SMEDWI-2

Overview
NameSMEDWI-2 (Q2Q5Y8)
Smed IDSMED30014446
Length (bp)4773
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMEDWI-2 (SMED30014446) t-SNE clustered cells

Violin plots show distribution of expression levels for SMEDWI-2 (SMED30014446) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMEDWI-2 (SMED30014446) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMEDWI-2 (SMED30014446) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

SMEDWI-2 ( piwi-2 ) is expressed during Stage 2, Stage 3, Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the neoblast and blastomere

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-2.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and piwi-2 (green). piwi-1+ blastomeres co-express the nuage factor piwi-2, and virtually all piwi-2+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (green). 

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-2.

SPIM reconstructed S3 embryo costained with piwi-1 (green) and piwi-2 (red). piwi-1+ blastomeres co-express the nuage factor piwi-2, and virtually all piwi-2+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (green).

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-2.

SPIM reconstructed S5 embryo costained with piwi-1 (green) and piwi-2 (red). piwi-1+ blastomeres co-express the nuage factor piwi-2, and virtually all piwi-2+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (green).

Anatomical Expression

PAGE et. al., 2020




SMED30014446

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 57

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014446SMESG000069984.1 SMESG000069981.1 SmedASXL_018810SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014446SMESG000069984.1 SMESG000069981.1 SmedASXL_018810SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014446SMESG000041410.1 Contig4660GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014446SMESG000069984.1 SMESG000069981.1 Contig34872uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014446SMESG000069984.1 SMESG000069981.1 Contig34872newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014446SMESG000069984.1 Contig38044uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014446SMESG000069984.1 Contig38044newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014446SMESG000069984.1 SMESG000069981.1 Contig42028uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014446SMESG000069984.1 SMESG000069981.1 Contig42028newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014446SMESG000069984.1 Contig4660GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
cephalic gangliaSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:21806978
Iglesias et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30014446SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
neoblastSMED30014446SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
neoblastSMED30014446SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
blastomereSMED30014446SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
blastomereSMED30014446SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
blastomereSMED30014446SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 fluorescence in situ hybridization evidence
blastomereSMED30014446SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
blastomereSMED30014446SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
blastomereSMED30014446SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 fluorescence in situ hybridization evidence
blastomereSMED30014446SMESG000069984.1 SMESG000069981.1 SMED30014446smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 fluorescence in situ hybridization evidence
neoblastSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
neoblastSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
neoblastSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
blastomereSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 fluorescence in situ hybridization evidence
blastomereSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
blastomereSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 fluorescence in situ hybridization evidence
blastomereSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
blastomereSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
blastomereSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 fluorescence in situ hybridization evidence
blastomereSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986.1smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
neoblastSMED30014446SMESG000069984.1 SMESG000069981.1 DQ186986smed_ncbi_20200123PMID:16311336
Reddien et al., 2005
whole organism asexual adult colorimetric in situ hybridization evidence
central nervous systemSMED30014446SMESG000069981.1 SMESG000069984.1 DN303300ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30014446SMESG000069981.1 SMESG000069984.1 DN303300ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
neoblastSMED30014446SMESG000069981.1 SMESG000069984.1 DN303300ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
pharynx musculatureSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v4_756_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30014446SMESG000069984.1 SMESG000069981.1 isotig05155be_Smed_v2PMID:22543868
Onal et al., 2012
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30014446SMESG000069984.1 SMESG000069981.1 dd_Smed_v6_756_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014446SMESG000069984.1 SMESG000069981.1 SmWIOct06_100030GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30014446SMESG000069984.1 SMESG000069981.1 SmWIOct06_100032GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30014446SMESG000069984.1 SMESG000069981.1 SmWIOct06_100031GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMEDWI-2 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 259.61 bits (662), Expect = 2.024e-71
Identity = 219/847 (25.86%), Postives = 392/847 (46.28%), Query Frame = 1
Query:   85 MGNRGGLRRTFRIVEPNL-QPADITE--KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSH----DEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            +  RGG RR F  +  N  Q  D  +  KTG+ G  V+L +N   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++   +   + FS     ++ ++T+ L + + P +    Q  N++   L  ++  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++++YN  +T   QP ++++ K+                                 + IP ELC+L G +D+ +++ ++ K+L    +  P +R  ++    ++I  +D        W L  D+  L   GR L    +  GG   +      DW        +   +  +  ++I  R +++  N  + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +G     P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:   76 LAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTN--HFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQ-QKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGP---------------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          
BLAST of SMEDWI-2 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 259.61 bits (662), Expect = 2.024e-71
Identity = 219/847 (25.86%), Postives = 392/847 (46.28%), Query Frame = 1
Query:   85 MGNRGGLRRTFRIVEPNL-QPADITE--KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSH----DEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            +  RGG RR F  +  N  Q  D  +  KTG+ G  V+L +N   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++   +   + FS     ++ ++T+ L + + P +    Q  N++   L  ++  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++++YN  +T   QP ++++ K+                                 + IP ELC+L G +D+ +++ ++ K+L    +  P +R  ++    ++I  +D        W L  D+  L   GR L    +  GG   +      DW        +   +  +  ++I  R +++  N  + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +G     P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:   76 LAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTN--HFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQ-QKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGP---------------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          
BLAST of SMEDWI-2 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 224.942 bits (572), Expect = 4.797e-60
Identity = 204/817 (24.97%), Postives = 359/817 (43.94%), Query Frame = 1
Query:   85 MGNRGGLRRTFRIVEPNL-QPADITE--KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSH----DEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSK-------------------INEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNW 2400
            +  RGG RR F  +  N  Q  D  +  KTG+ G  V+L +N   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++   +   + FS     ++ ++T+ L + + P +    Q  N++   L  ++  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++++YN  +T   QP ++++ K+                                 + IP ELC+L G +D+ +++ ++ K+L    +  P +R  ++    ++I  +D        W L  D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    M    ++   + +D R             R L     + +      L     D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +G     P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW
Sbjct:   76 LAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTN--HFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQ-QKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGP---------------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGMQMRKAIMIEVDDRT--------EAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNW 822          
BLAST of SMEDWI-2 vs. Ensembl Human
Match: PIWIL4 (piwi like RNA-mediated gene silencing 4 [Source:HGNC Symbol;Acc:HGNC:18444])

HSP 1 Score: 206.453 bits (524), Expect = 6.203e-54
Identity = 198/823 (24.06%), Postives = 357/823 (43.38%), Query Frame = 1
Query:  160 KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQ-ENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEK-----KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERIN-RVLNDNSVMK------------AYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEM-GGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDW-KFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTC--GPNDVERCLNDAARSGSGCAKMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKK-SIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            KTG+ G  VKL +N       +  +   Y   +     S ++++  +    +  NK   A  FDG  LF S+K   E  + E S + +     KMT+ L   +   +    Q+ N++   +   L   +IG+ ++             S P     +   +  GF  ++    +       LL+   ++ +VL + +V++             + +    QLIG  ++T+YNN+TY I +I   +     F+   G  ++Y +Y+K++Y+I ++  +QP +++ +KK      + +                          IP ELCFL G +DQ  S+  L K +    +  P  R   +    + I+ +  A      W L   ++ + + GR +P   ++            DW K  R    +     +   ++  DR ++  ++F+N + +   +M  +    K+      P    R +           ++ +  +P ++   Y  +K +  S   + +QCV  R  T         +++K  MQ+  K G + W VEI L+  M+VG+D   +  SK   +   V S+N   T++ S     +   +  + L      AL  + K    LP RI+V+R GVGD QL+    +EV     L+ ++ + +     ++  ++V+K+   + F   N    NP  GTVVD E  +  +Y+F+L+SQ   +GT +PT YNV+ D          + + P+ +Q++T+ L HLY+NW G + VP P  YAH+L  LV + +HK       +  + N LFYL
Sbjct:   98 KTGSSGIPVKLVTNLFNLDFPQDWQLYQYHVTYIPDLASRRLRIALLYSHSELSNK---AKAFDGAILFLSQKL--EEKVTELSSETQRGETIKMTITLKRELPSSSPVCIQVFNIIFRKILKKLSMYQIGRNFY-----------NPSEPMEIPQHKLSLWPGFAISVSYFER------KLLFSADVSYKVLRNETVLEFMTALCQRTGLSCFTQTCEKQLIGLIVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLLKKKRNDNSEAQLAHL----------------------IP-ELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDNIQRNTNARFELETWGLHFGSQ-ISLTGRIVPSEKILMQDHICQPVSAADWSKDIRTCKILNAQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYVDPD---VQLVMCILPSNQKTYYDSIKKYLSSDCPVPSQCVLAR--TLNKQGMMMSIATKIAMQMTCKLGGELWAVEIPLKSLMVVGIDVCKDALSKDVMVVGCVASVNPRITRWFSRCILQRTMTDVADCLKVFMTGALNKWYKYNHDLPARIIVYRAGVGDGQLKTLIEYEVPQ---LLSSVAESSSNTSSRLSVIVVRKKCMPRFFTEMNRTVQNPPLGTVVDSEATRNEWYDFYLISQVACRGTVSPTYYNVIYDD---------NGLKPDHMQRLTFKLCHLYYNWPGIVSVPAPCQYAHKLTFLVAQSIHKEP-----SLELANHLFYL 852          
BLAST of SMEDWI-2 vs. Ensembl Human
Match: PIWIL3 (piwi like RNA-mediated gene silencing 3 [Source:HGNC Symbol;Acc:HGNC:18443])

HSP 1 Score: 203.756 bits (517), Expect = 1.679e-53
Identity = 144/504 (28.57%), Postives = 240/504 (47.62%), Query Frame = 1
Query: 1057 LNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRND----FQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDD--RVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            L IP +LC + G +D+   +  + K L    +  PR R   +  + N ++++     +   W LK D   L + GR L   +++ G   +      DW     +  +         +++  R+        K  +  V   +      A + +V+     D    ++   +      +M +  +P+D  R Y  +K +  +   + +QCV  +  T    + R +V+ K   Q+  K G   W VE  ++ TM VG+D +H+  + +KSI   V S N+  T++ S     K  +E  + L      AL+ + K    +P  ++V+RDGVGD QLQ   + E   M   ++ I   N      + +++VKKR+ T+ F +      NP PGTV+D E+ +  +Y+FF+VSQ    GT TPT+YNV+ DT           ++P+ +Q++TY L H+Y+N  G IRVP P HYAH+LA LVG+ +H+       N  +  RLFYL
Sbjct:  287 LLIP-QLCHMTGLTDEICKDYSIVKELAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQGRRMVKANSQGDWSREIRELPLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITMKPAEMIEVD----GDANSYIDTLRKYTRPTLQMVICILPNDDKRRYDSIKRYLCTKCPIPSQCVVKK--TLEKVQARTIVT-KIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIVNRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHSVIVYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNF----TLAFIVVKKRINTRFFLKHGSNFQNPPPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDT---------IGLSPDTVQRLTYCLCHMYYNLPGIIRVPAPCHYAHKLAYLVGQSIHQEP-----NRSLSTRLFYL 764          
BLAST of SMEDWI-2 vs. Ensembl Celegans
Match: prg-1 (Piwi-like protein [Source:UniProtKB/TrEMBL;Acc:P90786])

