSPVNKRNFQPNNDVAI----HLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKV--SDEEMANILSE-----------IVQKNQLYRY 3462
              N+L  K  L+++I  +E       +D+  +AS LT+ L    +YF ++LK L+  L+ E+Y          ++  + E+++  W SIC++  L+ +  GE F+ L+R IK + + G VD  + KAKY L+ + LL  D++Y+TL ++V +    +          ++ +   +L  D+I+Q+KEK++++     +  +   ++S+          +   +  A  LI         L D D TS+     K+   +NT +HY +  G  + L   +       S  + P  K     + D       HL    E     K+   + R+   +      R     + YL  L++ K +L   +D                           F  ++ST    P  ++              Y F L DE A+   I D + I++WK+N    + W N ++NP  IF +     V   L  I+    +SC +     G   D P+ K ++  DI     +  + +  I++ +  SD+EM + L+E           +V  N+LY+Y
Sbjct: 1670 LSNLLNSKLFLIKFIHTLEAQRTFSPRDRAYVASLLTVALHGKLEYFTDILKTLLNDLV-EQYVAKNPKLMLRRTESVVEKLLTNWMSICLYTFLRES-AGESFYMLFRAIKHQVDKGPVDAVTGKAKYTLNDNRLLREDVEYRTLTLNVVMPAADASGGS-----TVQTVPAKVLDCDTITQVKEKVLEQTWKGTSYSQRPHIDSLN---------LEWRAGVAGHLI---------LSDEDLTSVLQGSWKR---LNTLQHYKVPDGATVALVSRNNKHLLHDSHDYMPGEKTPMLDDGDEGGVRLWHLVKAGEEPEMQKHRRGSMRERGGE------RAKAIPEIYLTRLLSMKGTLQKFVDDL-------------------------FTAILSTSRPVPLAVK--------------YFFDLLDEQAQQHGITDAETIHIWKTNSLPLRFWINILKNPQFIFDVQTSDHVDAVLSVIAQTFMDSCTIADHKLG--RDSPINKLLYARDIPRYKQMVERYYTDIRQTISASDQEMNSALAELSRNYAPEVNCLVALNELYKY 2160          
BLAST of plexin B-5 vs. Ensembl Medaka
Match: PLXND1 (plexin D1 [Source:NCBI gene;Acc:101169698])

HSP 1 Score: 123.25 bits (308), Expect = 1.036e-27
Identity = 132/536 (24.63%), Postives = 230/536 (42.91%), Query Frame = 1
Query: 1852 FENILLKKHTLVQWIEKVEL--NCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLI-IEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQE--KVSDEEMANILSEIVQK 3444
            F  +L  KH L+ ++  +E   +  V+D+C LAS LT+ L    +Y+  ++K L+  LI     KN K      ++  + E+++  W SICM+  LK T +GE FF L   IK +   G +D  + KA+Y L+ + LL  +I+ +   I+V+ +              M+ ++V ++  D+I Q+KEKII+ A  +N       ++E               +     SN KI L D D+TS+     KK   +NT  HY +  G  L ++           V       + +  +HL +P++  F  ++   +   ++ K+L          + YL  L++TK +L   +D   ++I L  PP        P+                                ++ Y F   +E A    I D D +++WK+N    + W N ++NP  +F I     +   L  I+    ++C +  +  G   D P  K ++  +I          +  IQE   +S++EM   L+E  +K
Sbjct: 1387 FSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPK--LMLRRTESVVEKMLTNWMSICMYSYLKET-VGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQG-----------CGMDSLSVRVMHTDTICQVKEKIIE-AFYKNLPFSQWPRAED-----------VDLEWFDSGSNSKI-LQDLDNTSVMEDGRKK---LNTVFHYQVPEGASLAMSMKDKKDYTLERVKDL----DTEKYVHLVLPHDELF--ESSKGHRHSHRKKVL---------PEIYLTRLLSTKGTLQKFLDDLFKAI-LSIPPD-----CPPL--------------------------------AVKYFFDFLEEQADKRGITDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLG--KDSPTNKLLYAKEIPEYKKRVQCYYRQIQEMPPLSEQEMNAHLAEESRK 1837          
BLAST of plexin B-5 vs. Ensembl Medaka
Match: plxnb3 (plexin-B1-like [Source:NCBI gene;Acc:101165957])