HSP 1 Score: 196.823 bits (499), Expect = 2.675e-51
Identity = 164/617 (26.58%), Postives = 279/617 (45.22%), Query Frame = 1
Query:  772 GRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVI---VDRNDFQYKNFMNDVEQELRNMRI---DARVGKVNTCGPNDVERCLNDAARSGSG-CAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRN--GTNRNDKRRKVVSS---KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYD-ILPQRILVFRDGVGDNQLQFTKNFEV----DAMKPLIENIYKGNGFPVPQI--IYVIVKKRVGTKLFNRGN------NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            G  IIT+YNNK +R + +   ++   +F   G++++  EYFK +Y I +T  DQP +++  K     E  +                           I  ELCF  G +D+ + +  + K +    +  P++RL +       +  ++        W + +      ++ R L    +   G K  E    +W  G  +  I R       +VI      +    + F+ +  +  + +++   +     +    PND    +  A +   G    M +V + DD    Y  +K F  +   +  QCV  R   G +++    K + S   K V+Q+  K G   W V I L+ TMIVG D YH+ + K K++ A V + ++ FTQ+ S     +   +    L      AL+ +    D  LP R++++RDG GD Q+ + KN EV    DA   + +   + +     +I   ++IV KRV  ++  +G+      NP PGTVVD  + +P   +F+LV Q   +GT TP +YN++ D   L          P++ Q++ + L HLY+NW GT+RVP P  YAH+LA L  + +H  +N       +R++LF+L
Sbjct:  248 GTTIITRYNNKLHRYTRLDYSISPLSEFVKDGQSITLKEYFKNQYGIEITVDDQPIIISEGKPKQPGEPPQVSY------------------------IVPELCFPTGLTDEMRKDFKMMKEIAKHTRMSPQQRLVESRKLIVDLSKNEKVMECFKYWGISLGQDLANVQARVLKSEPL--QGKKTYEGKQAEWARGVKECGIYRGSNMTNWIVIGPGSGNSGLLSQKFIEEARRLGKILQVQLGEPMCVPIRGISPNDYLEGVKGAIKQVDGEDIHMLVVMLADDNKTRYDSLKKFLCVECPIPNQCVNLRTLAGKSKDGGENKNLGSIVLKIVLQMICKTGGALWKVNIPLKNTMIVGYDLYHDSTLKGKTVGACVSTTSNDFTQFYSQTRPHENPTQLGNNLTHFVRKALKQYYDSNDQTLPSRLILYRDGAGDGQIPYIKNTEVKLVRDACDAVTDKAAELSNKVQEKIKLAFIIVTKRVNMRILKQGSSLDNAINPQPGTVVDTTVTRPERMDFYLVPQFVNQGTVTPVSYNIIHDDTDL---------GPDKHQQLAFKLCHLYYNWQGTVRVPAPCQYAHKLAFLTAQSLHDDANGC-----LRDKLFFL 824          
BLAST of SMEDWI-2 vs. Ensembl Celegans
Match: alg-1 (pep chromosome:WBcel235:X:13951262:13956261:1 gene:WBGene00000105.1 transcript:F48F7.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-1)

HSP 1 Score: 120.939 bits (302), Expect = 3.401e-27
Identity = 130/516 (25.19%), Postives = 220/516 (42.64%), Query Frame = 1
Query: 1063 IPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSD-AATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDD--WKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKV-NTC------GPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMST-GLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRP------TMIVGMDTYH---NKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA-----ELVGKVH---KGSNPVAINE 2502
            +PG+ C +   +D + S M     +    +  P ER  +I    N ++ ++ +A    +++ + I+    E++GR L    ++ GG      + +   W     QF    D +         +   + +N +     +L+ +  DA +  V N C      G   VE       ++ SG   + +V      VYA+VK    +  G+ TQCV  +N      +      S   +++  K G     +   +RP       +  G D  H     S K SI A V S+++  ++Y + V   + RQE    L       L  F +     P RI+V+RDGV + Q      +E+ A++     + +G     P I ++ V+KR  T+LF         +  N  PGT VD  I  P  ++F+L S    +GT+ P++Y+VL D   LT          +ELQ++TY + H Y     ++ +P P +YAH +A      LV + H   +GS P   +E
Sbjct:  490 VPGQRC-IKKLTDVQTSTM-----IKATARSAP-EREREI---SNLVRKAEFSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRTRATALPNQGVWDMRGKQFHTGIDVRVWAIACFAQQQHVK-ENDLRMFTNQLQRISNDAGMPIVGNPCFCKYAVGVEQVEPMFKYLKQNYSGIQLVVVVLPGKTPVYAEVKRVGDTVLGIATQCVQAKNAIRTTPQ----TLSNLCLKMNVKLGGVNSILLPNVRPRIFNEPVIFFGCDITHPPAGDSRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIISDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQFFNVLQYELRAIREACMMLERGYQ---PGITFIAVQKRHHTRLFAVDKKDQVGKAYNIPPGTTVDVGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNNLTA---------DELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDREHDSGEGSQPSGTSE 978          
BLAST of SMEDWI-2 vs. Ensembl Celegans
Match: alg-1 (pep chromosome:WBcel235:X:13949114:13956261:1 gene:WBGene00000105.1 transcript:F48F7.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-1)

HSP 1 Score: 120.939 bits (302), Expect = 3.823e-27
Identity = 130/516 (25.19%), Postives = 220/516 (42.64%), Query Frame = 1
Query: 1063 IPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSD-AATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDD--WKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKV-NTC------GPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMST-GLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRP------TMIVGMDTYH---NKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA-----ELVGKVH---KGSNPVAINE 2502
            +PG+ C +   +D + S M     +    +  P ER  +I    N ++ ++ +A    +++ + I+    E++GR L    ++ GG      + +   W     QF    D +         +   + +N +     +L+ +  DA +  V N C      G   VE       ++ SG   + +V      VYA+VK    +  G+ TQCV  +N      +      S   +++  K G     +   +RP       +  G D  H     S K SI A V S+++  ++Y + V   + RQE    L       L  F +     P RI+V+RDGV + Q      +E+ A++     + +G     P I ++ V+KR  T+LF         +  N  PGT VD  I  P  ++F+L S    +GT+ P++Y+VL D   LT          +ELQ++TY + H Y     ++ +P P +YAH +A      LV + H   +GS P   +E
Sbjct:  511 VPGQRC-IKKLTDVQTSTM-----IKATARSAP-EREREI---SNLVRKAEFSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRTRATALPNQGVWDMRGKQFHTGIDVRVWAIACFAQQQHVK-ENDLRMFTNQLQRISNDAGMPIVGNPCFCKYAVGVEQVEPMFKYLKQNYSGIQLVVVVLPGKTPVYAEVKRVGDTVLGIATQCVQAKNAIRTTPQ----TLSNLCLKMNVKLGGVNSILLPNVRPRIFNEPVIFFGCDITHPPAGDSRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIISDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQFFNVLQYELRAIREACMMLERGYQ---PGITFIAVQKRHHTRLFAVDKKDQVGKAYNIPPGTTVDVGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNNLTA---------DELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDREHDSGEGSQPSGTSE 999          
BLAST of SMEDWI-2 vs. Ensembl Celegans
Match: alg-2 (pep chromosome:WBcel235:II:874160:879001:1 gene:WBGene00000106.1 transcript:T07D3.7b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-2)

HSP 1 Score: 119.398 bits (298), Expect = 9.913e-27
Identity = 127/516 (24.61%), Postives = 222/516 (43.02%), Query Frame = 1
Query: 1063 IPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSD-AATGMCNKWQLKIDNKPLEIEGRELPPCDVISGG-SKINEKMGDD--WKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNT-------CGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMST-GLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRP------TMIVGMDTYHNKSS---KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKP---LIENIYKGNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA-----ELVGKVH----KGSNP 2487
            +PG+ C L   +D + S M     +    +  P ER  +I   C  +  ++ +A    +++ + I+    E++GR L    ++ GG  +    + +   W     QF    + +         ++  + +N +     +L+ +  DA +  + T        G   VE       ++ S    + +V      +YA+VK    +  G+ TQCV  +N      +      S   +++  K G     +   +RP       + +G D  H  +    K SI A V S+++  ++Y + V   + RQE    L       L  F +     P RI+V+RDGV + QL     +E+ A++    ++E+ Y+      P I ++ V+KR  T+LF         +  N  PGT VD  I  P  ++FFL S    +GT+ P++Y+VL D   LT          +ELQ++TY + H Y     ++ +P P +YAH +A      LV + H    +GS P
Sbjct:  376 VPGQRC-LKKLTDVQTSTM-----IKATARSAP-EREREI---CKLVSKAELSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRHRATTALPNQGVWDMRGKQFHTGMEVRTWAIACFAQQSHVK-ENDLRMFTTQLQRISTDAGMPIIGTPMFCKYASGVEQVEPMFKYLKQTYSAIQLIVVVLPGKTPIYAEVKRVGDTVLGIATQCVQAKNAIRTTPQ----TLSNLCLKMNVKLGGVNSILLPNVRPRIFNEPVIFLGCDITHPAAGDTRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIITDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQLFNVLQYELRAIREACVMLESGYQ------PGITFIAVQKRHHTRLFAADKADQVGKAFNIPPGTTVDVGITHPTEFDFFLCSHAGIQGTSRPSHYHVLWDDNDLTA---------DELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDRDHGSGEEGSQP 861          
BLAST of SMEDWI-2 vs. Ensembl Celegans
Match: alg-2 (pep chromosome:WBcel235:II:873176:878945:1 gene:WBGene00000106.1 transcript:T07D3.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-2)

HSP 1 Score: 119.398 bits (298), Expect = 1.004e-26
Identity = 127/516 (24.61%), Postives = 222/516 (43.02%), Query Frame = 1
Query: 1063 IPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSD-AATGMCNKWQLKIDNKPLEIEGRELPPCDVISGG-SKINEKMGDD--WKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNT-------CGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMST-GLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRP------TMIVGMDTYHNKSS---KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKP---LIENIYKGNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA-----ELVGKVH----KGSNP 2487
            +PG+ C L   +D + S M     +    +  P ER  +I   C  +  ++ +A    +++ + I+    E++GR L    ++ GG  +    + +   W     QF    + +         ++  + +N +     +L+ +  DA +  + T        G   VE       ++ S    + +V      +YA+VK    +  G+ TQCV  +N      +      S   +++  K G     +   +RP       + +G D  H  +    K SI A V S+++  ++Y + V   + RQE    L       L  F +     P RI+V+RDGV + QL     +E+ A++    ++E+ Y+      P I ++ V+KR  T+LF         +  N  PGT VD  I  P  ++FFL S    +GT+ P++Y+VL D   LT          +ELQ++TY + H Y     ++ +P P +YAH +A      LV + H    +GS P
Sbjct:  395 VPGQRC-LKKLTDVQTSTM-----IKATARSAP-EREREI---CKLVSKAELSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRHRATTALPNQGVWDMRGKQFHTGMEVRTWAIACFAQQSHVK-ENDLRMFTTQLQRISTDAGMPIIGTPMFCKYASGVEQVEPMFKYLKQTYSAIQLIVVVLPGKTPIYAEVKRVGDTVLGIATQCVQAKNAIRTTPQ----TLSNLCLKMNVKLGGVNSILLPNVRPRIFNEPVIFLGCDITHPAAGDTRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIITDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQLFNVLQYELRAIREACVMLESGYQ------PGITFIAVQKRHHTRLFAADKADQVGKAFNIPPGTTVDVGITHPTEFDFFLCSHAGIQGTSRPSHYHVLWDDNDLTA---------DELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDRDHGSGEEGSQP 880          
BLAST of SMEDWI-2 vs. Ensembl Fly
Match: piwi (gene:FBgn0004872 transcript:FBtr0080166)

HSP 1 Score: 262.307 bits (669), Expect = 1.189e-72
Identity = 212/810 (26.17%), Postives = 365/810 (45.06%), Query Frame = 1
Query:  133 NLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEK-----KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK--VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRD----------IITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDW-KFGRVQ--FDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGK---VNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS--SKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSI----NSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVG 2463
            N +PA++  K G  G  V LQ+NF +       + + Y   F     +P+V++  +      N L   + FDG +LFT+ K+  E +I   S   K     K++++ V  I      + Q++N++L      L  E +G+  F          PR       E   FK  +  G+ T++++  K       LL  E  ++V+   ++     R S +    +D          ++T YNN+TYRI+++         F   GR +S+ EY+  +YNIR+   +QP ++++ +    +    +                        + IP ELC + G + + +SN  L + +    +  P++R D + A+ + ++N+  +  +   W +++D    E++GR +   +++    K+      DW +  R Q       D      V+   RN  + +  ++ + +    M +  R  +   +         R ++D  RS     K+ L  VP+D    Y+ +K      G + + V T+  T +  K R ++S  +K  +Q+  K GY PW +E+ L   M +G D   + +  K++  A + S+    NST   Y S V           TL      AL  ++  +  LP RI+ +RDGV    L+    FEV  +   ++  Y       PQ+ Y++V + + T+ F  G NP PGT+VD  I  P  Y+F+LVSQ+  +GT +PT+YNVL  +  L         +P ++QK+TY + HLY+NW GT RVP    YA +LA LVG
Sbjct:   80 NTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSN--HANLLGSGYLFDGLQLFTTRKF--EQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---------DPRAK----IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKTNASEL----------------------VVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSD---PKLILCLVPNDNAERYSSIKK----RGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGL---------SPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          
BLAST of SMEDWI-2 vs. Ensembl Fly
Match: piwi (gene:FBgn0004872 transcript:FBtr0340227)

HSP 1 Score: 262.307 bits (669), Expect = 1.189e-72
Identity = 212/810 (26.17%), Postives = 365/810 (45.06%), Query Frame = 1
Query:  133 NLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEK-----KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK--VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRD----------IITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDW-KFGRVQ--FDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGK---VNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS--SKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSI----NSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVG 2463
            N +PA++  K G  G  V LQ+NF +       + + Y   F     +P+V++  +      N L   + FDG +LFT+ K+  E +I   S   K     K++++ V  I      + Q++N++L      L  E +G+  F          PR       E   FK  +  G+ T++++  K       LL  E  ++V+   ++     R S +    +D          ++T YNN+TYRI+++         F   GR +S+ EY+  +YNIR+   +QP ++++ +    +    +                        + IP ELC + G + + +SN  L + +    +  P++R D + A+ + ++N+  +  +   W +++D    E++GR +   +++    K+      DW +  R Q       D      V+   RN  + +  ++ + +    M +  R  +   +         R ++D  RS     K+ L  VP+D    Y+ +K      G + + V T+  T +  K R ++S  +K  +Q+  K GY PW +E+ L   M +G D   + +  K++  A + S+    NST   Y S V           TL      AL  ++  +  LP RI+ +RDGV    L+    FEV  +   ++  Y       PQ+ Y++V + + T+ F  G NP PGT+VD  I  P  Y+F+LVSQ+  +GT +PT+YNVL  +  L         +P ++QK+TY + HLY+NW GT RVP    YA +LA LVG
Sbjct:   80 NTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSN--HANLLGSGYLFDGLQLFTTRKF--EQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---------DPRAK----IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKTNASEL----------------------VVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSD---PKLILCLVPNDNAERYSSIKK----RGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGL---------SPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          
BLAST of SMEDWI-2 vs. Ensembl Fly
Match: AGO3 (gene:FBgn0250816 transcript:FBtr0299882)

HSP 1 Score: 254.218 bits (648), Expect = 7.160e-70
Identity = 214/816 (26.23%), Postives = 377/816 (46.20%), Query Frame = 1
Query:  166 GNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKA-----------YNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP-------NDVERCLNDAARSGSGCAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            G+ G +V +  N+ K +   S+    Y+  F     S  ++++++     ++KL G   FDG  L+       +  +     ++ ++ +R++     E     Q+ N+L + +  +L   +  +  F  P          S P        +V  G+ T +    +  G L  +L  +  +R+L   +V++            Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K+ +NI +   +QP + +  K       ++  +  +                     IP ELC+L G  D+ +S+  L + +    +  P +R   +  +   + N+ AA  + N W L + N   +I GR++    +    SKI+   G   +F +     +  +   +   I+       +N+       L NM+       +N   P       + ++  +    R+ +   +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+    S    + E +  +LFYL
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND--HKDKLGGTKTFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQF-DP----------SRPKIIPLAKLEVWPGYVTAVD---EYKGGL--MLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGIPAERENLQFCL---------------------IP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF--SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWII----IHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQ----SIQRDVAEALSEKLFYL 867          
BLAST of SMEDWI-2 vs. Ensembl Fly
Match: AGO3 (gene:FBgn0250816 transcript:FBtr0299881)

HSP 1 Score: 254.218 bits (648), Expect = 7.160e-70
Identity = 214/816 (26.23%), Postives = 377/816 (46.20%), Query Frame = 1
Query:  166 GNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKA-----------YNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP-------NDVERCLNDAARSGSGCAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            G+ G +V +  N+ K +   S+    Y+  F     S  ++++++     ++KL G   FDG  L+       +  +     ++ ++ +R++     E     Q+ N+L + +  +L   +  +  F  P          S P        +V  G+ T +    +  G L  +L  +  +R+L   +V++            Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K+ +NI +   +QP + +  K       ++  +  +                     IP ELC+L G  D+ +S+  L + +    +  P +R   +  +   + N+ AA  + N W L + N   +I GR++    +    SKI+   G   +F +     +  +   +   I+       +N+       L NM+       +N   P       + ++  +    R+ +   +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+    S    + E +  +LFYL
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND--HKDKLGGTKTFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQF-DP----------SRPKIIPLAKLEVWPGYVTAVD---EYKGGL--MLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGIPAERENLQFCL---------------------IP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF--SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWII----IHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQ----SIQRDVAEALSEKLFYL 867          
BLAST of SMEDWI-2 vs. Ensembl Fly
Match: AGO3 (gene:FBgn0250816 transcript:FBtr0299880)

HSP 1 Score: 254.218 bits (648), Expect = 7.160e-70
Identity = 214/816 (26.23%), Postives = 377/816 (46.20%), Query Frame = 1
Query:  166 GNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKA-----------YNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP-------NDVERCLNDAARSGSGCAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            G+ G +V +  N+ K +   S+    Y+  F     S  ++++++     ++KL G   FDG  L+       +  +     ++ ++ +R++     E     Q+ N+L + +  +L   +  +  F  P          S P        +V  G+ T +    +  G L  +L  +  +R+L   +V++            Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K+ +NI +   +QP + +  K       ++  +  +                     IP ELC+L G  D+ +S+  L + +    +  P +R   +  +   + N+ AA  + N W L + N   +I GR++    +    SKI+   G   +F +     +  +   +   I+       +N+       L NM+       +N   P       + ++  +    R+ +   +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+    S    + E +  +LFYL
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND--HKDKLGGTKTFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQF-DP----------SRPKIIPLAKLEVWPGYVTAVD---EYKGGL--MLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGIPAERENLQFCL---------------------IP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF--SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWII----IHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQ----SIQRDVAEALSEKLFYL 867          
BLAST of SMEDWI-2 vs. Ensembl Zebrafish
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:368200])

HSP 1 Score: 275.789 bits (704), Expect = 5.017e-77
Identity = 240/852 (28.17%), Postives = 393/852 (46.13%), Query Frame = 1
Query:   46 AKLEANGSETRGKMGNRGGLRRTFR---IVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKV---KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEK-KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSV---MKAYNRRSIDQ---------LIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVG-----KVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSN 2484
            A L+ +    + K+G RGG RR F    +    L       KTG  G  ++L++NF +  +L    + +Y      V   P +   +L+  +    E  L  A  FDG  LF   K      +   E  + EK ++T+ L + + P +    Q  N+L   +  +L  ++IG+ Y+ +P+           P     +   +  GF TT+ +      E + +L  +  ++VL   +V   M +  ++  DQ         L+G  I+TKYNNKTYRI +I  +   +  F+ G   +S+  YFK +Y + +T G+Q  +++ VK+     R                           + +P E C+L G +D+ +++ ++ K+L    +  P +R   I    + I  +         W L  +NK L + GR LP   +I GG          DW        +       I  + +D     Y     DV Q L     ++   +G      V     +  E  L    ++ +   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VEI LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S        QE  + L  +   AL+ + K  + LP RI+V+RDGVGD  LQ   ++EV  +   I+ +  G  +  P++  V+VKKR+ ++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G   PT+YNV+ D   L          P+ +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ +HK  N
Sbjct:   61 AMLQISAGFQQVKIGERGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMR--LLSRPMWALYQY---HVDYKPPMESRRLRSALLFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY-NPD----------DPFNIPQHRLTIWPGFMTTILQY-----ESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGRPPPGP---------------------AMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTM--GQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGL---------KPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848          
BLAST of SMEDWI-2 vs. Ensembl Zebrafish
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:368200])

HSP 1 Score: 275.789 bits (704), Expect = 5.017e-77
Identity = 240/852 (28.17%), Postives = 393/852 (46.13%), Query Frame = 1
Query:   46 AKLEANGSETRGKMGNRGGLRRTFR---IVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKV---KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEK-KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSV---MKAYNRRSIDQ---------LIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVG-----KVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSN 2484
            A L+ +    + K+G RGG RR F    +    L       KTG  G  ++L++NF +  +L    + +Y      V   P +   +L+  +    E  L  A  FDG  LF   K      +   E  + EK ++T+ L + + P +    Q  N+L   +  +L  ++IG+ Y+ +P+           P     +   +  GF TT+ +      E + +L  +  ++VL   +V   M +  ++  DQ         L+G  I+TKYNNKTYRI +I  +   +  F+ G   +S+  YFK +Y + +T G+Q  +++ VK+     R                           + +P E C+L G +D+ +++ ++ K+L    +  P +R   I    + I  +         W L  +NK L + GR LP   +I GG          DW        +       I  + +D     Y     DV Q L     ++   +G      V     +  E  L    ++ +   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VEI LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S        QE  + L  +   AL+ + K  + LP RI+V+RDGVGD  LQ   ++EV  +   I+ +  G  +  P++  V+VKKR+ ++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G   PT+YNV+ D   L          P+ +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ +HK  N
Sbjct:   61 AMLQISAGFQQVKIGERGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMR--LLSRPMWALYQY---HVDYKPPMESRRLRSALLFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY-NPD----------DPFNIPQHRLTIWPGFMTTILQY-----ESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGRPPPGP---------------------AMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTM--GQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGL---------KPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848          
BLAST of SMEDWI-2 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:572134])