HSP 1 Score: 118.242 bits (295), Expect = 2.925e-26
Identity = 126/534 (23.60%), Postives = 229/534 (42.88%), Query Frame = 1
Query: 1924 KDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIK-IQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNK-TKLLFNPIRENTNKDA----YLFMLMATKKSLLPLIDG-FIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIE---------MDLPLIKQM---FMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKS 3468
            +D+  +AS LT+ L    +YF EV+K L++ L+ ++Y          ++  + E+++  W SIC++  LK    GE  + LYR IK + + G VD  + KAK  L+  +LL  DIDY  + + V VK            +E++   V +L +D+I+Q+K+KI+D+ +   A       ++             +  L +       + L D D T+I     K+   +NT +HY +  G  + L   S  S G S V    FQ      + L+   E  F   +   ++ D +  K   + +RE     A    YL  L++ K +L   +D  F+  +   +PP        P+                                ++ + F   D++A+   I D D +++WK+N    + W N ++NP  +  + +  ++   L  I+    +SC       G +          ++P  KQ+   +  DI++  S  +Q   S   ++S    A+ ++ +V  ++LY+Y S
Sbjct: 1394 RDRGYVASLLTIALHDKLEYFTEVMKSLLQDLV-QQYVTKNPKLMLRRTETVVEKMLTNWMSICLYSFLKEV-AGEPLYMLYRAIKYQVDKGPVDAVTGKAKRTLNDSHLLREDIDYCAMTLTVLVKNG----------VEVQPCPVKVLDVDTITQVKDKILDQ-VYRGAPFSQRPAAD-------------SLDLEWRSGQAGHLTLSDDDVTAIVQGHWKR---LNTLQHYKVPDGATVALIPRSQSSGGISQV----FQTGEKTPM-LEGEEEEGFRLWHLVKSSEDPEIPKHRKSSMRERERAKAIPEIYLTRLLSMKGTLQKFVDDVFVAILNTKRPP--------PI--------------------------------AVRFFFDFLDDMAEKHGIDDPDTVHIWKTNSLPLRFWVNILKNPQFVLDVQITDSIDAILSVIAQTFIDSCTTSEHKVGRDSPVNKLLYAREIPRYKQLVERYYSDIRSAASGCYQEMNSYLTELSG-SFASEMNSVVALHELYKYIS 1852          
BLAST of plexin B-5 vs. Ensembl Medaka
Match: plxnb3 (plexin-B1-like [Source:NCBI gene;Acc:101165957])

HSP 1 Score: 118.242 bits (295), Expect = 2.925e-26
Identity = 126/534 (23.60%), Postives = 229/534 (42.88%), Query Frame = 1
Query: 1924 KDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIK-IQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNK-TKLLFNPIRENTNKDA----YLFMLMATKKSLLPLIDG-FIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIE---------MDLPLIKQM---FMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKS 3468
            +D+  +AS LT+ L    +YF EV+K L++ L+ ++Y          ++  + E+++  W SIC++  LK    GE  + LYR IK + + G VD  + KAK  L+  +LL  DIDY  + + V VK            +E++   V +L +D+I+Q+K+KI+D+ +   A       ++             +  L +       + L D D T+I     K+   +NT +HY +  G  + L   S  S G S V    FQ      + L+   E  F   +   ++ D +  K   + +RE     A    YL  L++ K +L   +D  F+  +   +PP        P+                                ++ + F   D++A+   I D D +++WK+N    + W N ++NP  +  + +  ++   L  I+    +SC       G +          ++P  KQ+   +  DI++  S  +Q   S   ++S    A+ ++ +V  ++LY+Y S
Sbjct: 1394 RDRGYVASLLTIALHDKLEYFTEVMKSLLQDLV-QQYVTKNPKLMLRRTETVVEKMLTNWMSICLYSFLKEV-AGEPLYMLYRAIKYQVDKGPVDAVTGKAKRTLNDSHLLREDIDYCAMTLTVLVKNG----------VEVQPCPVKVLDVDTITQVKDKILDQ-VYRGAPFSQRPAAD-------------SLDLEWRSGQAGHLTLSDDDVTAIVQGHWKR---LNTLQHYKVPDGATVALIPRSQSSGGISQV----FQTGEKTPM-LEGEEEEGFRLWHLVKSSEDPEIPKHRKSSMRERERAKAIPEIYLTRLLSMKGTLQKFVDDVFVAILNTKRPP--------PI--------------------------------AVRFFFDFLDDMAEKHGIDDPDTVHIWKTNSLPLRFWVNILKNPQFVLDVQITDSIDAILSVIAQTFIDSCTTSEHKVGRDSPVNKLLYAREIPRYKQLVERYYSDIRSAASGCYQEMNSYLTELSG-SFASEMNSVVALHELYKYIS 1852          
BLAST of plexin B-5 vs. Planmine SMEST
Match: SMESG000047160.1 (SMESG000047160.1)

HSP 1 Score: 1180.24 bits (3052), Expect = 0.000e+0
Identity = 589/620 (95.00%), Postives = 596/620 (96.13%), Query Frame = 1
Query: 1744 NIGLFTPRHFYSFNDFLSKL-------LNVDLILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISLKVLQMRSKTLLIEESSIGTLQSRKNLPLPNLDFKS 3582
            N  +F      SF+D   K+         V++ILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDK VLASYLTLYLMQYPKYFIEVLK+LMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMN EELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIK FIDK+CIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISLKVLQM SKTLLIEESSIGTLQSRKNLPLPNLDFKS
Sbjct:   52 NENIFINHRINSFHDAFEKIEYKDGKSWFVNIILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDKGVLASYLTLYLMQYPKYFIEVLKHLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNGEELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKCFIDKRCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISLKVLQMLSKTLLIEESSIGTLQSRKNLPLPNLDFKS 671          
BLAST of plexin B-5 vs. Planmine SMEST
Match: SMESG000047160.1 (SMESG000047160.1)

HSP 1 Score: 1178.7 bits (3048), Expect = 0.000e+0
Identity = 582/588 (98.98%), Postives = 584/588 (99.32%), Query Frame = 1
Query: 1819 ILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISLKVLQMRSKTLLIEESSIGTLQSRKNLPLPNLDFKS 3582
            ILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDK VLASYLTLYLMQYPKYFIEVLK+LMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMN EELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIK FIDK+CIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISLKVLQM SKTLLIEESSIGTLQSRKNLPLPNLDFKS
Sbjct:  153 ILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDKGVLASYLTLYLMQYPKYFIEVLKHLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNGEELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKCFIDKRCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISLKVLQMLSKTLLIEESSIGTLQSRKNLPLPNLDFKS 740          
BLAST of plexin B-5 vs. Planmine SMEST
Match: SMESG000047160.1 (SMESG000047160.1)

HSP 1 Score: 1154.04 bits (2984), Expect = 0.000e+0
Identity = 581/638 (91.07%), Postives = 588/638 (92.16%), Query Frame = 1
Query: 1744 NIGLFTPRHFYSFNDFLSKL-------LNVDLILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISLKVLQMRSKTLLIEESSIGTLQSRKNLPLPNLDFKS*TPKMRPKKSDDTMWCFD 3636
            N  +F      SF+D   K+         V++ILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDK VLASYLTLYLMQYPKYFIEVLK+LMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMN EELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIK FIDK+CIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISLKVLQM SKTLLIE                          MRPKKSDDTMWCFD