HSP 1 Score: 205.297 bits (521), Expect = 3.843e-53
Identity = 188/836 (22.49%), Postives = 368/836 (44.02%), Query Frame = 1
Query:  157 EKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFS-QVGLSPKVK---LQFIVRVCQENKLPGAFCFDGRRLFTSEKW----HGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYN------RRSID-----QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQEL----------------RNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDR--VYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNN----PNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            +K G  G  + + SN+              D+VF   V  +P V+   ++F +             FDG  L+  ++     H +++ ++  + E  + ++L   + P ++      NV+L  +  +LG + +G+ ++  PN                 +  +V  G+ T+++      G L   L ++  ++VL ++SV+   N      R S       + +G  +IT+YNN+TYRI +I+   +  + F +  G   ++ +Y+++ Y I + + DQP ++                       ++             L +P EL F+ G  ++ + +    K+L   +    ++    +    + I +++ A     +W L I  + L  +GR LP   +    +        DW    V       R   I  V ++     Y     D  +EL                R +R++ R  +  T     +   L    R      ++ +  +  +R  +Y+ +K    + + + +Q +  R  T    ++ + V+ K ++QI  K G + WTV + L+  M++G+D +H+ S K +S+   V S+NS  T++ S V      +E           AL+ + +     P++I+++RDGV D QL+  +++E+  +    E I        P++ +++V+KR+ T L++ G++    P+PGTV+D  +   ++ +F+L++    +G   PT+Y  + +T  LT         P+ LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+       + ++E    +LF+L
Sbjct:  288 QKIGTKGSPIPIGSNYIPICCKN-------DAVFQYHVTFTPNVESLSMRFGMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAE-RKTDNQEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHY-DPNAV----------VILGKHRLQVWPGYSTSIKHTD---GGL--YLVVDVSHKVLRNDSVLDVMNLIYQGSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLI--------------------HRPKERSRPGGKVITGEILLLP-ELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICLHSASFVTSPAVDWSRELV-------RDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFV-KSIHSQLTSEPR-----VQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVR--TISQPQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETIPNYE----PKLAFIVVQKRISTTLYSYGSDHFGTPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNTANLT---------PDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLHSEPAIQLSE----KLFFL 1046          
BLAST of SMEDWI-2 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:572134])

HSP 1 Score: 205.297 bits (521), Expect = 3.843e-53
Identity = 188/836 (22.49%), Postives = 368/836 (44.02%), Query Frame = 1
Query:  157 EKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFS-QVGLSPKVK---LQFIVRVCQENKLPGAFCFDGRRLFTSEKW----HGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYN------RRSID-----QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQEL----------------RNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDR--VYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNN----PNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            +K G  G  + + SN+              D+VF   V  +P V+   ++F +             FDG  L+  ++     H +++ ++  + E  + ++L   + P ++      NV+L  +  +LG + +G+ ++  PN                 +  +V  G+ T+++      G L   L ++  ++VL ++SV+   N      R S       + +G  +IT+YNN+TYRI +I+   +  + F +  G   ++ +Y+++ Y I + + DQP ++                       ++             L +P EL F+ G  ++ + +    K+L   +    ++    +    + I +++ A     +W L I  + L  +GR LP   +    +        DW    V       R   I  V ++     Y     D  +EL                R +R++ R  +  T     +   L    R      ++ +  +  +R  +Y+ +K    + + + +Q +  R  T    ++ + V+ K ++QI  K G + WTV + L+  M++G+D +H+ S K +S+   V S+NS  T++ S V      +E           AL+ + +     P++I+++RDGV D QL+  +++E+  +    E I        P++ +++V+KR+ T L++ G++    P+PGTV+D  +   ++ +F+L++    +G   PT+Y  + +T  LT         P+ LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+       + ++E    +LF+L
Sbjct:  288 QKIGTKGSPIPIGSNYIPICCKN-------DAVFQYHVTFTPNVESLSMRFGMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAE-RKTDNQEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHY-DPNAV----------VILGKHRLQVWPGYSTSIKHTD---GGL--YLVVDVSHKVLRNDSVLDVMNLIYQGSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLI--------------------HRPKERSRPGGKVITGEILLLP-ELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICLHSASFVTSPAVDWSRELV-------RDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFV-KSIHSQLTSEPR-----VQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVR--TISQPQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETIPNYE----PKLAFIVVQKRISTTLYSYGSDHFGTPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNTANLT---------PDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLHSEPAIQLSE----KLFFL 1046          
BLAST of SMEDWI-2 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:572134])

HSP 1 Score: 155.606 bits (392), Expect = 1.298e-37
Identity = 164/781 (21.00%), Postives = 333/781 (42.64%), Query Frame = 1
Query:  157 EKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFS-QVGLSPKVK---LQFIVRVCQENKLPGAFCFDGRRLFTSEKW----HGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYN------RRSID-----QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQEL----------------RNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDR--VYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNN----PNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQK 2364
            +K G  G  + + SN+              D+VF   V  +P V+   ++F +             FDG  L+  ++     H +++ ++  + E  + ++L   + P ++      NV+L  +  +LG + +G+ ++  PN                 +  +V  G+ T+++      G L   L ++  ++VL ++SV+   N      R S       + +G  +IT+YNN+TYRI +I+   +  + F +  G   ++ +Y+++ Y I + + DQP ++                       ++             L +P EL F+ G  ++ + +    K+L   +    ++    +    + I +++ A     +W L I  + L  +GR LP   +    +        DW    V       R   I  V ++     Y     D  +EL                R +R++ R  +  T     +   L    R      ++ +  +  +R  +Y+ +K    + + + +Q +  R  T    ++ + V+ K ++QI  K G + WTV + L+  M++G+D +H+ S K +S+   V S+NS  T++ S V      +E           AL+ + +     P++I+++RDGV D QL+  +++E+  +    E I        P++ +++V+KR+ T L++ G++    P+PGTV+D  +   ++ +F+L++    +G   PT+Y  + +T  LT         P+ LQ+
Sbjct:  288 QKIGTKGSPIPIGSNYIPICCKN-------DAVFQYHVTFTPNVESLSMRFGMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAE-RKTDNQEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHY-DPNAV----------VILGKHRLQVWPGYSTSIKHTD---GGL--YLVVDVSHKVLRNDSVLDVMNLIYQGSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLI--------------------HRPKERSRPGGKVITGEILLLP-ELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICLHSASFVTSPAVDWSRELV-------RDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFV-KSIHSQLTSEPR-----VQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVR--TISQPQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETIPNYE----PKLAFIVVQKRISTTLYSYGSDHFGTPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNTANLT---------PDHLQR 995          
BLAST of SMEDWI-2 vs. Ensembl Xenopus
Match: cd74 (CD74 molecule [Source:Xenbase;Acc:XB-GENE-922847])

HSP 1 Score: 274.248 bits (700), Expect = 2.754e-76
Identity = 231/853 (27.08%), Postives = 413/853 (48.42%), Query Frame = 1
Query:   85 MGNRGGLRRTFRIVEPNLQPA--DITE-KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVK---LQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM--------KAYNRRSID----QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGG--SKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVG-KVNTCGPNDVERCLNDAAR----SGSGCAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNK-SSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            +G+RGG RR F  +  N + A   + E KTG+ G  ++L +N  K  ++   +++++      +  +P+++   L+  +    E  +  A  FDG  LF  ++    +++  Q  + +  K+T+ L + + P +   +Q  N++   L  M+  ++IG+ Y+ +PN   D++  +S       +   +  GF T++ +      E   +L I+  ++VL   +V+        K  + +  D     LIG+ ++TKYNNKTYRI +I  +   +  F+   G  +S+ +Y++ +YN  +T  +QP ++                        K+            L IP E CFL G +D+ +S+ ++ K+L    +  P +R   +  +   I   D+       W L  D+K L   GR  P   ++  G  +  N +  D W        + R +  +  V++  R ++   +  N + Q L   ++  ++G K+N     +V+   +   +      +   +M +  +  +R   Y  +K +  +   + +QCV  +  T    +    V++K  +Q+  K G + WTVEI L+  MIVG+D YH+  S K+SI A V S+N + T++ S       +QE  + L    + AL+ +      LP RI+++RDGVGD QL+    +E+  ++  I +  K      P++  ++VKKRV  + F     R  NP PGT+VD EI +P +Y+FF++SQ    G+ +PT+YNV+ D+  L          P+ +Q++TY L HLY+NW G IRVP P  YAH+LA LVG+ +H+  +       + +RL+YL
Sbjct:   77 LGDRGGRRRDFHDLGINTRQAIEHVKESKTGSSGSIIQLSTNHIK--LISRPQWVLFQY---HIDYAPQMESRGLRCALLFQHEELIGKARAFDGTMLFLPKRLDKVNEVFSQTRNGETVKITITLTNELPPTSPTCFQFYNIIFRRLLKMMNMKQIGRNYY-NPN---DQIEISS-------HGLTIYPGFSTSILQY-----ENNIMLSIDVSHKVLRSETVLDYMYNVNQKVESHKFHDICSKDLIGQIVLTKYNNKTYRIDDINWDFTPESTFKKSDGSEISFVDYYRTQYNKGITDLNQPALV---------------------HNPKKPRGPQNVPAGPILLIP-EFCFLTGLTDRMRSDFNVMKDLAIHTRLAPEQREIQVGKFLKNIHKDDSVQKELQDWGLNFDSKLLPFAGRVAPAEKILQAGKTADYNPQFAD-WSRELRGPTLIRVKHLDNWVLLYTRRNY---DAANTLTQNL--FKVSGQMGIKMNRAVMVEVDDTTDAYVKVLQQKVTPDVQMVVCLLSSNRKDKYDAIKKYLCIDCPVPSQCVLAK--TLNKPQTVVSVATKIALQMNCKMGGELWTVEIPLKELMIVGIDCYHDTLSGKRSIGAFVASLNPSMTRWFSRCVLQAQKQEIVDGLKVCMHAALKAWFNCNKSLPSRIIIYRDGVGDGQLKTMVEYEIPQLQDCIRSAEKDYS---PKLTVIVVKKRVSARFFAHVGGRLQNPPPGTIVDVEITRPEWYDFFIISQSVRVGSVSPTHYNVVYDSGAL---------KPDHMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPHLT-----LSDRLYYL 861          
BLAST of SMEDWI-2 vs. Ensembl Xenopus
Match: cd74 (CD74 molecule [Source:Xenbase;Acc:XB-GENE-922847])