Sbjct:   52 NENIFINHRINSFHDAFEKIEYKDGKSWFVNIILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDKGVLASYLTLYLMQYPKYFIEVLKHLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNGEELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKCFIDKRCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISLKVLQMLSKTLLIE--------------------------MRPKKSDDTMWCFD 663          
BLAST of plexin B-5 vs. Planmine SMEST
Match: SMESG000047160.1 (SMESG000047160.1)

HSP 1 Score: 1152.12 bits (2979), Expect = 0.000e+0
Identity = 578/616 (93.83%), Postives = 581/616 (94.32%), Query Frame = 1
Query: 1798 KLLNVDL---ILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFIDKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISLKVLQMRSKTLLIEESSIGTLQSRKNLPLPNLDFKS*TPKMRPKKSDDTMWCFD 3636
            +LL V L   ILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDK VLASYLTLYLMQYPKYFIEVLK+LMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMN EELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIK FIDK+CIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISLKVLQM SKTLLIE                          MRPKKSDDTMWCFD
Sbjct:  149 RLLQVYLNIGILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDKGVLASYLTLYLMQYPKYFIEVLKHLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTLIIDVNVKVKISLMNGEELIIEMERINVTILSLDSISQIKEKIIDKAIMENAKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKCFIDKRCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIHLQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSLLPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEESQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFVRNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMFMDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISLKVLQMLSKTLLIE--------------------------MRPKKSDDTMWCFD 738          
BLAST of plexin B-5 vs. Planmine SMEST
Match: SMESG000033300.1 (SMESG000033300.1)

HSP 1 Score: 732.25 bits (1889), Expect = 0.000e+0
Identity = 371/388 (95.62%), Postives = 379/388 (97.68%), Query Frame = 1
Query: 1030 YTARICLSHHSENVPVKPAMGEHVFSCRKSNETGNECKNKSVYSCPIPCNLSLQTVKIGMKIYKFSYLSKPKFELAEKNLKYNSNGNLTIRSDASLRLLAADQINIDFSANVSCSRKYIQNYSIICALNVPTNSKTPENATVFIVYGKRCNAKIMLGFIHFIPQTSLFSRYKYAILFTLVSLIIWLAXXXXXXXXXXXXXXLLNEKMIENHLTELSTDFSNIQYKAFYEYQIAVQSFNNIGLFTPRHFYSFNDFLSKLLNVDLILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTE 2193
            Y ARICL+HHSENV V+ AMG++VFSCRKSNETGN+CKNKSVYSCPIPCNLSLQ VKI  KIYKFS++ KPKFELAEK+ KYNSNGNLTIRSDASLRLLAADQINIDFSANVSCSRKYIQNYSIICALNVPTNSKTPENATVFIVYGKRCNAKIMLGFIHFIPQTSLFSRYKYAILFTLVSLIIWLAVVVIYIKSIIYKKKLLNEKMIENHLTELSTDFSNIQYKAFYEYQIAVQSFNNIGLFTPRHFYSFNDFLSKLL VDLILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTE
Sbjct:   39 YAARICLNHHSENVSVETAMGDYVFSCRKSNETGNDCKNKSVYSCPIPCNLSLQNVKIESKIYKFSFVPKPKFELAEKDQKYNSNGNLTIRSDASLRLLAADQINIDFSANVSCSRKYIQNYSIICALNVPTNSKTPENATVFIVYGKRCNAKIMLGFIHFIPQTSLFSRYKYAILFTLVSLIIWLAVVVIYIKSIIYKKKLLNEKMIENHLTELSTDFSNIQYKAFYEYQIAVQSFNNIGLFTPRHFYSFNDFLSKLLKVDLILNENSFSCQDFENILLKKHTLVQWIEKVELNCKVKDKCVLASYLTLYLMQYPKYFIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLKTTNIGERFFNLYRGIKTKTE 426          
The following BLAST results are available for this feature:
BLAST of plexin B-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLXNB22.314e-3426.16plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104][more]
PLXNB22.314e-3426.16plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104][more]
PLXNB14.212e-2623.16plexin B1 [Source:HGNC Symbol;Acc:HGNC:9103][more]
PLXNB17.035e-2622.63plexin B1 [Source:HGNC Symbol;Acc:HGNC:9103][more]
PLXNB17.035e-2622.63plexin B1 [Source:HGNC Symbol;Acc:HGNC:9103][more]
back to top
BLAST of plexin B-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plx-16.475e-3024.06PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-11.413e-2924.18PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-11.796e-2924.18PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-11.357e-1927.19PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-13.454e-1927.41PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
back to top
BLAST of plexin B-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PlexB3.215e-2823.96gene:FBgn0025740 transcript:FBtr0308297[more]
PlexB3.215e-2823.96gene:FBgn0025740 transcript:FBtr0089179[more]
PlexA3.164e-2222.76gene:FBgn0025741 transcript:FBtr0309865[more]
PlexA4.185e-2121.95gene:FBgn0025741 transcript:FBtr0089223[more]
PlexA6.207e-2121.95gene:FBgn0025741 transcript:FBtr0089224[more]
back to top
BLAST of plexin B-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plxnb1a4.571e-3025.04plexin b1a [Source:ZFIN;Acc:ZDB-GENE-050302-63][more]
plxnb2a2.269e-2825.00plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917][more]
plxnb2a3.384e-2825.17plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917][more]
plxnb2a3.384e-2825.17plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917][more]
plxnb2a4.249e-2825.17plexin b2a [Source:ZFIN;Acc:ZDB-GENE-030131-8917][more]
back to top
BLAST of plexin B-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLXNB21.377e-3124.56plexin B2 [Source:NCBI gene;Acc:550076][more]
PLXNB21.397e-3124.91plexin B2 [Source:NCBI gene;Acc:550076][more]
PLXNB21.547e-3124.91plexin B2 [Source:NCBI gene;Acc:550076][more]
PLXNB21.639e-3124.91plexin B2 [Source:NCBI gene;Acc:550076][more]
PLXNB21.956e-3124.56plexin B2 [Source:NCBI gene;Acc:550076][more]
back to top
BLAST of plexin B-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plxnb24.444e-3426.51plexin B2 [Source:MGI Symbol;Acc:MGI:2154239][more]
Plxnb24.444e-3426.51plexin B2 [Source:MGI Symbol;Acc:MGI:2154239][more]