HSP 1 Score: 273.478 bits (698), Expect = 3.339e-76
Identity = 232/854 (27.17%), Postives = 414/854 (48.48%), Query Frame = 1
Query:   85 MGNRGGLRRTFRIVEPNLQPA--DITE-KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVK---LQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM-------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGG--SKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVG-KVNTCGPNDVERCLNDAAR----SGSGCAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNK-SSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            +G+RGG RR F  +  N + A   + E KTG+ G  ++L +N  K  ++   +++++      +  +P+++   L+  +    E  +  A  FDG  LF  ++    +++  Q  + +  K+T+ L + + P +   +Q  N++   L  M+  ++IG+ Y+ +PN   D++  +S       +   +  GF T++ +      E   +L I+  ++VL   +V+             K ++  S D LIG+ ++TKYNNKTYRI +I  +   +  F+   G  +S+ +Y++ +YN  +T  +QP ++                        K+            L IP E CFL G +D+ +S+ ++ K+L    +  P +R   +  +   I   D+       W L  D+K L   GR  P   ++  G  +  N +  D W        + R +  +  V++  R ++   +  N + Q L   ++  ++G K+N     +V+   +   +      +   +M +  +  +R   Y  +K +  +   + +QCV  +  T    +    V++K  +Q+  K G + WTVEI L+  MIVG+D YH+  S K+SI A V S+N + T++ S       +QE  + L    + AL+ +      LP RI+++RDGVGD QL+    +E+  ++  I +  K      P++  ++VKKRV  + F     R  NP PGT+VD EI +P +Y+FF++SQ    G+ +PT+YNV+ D+  L          P+ +Q++TY L HLY+NW G IRVP P  YAH+LA LVG+ +H+  +       + +RL+YL
Sbjct:   57 LGDRGGRRRDFHDLGINTRQAIEHVKESKTGSSGSIIQLSTNHIK--LISRPQWVLFQY---HIDYAPQMESRGLRCALLFQHEELIGKARAFDGTMLFLPKRLDKVNEVFSQTRNGETVKITITLTNELPPTSPTCFQFYNIIFRRLLKMMNMKQIGRNYY-NPN---DQIEISS-------HGLTIYPGFSTSILQY-----ENNIMLSIDVSHKVLRSETVLDYMYNVNQKVESHKFHDICSKD-LIGQIVLTKYNNKTYRIDDINWDFTPESTFKKSDGSEISFVDYYRTQYNKGITDLNQPALV---------------------HNPKKPRGPQNVPAGPILLIP-EFCFLTGLTDRMRSDFNVMKDLAIHTRLAPEQREIQVGKFLKNIHKDDSVQKELQDWGLNFDSKLLPFAGRVAPAEKILQAGKTADYNPQFAD-WSRELRGPTLIRVKHLDNWVLLYTRRNY---DAANTLTQNL--FKVSGQMGIKMNRAVMVEVDDTTDAYVKVLQQKVTPDVQMVVCLLSSNRKDKYDAIKKYLCIDCPVPSQCVLAK--TLNKPQTVVSVATKIALQMNCKMGGELWTVEIPLKELMIVGIDCYHDTLSGKRSIGAFVASLNPSMTRWFSRCVLQAQKQEIVDGLKVCMHAALKAWFNCNKSLPSRIIIYRDGVGDGQLKTMVEYEIPQLQDCIRSAEKDYS---PKLTVIVVKKRVSARFFAHVGGRLQNPPPGTIVDVEITRPEWYDFFIISQSVRVGSVSPTHYNVVYDSGAL---------KPDHMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPHLT-----LSDRLYYL 841          
BLAST of SMEDWI-2 vs. Ensembl Xenopus
Match: piwil3 (piwi-like RNA-mediated gene silencing 3 [Source:NCBI gene;Acc:100496286])

HSP 1 Score: 263.462 bits (672), Expect = 1.128e-72
Identity = 228/850 (26.82%), Postives = 396/850 (46.59%), Query Frame = 1
Query:   85 MGNRGGLRRTFRIVEPNLQPA--DITE-KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKV---KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM----KAY----NRRSID----QLIGRDIITKYNNKTYRISEI-KEMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGG--SKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFM----NDVEQELRNMRID-ARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNK-SSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            +  RGG RR F  +  N +     + E KTG  G T++L +N  K  ++   ++++Y      +  +P++   +L+  +    E  +  A  FDG  LF  ++ +  +++  Q  + +  K+T+ L + + P +   +Q  N++   L  M+  ++IG+ Y+             S P     ++  +  GF T++ +      E + +L ++  ++VL   +V+    K Y    +R   D    +L+G+ ++TKYNNKTYRI EI   M     F+   G  +S+ +Y++ +YN  +    Q  +                             +  P      + +  ELC L G +D+ +++  + ++L    +  P +R   +  + N+I   +        W L  D + L   GR  PP  ++  G  +  N +  D  +  R Q  I   R  +  +++  R  +     +    N V Q++  MR++  R+ +V+    N   + LN      +      L  +  ++  +  K   +     +QCV  R  T    +    V++K  MQ+  K G + W+VEI L   M++G+D YH+  S K+SI   V S+N   T++ S       +QE  + L      +L  +      LP RIL++RDGVGD QL+   N+E+      I++   G  +  P++  ++VKKR+  + F     R  NP PGTVVD E+ +P +Y+FF+VSQ   +GT +PT+YNV+ D+  L          P+ +Q++TY L HLY+NW G IRVP P  YAH+LA LVG+ +HK  +       + NRL+YL
Sbjct:   87 ISERGGRRRDFHDLGVNTRQTIEHVKESKTGVSGSTIQLSTNHIK--LVSRPQWVLYQY---HIDYNPQMESRRLRTALLYQHEELIGKARAFDGTMLFAPKRLNKATEVFSQTRNGENVKITITLTNELPPTSPTCFQFYNIIFRRLLKMMNMKQIGRNYY-----------NPSDPIEISQHNLTIWPGFTTSILQY-----ETSIMLSLDVSHKVLRSETVLDVMTKLYRMHGDRDFADAVTKELLGQIVLTKYNNKTYRIDEICWNMTPQSTFKKSDGSDISFVDYYRMQYNKEIRDLRQALI------------------------ANIPRRVRPGGDTGPIVLVPELCNLTGLTDRMRNDFGVMRDLAVHTRLPPDQREKQVARFLNYIHKDENVQKELRDWGLNFDKQLLPFVGRVSPPERILQAGRTADYNPQFADWSREMRGQTLISV-RHLDNWMLLYPRRCYDAAQTLVQTLNKVAQQI-GMRMNNVRMFEVDDRA-NSYIQVLNAEVNPDTQMVVCVLSSIHKEKYDSIKKYLCLQIPTPSQCVVAR--TLSKPQTVLSVATKIAMQMNCKMGGELWSVEIPLGEMMVIGIDCYHDTLSGKRSIAGFVASMNRNLTRWYSRCVLQDQKQEIVDGLKVCLQASLHAWFNCNKNLPSRILIYRDGVGDGQLKTLVNYEIPQFLDCIKS--AGRDY-CPKLSIIVVKKRINARFFAHLGGRIQNPPPGTVVDVEVTRPEWYDFFIVSQSVRQGTVSPTHYNVVYDSSGL---------KPDYMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLAFLVGQSIHKEPHLA-----LSNRLYYL 869          
BLAST of SMEDWI-2 vs. Ensembl Xenopus
Match: piwil3 (piwi-like RNA-mediated gene silencing 3 [Source:NCBI gene;Acc:100496286])

HSP 1 Score: 250.366 bits (638), Expect = 2.383e-68
Identity = 225/849 (26.50%), Postives = 385/849 (45.35%), Query Frame = 1
Query:   85 MGNRGGLRRTFRIVEPNLQPA--DITE-KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKV---KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM----KAY----NRRSID----QLIGRDIITKYNNKTYRISEI-KEMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGG--SKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFM----NDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNK-SSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            +  RGG RR F  +  N +     + E KTG  G T++L +N  K  ++   ++++Y      +  +P++   +L+  +    E  +  A  FDG  LF  ++ +  +++  Q  + +  K+T+ L + + P +   +Q  N++   L  M+  ++IG+ Y+             S P     ++  +  GF T++ +      E + +L ++  ++VL   +V+    K Y    +R   D    +L+G+ ++TKYNNKTYRI EI   M     F+   G  +S+ +Y++ +YN  +    Q  +                             +  P      + +  ELC L G +D+ +++  + ++L    +  P +R   +  + N+I   +        W L  D + L   GR  PP  ++  G  +  N +  D  +  R Q  I   R  +  +++  R  +     +    N V Q++     + R+ +V+    N   + LN      +      L  +  ++  +  K   +     +QCV  R  T    +    V++K  MQ+  K G + W+VEI L   M++G+D YH+  S K+SI    FS    F  Y     S       H     N NL            P RIL++RDGVGD QL+   N+E+      I++   G  +  P++  ++VKKR+  + F     R  NP PGTVVD E+ +P +Y+FF+VSQ   +GT +PT+YNV+ D+  L          P+ +Q++TY L HLY+NW G IRVP P  YAH+LA LVG+ +HK  +       + NRL+YL
Sbjct:   97 ISERGGRRRDFHDLGVNTRQTIEHVKESKTGVSGSTIQLSTNHIK--LVSRPQWVLYQY---HIDYNPQMESRRLRTALLYQHEELIGKARAFDGTMLFAPKRLNKATEVFSQTRNGENVKITITLTNELPPTSPTCFQFYNIIFRRLLKMMNMKQIGRNYY-----------NPSDPIEISQHNLTIWPGFTTSILQY-----ETSIMLSLDVSHKVLRSETVLDVMTKLYRMHGDRDFADAVTKELLGQIVLTKYNNKTYRIDEICWNMTPQSTFKKSDGSDISFVDYYRMQYNKEIRDLRQALI------------------------ANIPRRVRPGGDTGPIVLVPELCNLTGLTDRMRNDFGVMRDLAVHTRLPPDQREKQVARFLNYIHKDENVQKELRDWGLNFDKQLLPFVGRVSPPERILQAGRTADYNPQFADWSREMRGQTLISV-RHLDNWMLLYPRRCYDAAQTLVQTLNKVAQQIGMRMNNVRMFEVDDRA-NSYIQVLNAEVNPDTQMVVCVLSSIHKEKYDSIKKYLCLQIPTPSQCVVAR--TLSKPQTVLSVATKIAMQMNCKMGGELWSVEIPLGEMMVIGIDCYHDTLSGKRSIAG--FSSCVIFILYFLLPAS------LHAWFNCNKNL------------PSRILIYRDGVGDGQLKTLVNYEIPQFLDCIKS--AGRDY-CPKLSIIVVKKRINARFFAHLGGRIQNPPPGTVVDVEVTRPEWYDFFIVSQSVRQGTVSPTHYNVVYDSSGL---------KPDYMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLAFLVGQSIHKEPHLA-----LSNRLYYL 859          
BLAST of SMEDWI-2 vs. Ensembl Xenopus
Match: bckdhb (branched chain keto acid dehydrogenase E1, beta polypeptide [Source:Xenbase;Acc:XB-GENE-953785])