Plxnb11.213e-2623.37plexin B1 [Source:MGI Symbol;Acc:MGI:2154238][more]
Plxna11.127e-2525.49plexin A1 [Source:MGI Symbol;Acc:MGI:107685][more]
Plxna11.127e-2525.49plexin A1 [Source:MGI Symbol;Acc:MGI:107685][more]
back to top
BLAST of plexin B-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O15031|PLXB2_HUMAN1.111e-3326.16Plexin-B2 OS=Homo sapiens OX=9606 GN=PLXNB2 PE=1 S... [more]
sp|B2RXS4|PLXB2_MOUSE3.109e-3326.51Plexin-B2 OS=Mus musculus OX=10090 GN=Plxnb2 PE=1 ... [more]
sp|Q9V4A7|PLXB_DROME3.222e-2723.96Plexin-B OS=Drosophila melanogaster OX=7227 GN=Ple... [more]
sp|Q8CJH3|PLXB1_MOUSE8.484e-2623.37Plexin-B1 OS=Mus musculus OX=10090 GN=Plxnb1 PE=1 ... [more]
sp|O43157|PLXB1_HUMAN3.379e-2522.63Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 S... [more]
back to top
BLAST of plexin B-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K0LJ040.000e+098.93Plexin B-5 (Fragment) OS=Schmidtea mediterranea OX... [more]
A0A0K0LJ738.420e-6935.44Plexin B-4 (Fragment) OS=Schmidtea mediterranea OX... [more]
A0A2K5I0Q98.136e-3326.16Plexin_cytopl domain-containing protein OS=Colobus... [more]
A0A2K6KJ839.114e-3325.98Plexin B2 OS=Rhinopithecus bieti OX=61621 GN=PLXNB... [more]
A0A2K5LGS11.141e-3225.75Plexin B2 OS=Cercocebus atys OX=9531 GN=PLXNB2 PE=... [more]
back to top
BLAST of plexin B-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plxnb1a1.439e-2623.74plexin b1a [Source:ZFIN;Acc:ZDB-GENE-050302-63][more]
PLXND11.548e-2625.60plexin D1 [Source:HGNC Symbol;Acc:HGNC:9107][more]
plxnb1b1.731e-2622.95plexin b1b [Source:ZFIN;Acc:ZDB-GENE-090812-4][more]
plxna1a2.840e-2624.69plexin-A1-like [Source:NCBI gene;Acc:103026658][more]
plxna1a4.136e-2624.69plexin-A1-like [Source:NCBI gene;Acc:103026658][more]
back to top
BLAST of plexin B-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009284.16.726e-1928.20pep scaffold:Pmarinus_7.0:GL476385:264710:288126:-... [more]
ENSPMAT00000006876.13.984e-1335.29pep scaffold:Pmarinus_7.0:GL486582:611:5415:1 gene... [more]
ENSPMAT00000007728.11.147e-1029.01pep scaffold:Pmarinus_7.0:GL483331:9686:16681:-1 g... [more]
ENSPMAT00000004433.17.238e-922.38pep scaffold:Pmarinus_7.0:GL481384:28210:40565:1 g... [more]
ENSPMAT00000006110.16.489e-829.13pep scaffold:Pmarinus_7.0:GL484765:748:3341:1 gene... [more]
back to top
BLAST of plexin B-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of plexin B-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO390091.736e-2922.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of plexin B-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plxnb2b1.872e-2825.84plexin-B2 [Source:NCBI gene;Acc:101169201][more]
plxnb1a7.776e-2823.32plexin-B1 [Source:NCBI gene;Acc:101162124][more]
PLXND11.036e-2724.63plexin D1 [Source:NCBI gene;Acc:101169698][more]
plxnb32.925e-2623.60plexin-B1-like [Source:NCBI gene;Acc:101165957][more]
plxnb32.925e-2623.60plexin-B1-like [Source:NCBI gene;Acc:101165957][more]
back to top
BLAST of plexin B-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047160.10.000e+095.00SMESG000047160.1[more]
SMESG000047160.10.000e+098.98SMESG000047160.1[more]
SMESG000047160.10.000e+091.07SMESG000047160.1[more]
SMESG000047160.10.000e+093.83SMESG000047160.1[more]
SMESG000033300.10.000e+095.62SMESG000033300.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014448
GenBankAJA72715.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014448 ID=SMED30014448|Name=plexin B-5|organism=Schmidtea mediterranea sexual|type=transcript|length=3733bp
TTATTGAATTTAGACACAAATTAACACATTTGTAATAAATACTAAATATG
AAATAATTTAACAAAATCAGTAATTGCACAAAATAACAGTAAAATAATAC
AAATATGATTTAATAAGCCTTTGGTTCTAGTTTTCCTCATTTAACTTCTT
TAACTTATTTGTTACCATATATTCTGAAGATACGGATGATACATCTATCA
AGTATAACCAAAATTTTGAGATGTGAATGAGGAGCATGATGAAAGATATT
TTGTTATGAGTATGGACTATAGAACGTGTTTTCTTTCATTCGAAACTATC
ACGGTTTTTATATTTACCGTTTATATAAGGTAATTTAGACATATTCCGGT
TAATATCGTTGACAGCTTATAAAGAATGTTAAGAAAAATTAAAGGAGCTT
GAGCGGACTTCCCGTTTACAGAAAATATAGCTAAGTCCGCCCATGACAAT
ATATTATATATTTAAATAGGAAACGCAAAAACAATTAAAGTGGAAGTCAA
AACGCACATTAGTGACTGAATGCAAAAAATAAATGAGCGTTTTATTTTAC
AAAACAATCGCAATATAGCGACTTCGTTCTCGCGGCGAGCGAAGCGAACA
AAAATTCCTCTTGAAATTTAAAAATGTATAATTTTCATAAATATTGTAAG
TTTTCGATTGAAAATAAAATCAAAAAAAATTATATTTTTTAGTGTTTAAT
AAAAATTGTGATTGTGCGTTATTTCACTGGTAAAATATCTCGAATGTTAT
GATGTAATATCAATGTTTATTTTTTCAATTTCAACGTGGAATACAATTTA
TTTACGAATTTATTTTGAATTTCATTGGTTAATAATCACAGTTTATGAAA
TGTTTCAATTTCATATTAACCTTTCAAGTGATTTACTGAAATTAGAATTT
CATGAAATTTGTTTATAATTCTTTATCAAAAATATGCTCAATTCTTTGCA
TTTGAAATTTGTTCTCGTTTTTATCTTTGTTGCAAATTCAATATCCGAAG
AAGAAATCAAAATTATAGAAGGGGGAGGATATACTGCAAGGATTTGTTTA
AGTCATCATTCGGAAAATGTGCCTGTCAAGCCGGCAATGGGAGAACATGT
TTTTAGTTGTAGGAAATCAAATGAAACTGGAAATGAATGTAAAAATAAAT
CGGTTTATTCATGTCCAATACCTTGCAATTTATCACTGCAAACTGTAAAG
ATTGGCATGAAAATATATAAATTCTCATATTTGTCTAAACCAAAGTTTGA
ATTAGCAGAAAAAAACCTAAAATATAATTCAAATGGTAATTTGACTATTA
GAAGTGATGCCAGTTTGCGTCTGTTAGCAGCGGATCAGATCAATATTGAT
TTCTCTGCAAATGTCTCCTGTTCAAGGAAATACATTCAAAATTATTCAAT
AATTTGTGCTCTGAATGTTCCGACGAACTCAAAGACGCCAGAAAATGCCA
CTGTATTTATAGTATATGGGAAACGTTGCAATGCAAAAATAATGCTAGGA
TTCATTCACTTCATTCCTCAAACTTCTTTATTTAGTCGTTATAAATATGC
GATTTTATTCACATTGGTTTCCCTTATAATATGGCTAGCTGTTGTAGTTA
TCTATATAAAAAGTATAATCTATAAGAAAAAGTTATTAAATGAGAAAATG
ATAGAAAATCATTTAACTGAACTTTCCACTGACTTTTCAAATATTCAATA
CAAAGCATTTTATGAATATCAAATTGCTGTCCAGTCTTTTAATAATATCG
GTTTATTCACTCCAAGACATTTTTATTCATTTAATGATTTCTTGTCGAAG
CTTTTGAACGTGGATTTGATCTTAAATGAAAATAGTTTTAGTTGCCAAGA
TTTTGAAAATATTCTTTTGAAGAAACATACTCTTGTGCAATGGATCGAAA
AGGTTGAATTAAACTGTAAAGTGAAAGACAAATGCGTTTTGGCATCATAT
TTGACACTGTATTTGATGCAATATCCGAAGTACTTTATAGAAGTTTTGAA
GTATTTGATGAGACAGCTCATTATTGAAAAATATAAAAATTACAAAGAAG
GATCACAAACTTTAAAATCAAGCATGATCAGTGAAAGAATTATTGGATAT
TGGGGCTCAATATGCATGCATGATAATTTAAAAACAACCAACATAGGAGA
AAGATTTTTTAACTTATATCGAGGAATCAAAACTAAAACTGAGTCAGGAC