HSP 1 Score: 237.269 bits (604), Expect = 3.373e-64
Identity = 206/826 (24.94%), Postives = 367/826 (44.43%), Query Frame = 1
Query:  157 EKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM--------KAYNRRSID----QLIGRDIITKYNNKTYRISEIKEMN--VDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRND----FQYKNFMNDVEQELRN--MRIDARVG------KVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDR--VYAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKK-SIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFN---RG-NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
             KTG  G  VKL +N    ++    K   Y   FS    S K+K   +        L  A  F G  LF S      +       +  K+T+ L + +  ++    Q   +L   +   L   ++G+ Y+             + P     +   +  GF  ++ +      E    L  +  ++VL + +V+        K    R  D    +L+G  ++T+YNNKTYR+ +I       D      G  ++Y +Y+ ++Y+I ++   QP +++ +K                                  +++  ELC+L G S +  S+  L K+L    + +P  R   +    + I+ +  A+    KW L++D K + + GR  PP  +    +        DW          RD ++E  + +    +    F Y+N   DV + L    M++ + +G      ++     N V   L    ++ +   ++    +P ++   Y  +K F ++   + +QCV  +N T    +    V++K  MQ+  K G + W VEI L+  M+VG+D   +  +K  S+   V S N+  T++ S     K   +F + L      A++++++  + LP RI+V+RDGVGD QL+   ++E+     L+ +  +      P++  ++V+K+  ++ +    RG  NP  GT+VD E  +P +Y+F+L+SQ   +GT  PT YNVL D          + + P+ +Q++TY L HLY+NW G IRVP P  YAH+L  LVG+ +H+  +P      + ++LFYL
Sbjct:   69 HKTGTSGAPVKLMTNLFGLTLPTQWKLYQYRVDFSPEFASRKLKTALLYS--HGETLGRARAFHGEILFLSRNIGKVNAFTTRKGETVKITITLTNQLPADSPVCIQFFGILFKKVFKSLNMYQVGRNYY-----------NPADPVIIPQHRLMLWPGFVLSIMKL-----ESQLALCADVSHKVLRNETVLDSMKALYSKVPKERFTDICEKELLGLVVLTRYNNKTYRVDDIDWSTKPTDSFPRKDGSEITYTDYYSQQYSINISDLQQPMLVSALKAKKSDNPDAPR----------------------AVHLIPELCYLTGLSSRALSDFRLMKDLSMETQLDPERRQQRLQRLADSIQRTPEASAELEKWGLRMD-KQIPVTGRIAPPERIFMRDNVCTPGSPADWA---------RDTRNEKVICVAPLQNWLMLFSYRN--ADVAENLLQCLMKVASGMGFHMDMPRIVQVEDNPVS-FLRTLQKNVTPDLQLVFCVIPTNQKDSYDSIKKFLSLDQPVPSQCV--QNRTLGRQQMMMSVANKIAMQMICKLGGELWAVEIPLKALMVVGIDINKDAVNKSMSVVGFVASTNARLTRWHSRCIIQKTTSDFADCLKMCMKGAIQNWQRCNNDLPNRIVVYRDGVGDGQLKMVVDYEIPQ---LLSSFRETKTSYCPRLSVIVVRKKCISRFYTQTGRGIQNPVLGTIVDSEATRPEWYDFYLISQNARQGTVNPTYYNVLLDE---------NGLKPDHMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLTFLVGQSIHREPSP-----ELSHKLFYL 822          
BLAST of SMEDWI-2 vs. Ensembl Mouse
Match: Piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:MGI Symbol;Acc:MGI:1928897])

HSP 1 Score: 258.455 bits (659), Expect = 3.814e-71
Identity = 224/875 (25.60%), Postives = 387/875 (44.23%), Query Frame = 1
Query:   40 KVAKLEANGSETRGKMGNRGGLRRTFRIVEPNL-QPADITE--KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKW-HGESDI--QEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSK-------------------INEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            K  +L+ +       +  RGG RR F  +  N  Q  D  +  KTG+ G  VKL +N   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++  H  +++  Q  + +  ++T+ L + + P +    Q  N++   L  ++  ++IG+ Y+             S P     +   +  GF T++ +      E   +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++++YN  +T   QP ++++ K+                                 + IP ELC+L G +D+ +++ ++ K+L    +  P +R  ++    ++I   D        W L  D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    M    ++   + +D R             R L     S +      L     D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V++ L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P R++V+RDGVGD QL+   N+EV      ++++ +G     P++  ++VKKRV  + F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D+           + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:   62 KSQELQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVKLSTN--HFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGRCHAFDGTILFLPKRLQHKVTEVFSQTRNGEHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPSDPIDIPNHRLVIWPGFTTSILQY-----ENNIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQVSKELIGLIVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGP---------------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGIQMKKAIMIEVDDRT--------EAYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQFLDCLKSVGRGYN---PRLTVIVVKKRVNARFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDS---------SGLKPDHIQRLTYKLCHVYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 862          
BLAST of SMEDWI-2 vs. Ensembl Mouse
Match: Piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:MGI Symbol;Acc:MGI:3041167])

HSP 1 Score: 229.95 bits (585), Expect = 8.055e-62
Identity = 210/824 (25.49%), Postives = 366/824 (44.42%), Query Frame = 1
Query:  160 KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEK-----KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERIN-RVLNDNSV------------MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEM-GGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDW-KFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDA---RVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS-VFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEV-DAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            KTG+ G  V+L +N     + +  +   Y   +S    S ++++  +           A  FDG  LF SEK   +  + E + + +     K+TL L S + P +    Q  NV+   +   L   +IG+ ++           + S P         +  GF  ++          + LL+   +N +VL + +V            M  +      QL+G  ++T+YNNKTYRI +I   +   + F+   G  ++Y +Y+K++Y+I L+  +QP +++ +K+      + +                        +++  ELCFL G S Q  S+  L K +    +  P  R   +    + I+ +  A      W L   ++ L + GR +P   ++            DW K  R    +     +   +V  +R +   + F++ + +   +M  +    ++ KV+   P    R +      G    ++ +  +P ++   Y  +K +  S   + +QCV TR  T         V++K  MQ+  K G + W+VEI L+  M+VG+D   +  +K  +    V SINS  T++ S     +   +  + L      AL  + +    LP RI+V+RDGVG+ QL+    +EV   +K + E    G+     ++  V+V+KR   +LF   +    NP  GTVVD E  +P +Y+F+L+SQ   +GT +PT+YNV+ D          + + P+ +Q++T+ L HLY+NW G I VP P  YAH+L  LV + VHK       +  + N LFYL
Sbjct:   93 KTGSSGIPVRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYN--HSILSDKAKAFDGASLFLSEKL--DQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFY-----------KPSEPVEIPQYKLSLWPGFAISVSHFE------SKLLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCHKQLVGLVVLTRYNNKTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKRKRNDNSEPQM-----------------------VHLMPELCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRNPVARFELETWGLHFGSQ-LSLTGRVVPSEKILLQDHTCQPAFAADWSKDMRSCKVLSSQPLNRWLIVCCNRAEHLIEAFLSCLRRVGGSMGFNVGYPKIIKVDE-TPAAFLRAIQ---VHGDPDVQLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTR--TLNKQGTMLSVATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTEC---GSDARSCRLSVVVVRKRCLLRLFASTDHTVQNPPLGTVVDSEATRPEWYDFYLISQTANRGTVSPTHYNVIYDD---------NALKPDHMQRLTFKLCHLYYNWQGLISVPAPCQYAHKLTFLVAQSVHKEP-----SLELANNLFYL 848          
BLAST of SMEDWI-2 vs. Ensembl Mouse
Match: Piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:MGI Symbol;Acc:MGI:1928897])

HSP 1 Score: 223.016 bits (567), Expect = 1.330e-59
Identity = 203/831 (24.43%), Postives = 360/831 (43.32%), Query Frame = 1
Query:   40 KVAKLEANGSETRGKMGNRGGLRRTFRIVEPNL-QPADITE--KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKW-HGESDI--QEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSK-------------------INEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNW 2400
            K  +L+ +       +  RGG RR F  +  N  Q  D  +  KTG+ G  VKL +N   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++  H  +++  Q  + +  ++T+ L + + P +    Q  N++   L  ++  ++IG+ Y+             S P     +   +  GF T++ +      E   +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++++YN  +T   QP ++++ K+                                 + IP ELC+L G +D+ +++ ++ K+L    +  P +R  ++    ++I   D        W L  D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    M    ++   + +D R             R L     S +      L     D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V++ L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P R++V+RDGVGD QL+   N+EV      ++++ +G     P++  ++VKKRV  + F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D+           + P+ +Q++TY L H+Y+NW
Sbjct:   62 KSQELQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVKLSTN--HFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGRCHAFDGTILFLPKRLQHKVTEVFSQTRNGEHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPSDPIDIPNHRLVIWPGFTTSILQY-----ENNIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQVSKELIGLIVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGP---------------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGIQMKKAIMIEVDDRT--------EAYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQFLDCLKSVGRGYN---PRLTVIVVKKRVNARFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDS---------SGLKPDHIQRLTYKLCHVYYNW 823          
BLAST of SMEDWI-2 vs. Ensembl Mouse
Match: Piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:MGI Symbol;Acc:MGI:1930036])

HSP 1 Score: 170.629 bits (431), Expect = 2.256e-42
Identity = 130/487 (26.69%), Postives = 229/487 (47.02%), Query Frame = 1
Query: 1072 ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVGKVNTCGPNDVERCLND-----------AARSGSGCAKMALVFVPDDR--VYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKS-SKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNN----PNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKV 2469
            EL F+ G  ++ K +    K+L   +   P++    +      I  ++ A+    +W L +     +IEGR LP         +IN +         + +  +  R   I  + +      Y     D  +EL NM  +I   +G +    P  VE  L D           +     G  +M +  +   R  +Y  +K    + + + +Q +  R  T     R + V+ K ++Q+  K G + W V+I L+  M++GMD YH+ S   +S+   V SIN T T++ S V      QE  ++L      +L+ + +    LP++I+V+RDGV D QL+   N+E+    P ++  ++      P+++  +V+K++ T L+    +    P+PGTVVD  I    + +F+L++    +G   PT+Y  + +T  L+         P+ +Q++T+ L H+Y+NW GTIRVP P  YAH+LA L G++
Sbjct:  494 ELSFMTGIPEKMKKDFRAMKDLTQQINLSPKQHHGALECLLQRISQNETASNELTRWGLSLHKDVHKIEGRLLP-------MERINLRNTSFVTSEDLNWVKEVTRDASILTIPMHFWALFYPKRAMDQARELVNMLEKIAGPIG-MRISPPAWVE--LKDDRIETYIRTIQSLLGVEGKIQMVVCIIMGTRDDLYGAIKKLCCVQSPVPSQVINVR--TIGQPTRLRSVAQKILLQMNCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKYYEVNHCLPEKIVVYRDGVSDGQLKTVANYEI----PQLQKCFEAFDNYHPKMVVFVVQKKISTNLYLAAPDHFVTPSPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYICVLNTANLS---------PDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQI 955          
BLAST of SMEDWI-2 vs. Ensembl Mouse
Match: Piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:MGI Symbol;Acc:MGI:3041167])

HSP 1 Score: 132.109 bits (331), Expect = 1.638e-30
Identity = 93/323 (28.79%), Postives = 150/323 (46.44%), Query Frame = 1
Query: 1576 KMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS-VFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            ++ +  +P ++   Y  +K +  S   + +QCV TR  T         V++K  MQ+  K G + W+VEI L+  M+VG+D   +  +K  +    V SINS  T++ S     +   +  + L      AL  + +    LP RI+V+RDGVG+ QL+    +EV                  PQ++  + +     +                       Y+F+L+SQ   +GT +PT+YNV+ D          + + P+ +Q++T+ L HLY+NW G I VP P  YAH+L  LV + VHK       +  + N LFYL
Sbjct:  613 QLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTR--TLNKQGTMLSVATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEV------------------PQLLKSVTECGSDAR-----------------------YDFYLISQTANRGTVSPTHYNVIYDD---------NALKPDHMQRLTFKLCHLYYNWQGLISVPAPCQYAHKLTFLVAQSVHKEP-----SLELANNLFYL 878          

HSP 2 Score: 71.2478 bits (173), Expect = 8.983e-12
Identity = 78/334 (23.35%), Postives = 142/334 (42.51%), Query Frame = 1
Query:  160 KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEK-----KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEM-GGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLG 1140
            KTG+ G  V+L +N     + +  +   Y   +S    S ++++  +           A  FDG  LF SEK   +  + E + + +     K+TL L S + P +    Q  NV+   +   L   +IG+ ++  P+    E+P+ +   F    ++KVL        R       +T L             + M  +      QL+G  ++T+YNNKTYRI +I   +   + F+   G  ++Y +Y+K++Y+I L+  +QP +++ +K+      + +                        +++  ELCFL G S Q  S+  L K + 
Sbjct:  156 KTGSSGIPVRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYN--HSILSDKAKAFDGASLFLSEKL--DQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFY-KPS-EPVEIPQYNKLLFNADVNYKVL--------RNETVLDFMTDLCL----------RTGMSCFTEMCHKQLVGLVVLTRYNNKTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKRKRNDNSEPQM-----------------------VHLMPELCFLTGLSSQATSDFRLMKAVA 442          
BLAST of SMEDWI-2 vs. UniProt/SwissProt
Match: sp|Q2Q5Y8|PIWI2_SCHMD (Piwi-like protein 2 OS=Schmidtea mediterranea OX=79327 GN=wi-2 PE=2 SV=1)

HSP 1 Score: 1633.62 bits (4229), Expect = 0.000e+0
Identity = 825/837 (98.57%), Postives = 826/837 (98.69%), Query Frame = 1
Query:   22 MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSF-VNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            MEEIPVKVAKLEANGSETRGKMGNRGGLR TFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKE  +E       TLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSF VNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL
Sbjct:    1 MEEIPVKVAKLEANGSETRGKMGNRGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPEEKDM----TLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          
BLAST of SMEDWI-2 vs. UniProt/SwissProt
Match: sp|Q2PC95|PIWIL_DUGJA (Piwi-like protein OS=Dugesia japonica OX=6161 GN=iwi PE=2 SV=1)

HSP 1 Score: 1263.44 bits (3268), Expect = 0.000e+0
Identity = 607/812 (74.75%), Postives = 702/812 (86.45%), Query Frame = 1
Query:   94 RGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            RGGL++ FRIVEP+LQP +  +K GN+G+ V+LQSNFTKFSV +SEK++MYD+ FS++GLSPK+KLQ +VR+C+E  LPG+FC+DGRRLFTS+ W   SDI+EF+ DEKK++LRLVST L +TEEYYQMINVLLNNLQ+++GQE+IGKGYFL  N  KD V +N GPTFFETN+FKVLGGFGTTLQRGT+P G+LTTLLYIERINRVLNDNSV+  YNR++IDQLIGRDI+TKYNNKTYRISEIKEMN++E FEM GRTLSYA+YFKERYNI LT   QPFVLTRVKK  RR+++K+  E    E               TLNI GELCFLCGFSDQEKSN+DLQKNLGCVLKR PRERLDDIP++C+WIK ++ + GM NKW LKIDN PLEIEGRELP CDVISGG +INEK+ DDWKFG+VQF++++  KHEIDVVIVDRND QY NF+NDVE E++ +R DA++G+V  C  NDVER LND  RSGSGCAK+ALVFVPDDRVYAKVKSFT+STGLLTQCVTTRNGTNRNDKRR+VVSSKTVMQIF+KFGYDPWT++IK+RPTMIVGMDT+HNK SKKSI ASVFSINSTF+QYMSF NSPKG+QEFH+TL  NF  AL +FK+ Y ILP RI+V+RDGVGD+QLQFTK FEVDAMKPL+ENIYK NG  VPQIIYVIVKKR+GTKLFNRG+N NPGT+VDKEIVKPNF+EFFLVSQR T+GTA+PTNYNVLEDTR   K G ++ + PNELQ+ITY LTHLYFNWMGTIRVPVPVHYAH+LAEL+GKVHKGS P  INERIRNRLFYL
Sbjct:   18 RGGLQKRFRIVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKKIARRDKRKEHNENEAPEDMDL-----------TLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQNKAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          
BLAST of SMEDWI-2 vs. UniProt/SwissProt
Match: sp|Q2Q5Y9|PIWI1_SCHMD (Piwi-like protein 1 OS=Schmidtea mediterranea OX=79327 GN=wi-1 PE=2 SV=1)

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 440/813 (54.12%), Postives = 589/813 (72.45%), Query Frame = 1
Query:   94 RGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            RGGL+R F I+EP LQP  +T+K G  GR V L+SN+  F++     F MYD V     +  K++L       + N  P  FCFDGRRLFT+ KWH + D +     + ++++RL++T L  +EEYYQMIN++ NN+Q+ +GQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK+RYNI L    QPFV++RVK+ M R ++K + E     +  +           +L+IPGELC+LCGFSD E+SN++LQKNLG VLKREPRERL+DI  +C W     +   M   W + I+ +P+ I GREL P D+ S   KIN K+ DDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVNS KG+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY+     +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P AIN+RIR RLFYL
Sbjct:   16 RGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETDQ-----------SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYM-KSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          
BLAST of SMEDWI-2 vs. UniProt/SwissProt
Match: sp|A8D8P8|SIWI_BOMMO (Piwi-like protein Siwi OS=Bombyx mori OX=7091 GN=Siwi PE=1 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 3.674e-77
Identity = 227/836 (27.15%), Postives = 379/836 (45.33%), Query Frame = 1
Query:  139 QPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQ--ENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEK------KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKA-----------YNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEK--FEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDD---WK--------FGRVQFDI---------KRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERI 2508
            +P  +T K G  G  + L +N+  F+V  + K+ +Y      V +SP+     + +      +K  G + FDG  L+T  + H   D  E   D K      ++ ++L   + P    Y Q+ N+++     +L  + +G+ YF       D   +   P F      ++  G+ TT+ +      E   LL  E  ++VL  ++V++            Y +  ++ ++G+ ++T YN +TYR+ ++   NV  K  F+M    ++Y EY+ ++YN+R+    QP +++R K    R    +                        + +  ELC   G SD+ ++N  L ++L    K  P +R++ +  +     ++         W LK+  + ++I+GR+LPP ++I   + +    GD    W             Q +          +RD +  ID++I       ++    D    L  +R D  +   N C     E  +   AR         L     DR  A  K  T+   + TQ V  RN ++   K    +++K  +QI  K G  PWTV+I L   M+VG D  H+  SK KS  A V +++   TQY S VN+    +E    +G N   A++ F+++    P RI ++RDGVGD Q+ +  + EV  +K  +  IY G      ++ ++IV KR+ T++F      G NP PGTV+D  +  P  Y+F+LVSQ   +GT  PT+YNV+EDT  L          P+ +Q++TY LTHLYFN    +RVP    YAH+LA L           ++NE +
Sbjct:  136 RPEAVTSKKGTSGTPLDLLANY--FTVETTPKWGLYQY---HVDISPEEDSTGVRKALMRVHSKTLGGYLFDGTVLYTVNRLH--PDPMELYSDRKTDNERMRILIKLTCEVSPGDYHYIQIFNIIIRKCFNLLKLQLMGRDYF-------DPEAKIDIPEF----KLQIWPGYKTTINQY-----EDRLLLVTEIAHKVLRMDTVLQMLSEYAATKGNNYKKIFLEDVVGKIVMTDYNKRTYRVDDVA-WNVSPKSTFKMRDENITYIEYYYKKYNLRIQDPGQPLLISRSKPREIRAGLPEL-----------------------IYLVPELCRQTGLSDEMRANFKLMRSLDVHTKIGPDKRIEKLNNFNRRFTSTPEVVEELATWSLKLSKELVKIKGRQLPPENIIQANN-VKYPAGDTTEGWTRDMRSKHLLAIAQLNSWVVITPERQRRDTESFIDLIIKTGGGVGFRMRSPD----LVVIRHDGPIEYANMC-----EEVI---ARKNPALILCVLARNYADRYEAIKKKCTVDRAVPTQVVCARNMSS---KSAMSIATKVAIQINCKLGGSPWTVDIPLPSLMVVGYDVCHDTRSKEKSFGAFVATLDKQMTQYYSIVNAHTSGEELSSHMGFNIASAVKKFREKNGTYPARIFIYRDGVGDGQIPYVHSHEVAEIKKKLAEIYAGVEI---KLAFIIVSKRINTRIFVQRGRSGENPRPGTVIDDVVTLPERYDFYLVSQNVREGTIAPTSYNVIEDTTGLN---------PDRIQRLTYKLTHLYFNCSSQVRVPSVCQYAHKLAFLAANSLHNQPHYSLNETL 896          
BLAST of SMEDWI-2 vs. UniProt/SwissProt
Match: sp|Q8UVX0|PIWL1_DANRE (Piwi-like protein 1 OS=Danio rerio OX=7955 GN=piwil1 PE=1 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 3.787e-76
Identity = 240/852 (28.17%), Postives = 393/852 (46.13%), Query Frame = 1
Query:   46 AKLEANGSETRGKMGNRGGLRRTFR---IVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKV---KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEK-KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSV---MKAYNRRSIDQ---------LIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVG-----KVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSN 2484
            A L+ +    + K+G RGG RR F    +    L       KTG  G  ++L++NF +  +L    + +Y      V   P +   +L+  +    E  L  A  FDG  LF   K      +   E  + EK ++T+ L + + P +    Q  N+L   +  +L  ++IG+ Y+ +P+           P     +   +  GF TT+ +      E + +L  +  ++VL   +V   M +  ++  DQ         L+G  I+TKYNNKTYRI +I  +   +  F+ G   +S+  YFK +Y + +T G+Q  +++ VK+     R                           + +P E C+L G +D+ +++ ++ K+L    +  P +R   I    + I  +         W L  +NK L + GR LP   +I GG          DW        +       I  + +D     Y     DV Q L     ++   +G      V     +  E  L    ++ +   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VEI LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S        QE  + L  +   AL+ + K  + LP RI+V+RDGVGD  LQ   ++EV  +   I+ +  G  +  P++  V+VKKR+ ++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G   PT+YNV+ D   L          P+ +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ +HK  N
Sbjct:   61 AMLQISAGFQQVKIGERGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMR--LLSRPMWALYQY---HVDYKPPMESRRLRSALLFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY-NPD----------DPFNIPQHRLTIWPGFMTTILQY-----ESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGRPPPGP---------------------AMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTM--GQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGL---------KPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848          
BLAST of SMEDWI-2 vs. TrEMBL
Match: D2Z0D9 (DjPiwiB OS=Dugesia japonica OX=6161 GN=DjpiwiB PE=2 SV=1)