TAGTTGACTGTTTTAGTTCGAAGGCCAAATATGCTTTATCATTTGATAAT
TTATTACTTGGTGACATAGATTATCAAACACTGATAATCGATGTCAATGT
AAAAGTTAAAATTTCTTTGATGAACAGGGAAGAATTAATAATTGAAATGG
AAAGAATTAATGTGACTATTCTGTCTTTAGACAGTATCTCTCAAATAAAA
GAAAAGATTATTGATAAGGCAATAATGGAAAACGCAAAATTGGAAAGTAT
AACCAAAAGTGAGGGTGACCCTTGTCCATGTATTGCTCCGATTTCACATA
GTGCTTTTAAATTAATTTTTATAAAGAGTAATATAAAAATTCAATTGGAC
GATTTTGACGACACCAGCATCAAGTCTTTCATTGACAAAAAGTGTATCAT
TATAAATACGGCAAAGCACTATAATATCAAAAGTGGGACAAAACTTCTGC
TTACTCAAGATAGCATGATGTCAATTGGGTTTTCTCCAGTTAATAAACGA
AATTTTCAACCAAACAATGACGTTGCTATCCATTTACAAATTCCAAACGA
AACAAATTTTGGTAACAAAAATGAATCTAACAATGCTAGAGATAATAAAA
CAAAACTTTTGTTTAATCCAATTAGAGAAAATACAAATAAAGACGCTTAC
TTATTTATGCTAATGGCTACAAAGAAAAGTTTATTACCTTTGATTGATGG
CTTCATTCAATCAATCACACTTTGGAAGCCGCCTTCTGAGAATTATAATA
CGTTTTCTCCTATGTCTAATACAAATTCTTTCGAAGAATTAATTAGTACA
GATTTGTCTACCCCCACTCAAATTGAAGAAGAATCTCAATTGAATCTCAC
TAATATGAAATCCATCTTCTATATATTTTCTCTCTACGACGAAATCGCTA
AATCTCTTTTTATTTTTGACACTGACTTAATTAATTTATGGAAAAGTAAT
TGTTATATTCATCAAGTTTGGTCAAATTTTGTGAGAAATCCGGACCTTAT
ATTTCCAATAACTGTGGAGTCGGCAGTTCGAGGCAGTTTGGAAACGATTT
CTCATATTTTGAAAGAGTCTTGTCATGTCGAATCTATTTATTCGGGAATC
GAAATGGATTTACCACTTATCAAACAAATGTTTATGGATGATATAAAGAA
CAAATATTCTCTGTGGTGGCAAACATTTGTTAGCATTCAGGAAAAGGTCT
CGGATGAAGAAATGGCAAATATTTTATCTGAAATCGTGCAGAAAAATCAA
TTGTATCGTTACAAATCAATTTCTCTGAAGGTGCTACAAATGCGTTCTAA
AACTCTTTTAATAGAAGAATCATCTATTGGAACTCTTCAAAGTCGGAAAA
ATTTACCTCTTCCAAATTTAGATTTCAAATCTTAAACTCCAAAAATGAGA
CCAAAGAAATCGGACGACACCATGTGGTGCTTTGACTAAATGAATATACT
TCATTTTTTTCATTAAACTATCAATTTGCATGACTTAATAGTTTATGTTT
TCGATTTTCTAATACAAATAACTGTGACTAGCA
back to top

protein sequence of SMED30014448-orf-1

>SMED30014448-orf-1 ID=SMED30014448-orf-1|Name=SMED30014448-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=884bp
MLNSLHLKFVLVFIFVANSISEEEIKIIEGGGYTARICLSHHSENVPVKP
AMGEHVFSCRKSNETGNECKNKSVYSCPIPCNLSLQTVKIGMKIYKFSYL
SKPKFELAEKNLKYNSNGNLTIRSDASLRLLAADQINIDFSANVSCSRKY
IQNYSIICALNVPTNSKTPENATVFIVYGKRCNAKIMLGFIHFIPQTSLF
SRYKYAILFTLVSLIIWLAVVVIYIKSIIYKKKLLNEKMIENHLTELSTD
FSNIQYKAFYEYQIAVQSFNNIGLFTPRHFYSFNDFLSKLLNVDLILNEN
SFSCQDFENILLKKHTLVQWIEKVELNCKVKDKCVLASYLTLYLMQYPKY
FIEVLKYLMRQLIIEKYKNYKEGSQTLKSSMISERIIGYWGSICMHDNLK
TTNIGERFFNLYRGIKTKTESGLVDCFSSKAKYALSFDNLLLGDIDYQTL
IIDVNVKVKISLMNREELIIEMERINVTILSLDSISQIKEKIIDKAIMEN
AKLESITKSEGDPCPCIAPISHSAFKLIFIKSNIKIQLDDFDDTSIKSFI
DKKCIIINTAKHYNIKSGTKLLLTQDSMMSIGFSPVNKRNFQPNNDVAIH
LQIPNETNFGNKNESNNARDNKTKLLFNPIRENTNKDAYLFMLMATKKSL
LPLIDGFIQSITLWKPPSENYNTFSPMSNTNSFEELISTDLSTPTQIEEE
SQLNLTNMKSIFYIFSLYDEIAKSLFIFDTDLINLWKSNCYIHQVWSNFV
RNPDLIFPITVESAVRGSLETISHILKESCHVESIYSGIEMDLPLIKQMF
MDDIKNKYSLWWQTFVSIQEKVSDEEMANILSEIVQKNQLYRYKSISLKV
LQMRSKTLLIEESSIGTLQSRKNLPLPNLDFKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013548Plexin_cytoplasmic_RasGAP_dom
Vocabulary: molecular function
TermDefinition
GO:0017154semaphorin receptor activity
Vocabulary: biological process
TermDefinition
GO:0071526semaphorin-plexin signaling pathway