HSP 1 Score: 1529.23 bits (3958), Expect = 0.000e+0
Identity = 776/829 (93.61%), Postives = 806/829 (97.23%), Query Frame = 1
Query:   43 VAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            +AKLE NGSE RG+    G LRRTFRIVEPNLQPA+I EKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVF+QVG+ PKVKLQFIVRVCQEN+LPGAFCFDGRRLFTSEKWHGESDIQEF++D+KKMTLRLV+TILPETEEYYQMINVLLNNLQ+M+GQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEM+VDEKFEM GRTLSYAEYFK+RYNIRL+QGDQPFVLTRVKKPMRRER+K  EE  EK+KEKE+EKEAP++KDMTLNIPGELCFLCGFSDQEKSNMDLQK+LG VLKREPRERLDDIPA+CNWIK+SD A GMCNKWQLKI+NKPLEIEGRELPPCDVISG +KINEK+ DDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFM+DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS+KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVN PKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYK NGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG++P  INERIRNRLFYL
Sbjct:    1 MAKLETNGSENRGRGNRGG-LRRTFRIVEPNLQPAEIIEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFTQVGIPPKVKLQFIVRVCQENRLPGAFCFDGRRLFTSEKWHGESDIQEFTYDDKKMTLRLVATILPETEEYYQMINVLLNNLQIMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMSVDEKFEMSGRTLSYAEYFKDRYNIRLSQGDQPFVLTRVKKPMRRERRKPGEEDKEKDKEKEKEKEAPQDKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIKSSDNANGMCNKWQLKIENKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMSDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNSPAVINERIRNRLFYL 828          
BLAST of SMEDWI-2 vs. TrEMBL
Match: G9B7C2 (Piwi B (Fragment) OS=Seidlia auriculata OX=1051009 GN=piwiB PE=2 SV=1)

HSP 1 Score: 1120.53 bits (2897), Expect = 0.000e+0
Identity = 519/789 (65.78%), Postives = 642/789 (81.37%), Query Frame = 1
Query:  166 GNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFS-HDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            GNIG+TVKL SNF KF + + E + MYD V S +G++PK KL+ I +V + N L G FCFDGRRLFT EKWH ESDI+EF+  D+KK+T+RL++ +   TEEYYQM+NV+ NN+QV +GQERIG+ YFL  N  K ++ + SGPT+FE N+F+VLGGF TTLQRGT+P G  +TLLYIERINRVLN+NSV+ AY++   D L+GRD+ITKYNNKTYRIS+IKEM+V E+F++ GR LSY +YFKERYNI+L   +QPFVLTR+++ + R++K  +       +     +        TLNIPGELCFLCGFSDQEK N+DLQKNLG +LKREPR+RLDDIPA+C+WI   +       +W L+++N+PLEIEGRELPP DV+SGG K+NE++ DDWKFGRV+F     + +EID+VIVDRNDF Y+ F+ DV+ EL+N+ ++A+V  V  CGPND+E  L    R      KMA+VFVPDD+VYA+VK+FTMSTGLLTQCVTTRNGTNR DKRR+VV+SK+VMQIF+KFGYDPW+VEIKLRPTMIVG+DTYHNK+ KKSIQASV+SINSTFTQY+SFVNSP GRQEFHE LG+NF  AL+ F  +Y+I PQRI+++RDGVGD+Q+ FTK FE DA+KP++E +Y+  GFP+PQIIYV+VKKR+ TK F  G NP PGT+VDKE+VKPNFYEFFLVSQRTTKGTA+PTNYNVLEDT+LLTKKG+M+PMAPNELQKITY LTHLYFNWMGTIRVP P HYAHRLAEL+GK+HKG+NP  IN+RIR+RLFYL
Sbjct:    2 GNIGKTVKLASNFAKFQICQLETYYMYDVVLSDLGVAPKAKLKIISKVQEMNDLKGPFCFDGRRLFTGEKWHNESDIREFAAEDDKKVTIRLITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDIAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRADTLVGRDVITKYNNKTYRISDIKEMSVGEQFDLSGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTIVRKKKAPEGTEEVPVEPPPEPEPEM-----TLNIPGELCFLCGFSDQEKGNIDLQKNLGGILKREPRQRLDDIPAFCDWIGKCEKVNSFMKEWGLRVENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVRFATSSRKSYEIDIVIVDRNDFNYQKFIQDVKTELKNLNVNAKVTSVEKCGPNDIENILTSIMRQSRDAVKMAMVFVPDDKVYARVKNFTMSTGLLTQCVTTRNGTNRMDKRRQVVASKSVMQIFSKFGYDPWSVEIKLRPTMIVGLDTYHNKTGKKSIQASVYSINSTFTQYLSFVNSPHGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPPVINDRIRDRLFYL 785          
BLAST of SMEDWI-2 vs. TrEMBL
Match: G9B7B6 (Piwi B (Fragment) OS=Phagocata kawakatsui OX=1051007 GN=piwiB PE=2 SV=1)

HSP 1 Score: 956.822 bits (2472), Expect = 0.000e+0
Identity = 454/692 (65.61%), Postives = 563/692 (81.36%), Query Frame = 1
Query:  478 MINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK--------KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            M+NV+ NN+Q+ +GQERIG+ YFL  N  K ++ + SGPT+FE N+F+VLGGF TTLQRGT+P G  +TLLYIERINRVLN+NSV+ AY++   DQL+GRDIITKYNNKTYRIS+IKEM+V E+F++ GR LSY +YFKERYNI+L   +QPFVLTR+++ + R++K +  E  E+  E+   +  PE    TLNIPGELCFLCGFSDQEKSN DLQKNLG +LKREPR+RLDDIP   +WI  ++ A+    +W L+++N+PLEIEGRELPP DV+SGG K+NE++ DDWKFGRV+F I   + HEID+V++DRNDF Y+ F+ DV+ E+RN+ ++A+V  V  CGPND+E  LND  R      KMA+VFV DD+VYA+VK+FT+ TGLLTQCVTTRN TNR DKRR+VV+SK+VMQIF+KFGYDPW VEIKLRPTMIVG+DTYH+K+ K        KSIQASV+SINSTFTQY+SF+NSP+GRQEFHE LG+NF  AL+ F  +Y+I PQRI+++RDGVGD+Q+ FTK FE DA+KP++E +Y+  GFP+PQIIYV+VKKR+ TK F  G NP PGT+VDKE+VKPNFYEFFLVSQRTTKGTA+PTNYNVLEDT+LLTKKG M+PMAPNELQKITY LTHL     GTIRVP P HYAHRLAEL+GK+ KG+NP  IN+RIR+RLFYL
Sbjct:    1 MVNVMFNNIQLFMGQERIGRAYFLGANTDKRDIAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKPEKPENPEEAPEEPPAEPEPEM---TLNIPGELCFLCGFSDQEKSNNDLQKNLGGILKREPRQRLDDIP---DWIGKNEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFAISSRKNHEIDIVVIDRNDFNYQKFIQDVKTEIRNLNVNAKVTSVEKCGPNDIENVLNDIMRRSRDAVKMAMVFVADDKVYARVKNFTLQTGLLTQCVTTRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKTYHSKTGKKSIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGNMEPMAPNELQKITYTLTHL-----GTIRVPAPTHYAHRLAELIGKIRKGTNPAVINDRIRDRLFYL 681          
BLAST of SMEDWI-2 vs. TrEMBL
Match: T1E104 (PIWI-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 909.827 bits (2350), Expect = 0.000e+0
Identity = 441/820 (53.78%), Postives = 598/820 (72.93%), Query Frame = 1
Query:   70 ETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            E R     RGGL++ F I+EP LQPA+I EK G  G+ V L+SN+  F +     F MYD   S VG S + KL+ +  V    +    +CFDGRRLFT+ +WH  S+IQ F+  E++++LR +++ L  TEEYYQM+N++ NN+Q  +GQERIG+ +FL  N   DEV    GPTFF+ ++FK+LGGF TTL RGT   G  +TLLY+ERINRVLN+NSV   YN+  +D LIGRD+ITKYNNKTYRIS+IKE+++ ++ E+  + +SYA+YFK+RYNI L    QPFV++R+++   + ++  + E    ++  +           +L+IPGELCFLCGFSD E+SN++LQK+LG VLKREPRERL+DI  +C+W K   A + M  KW ++I+++P+ I+GREL   DV S   +IN K  DDWKFG V+FDI +  +H   ++++DRN  Q+  F++D+++E+  +RI+  +  V++C  N++E  L D  R       MA+VF+ DD+VYA+VK+FT+STGLLTQCVT RN TNR+D+RRKVV+ K+VMQ+FAK GYDPW VE+K+ PTM+VG+DT+H+K+ K+SIQASVFSI+  F+QY+SFVNS KG+ E+H+ L +NF  A++ FK +++ LPQR +++RDGVGD+QL FTK +E D +  L+E +Y+     +PQIIY+IVKKR+  K F  GNNPNPGT+VD+ +VKPNFYEF+LVSQRTTKGTATPTNYNVL DT+L    G   P+ P +LQ ITYALTHLYFNWMGTIRVPVP HYAHRLAELVG VH+G+NP  I++RIR RLFYL
Sbjct:    2 EERKPFVKRGGLQKRFYIIEPVLQPAEIVEKVGKEGKIVSLKSNYANFKLKPKGPFCMYDVKMS-VGKSLRGKLEILGAVAALKEPNEPYCFDGRRLFTASEWHN-SEIQSFTVKEEEVSLRFLTSFLENTEEYYQMVNIIFNNVQSFMGQERIGRAFFLGSNC--DEVTSRYGPTFFKKDNFKILGGFSTTLTRGTNNDGTASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEIDIKDEIELNDKKISYADYFKQRYNITLNHAKQPFVISRMRRIAIQRKENIENEPDAPKEADQ-----------SLSIPGELCFLCGFSDNERSNINLQKSLGSVLKREPRERLNDIADFCHWTKEGKADSFM-KKWGVEIEDQPITIKGRELNGVDVFSNRQRINTKSSDDWKFGEVKFDIPQGAQHRFGILVIDRNANQFNQFIDDMKREMSRLRINNTIEAVSSCRANEIEDALTDFVRVQK--VHMAIVFIGDDKVYARVKNFTISTGLLTQCVTIRNATNRDDRRRKVVADKSVMQMFAKLGYDPWGVELKMVPTMVVGLDTFHSKTGKRSIQASVFSISHKFSQYLSFVNSSKGKNEYHDNLVQNFTSAIKTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDEVLKLMEKLYE--NMRLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEMVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNNAGVKAPIPPGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 801          
BLAST of SMEDWI-2 vs. TrEMBL
Match: D2Z0D8 (DjPiwiA OS=Dugesia japonica OX=6161 GN=DjpiwiA PE=2 SV=1)

HSP 1 Score: 905.59 bits (2339), Expect = 0.000e+0
Identity = 442/813 (54.37%), Postives = 593/813 (72.94%), Query Frame = 1
Query:   94 RGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            RGGL+R F I+EP LQP  I +K G  GR V L+SN+  FS+     F MYD V     +  K++L       + +  P  FCFDGRRLFT+ KW+   D+++F+ +  ++++RL++T L  +EEYYQMIN++ NN+Q+ +GQE+IG+ +FL  N     +    GP+FF+  +FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+NSV+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+ +++ ++ G  +SY+ YFK+RYNI L    QPFV++R+K+      K+K E   E  KE ++          +L+IPGELC+LCGFSD E+SN++LQK+LG VLKREPRERL+DI  +C W     +   M N W + I+ +P+ I GRELPP D+ S   KIN K+ DDWKFG V+FD+ +   H   V++VDRN   + NF++DV++E+  +RI+  +  +++C  N+VE  L++  R       +ALVF+PDD++YAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI+S F+QY+SFVNS KG+ EFHE LGKNF  A+  F++++  +P R +++RDGVGD+QL FTK FE +A+  +IE IY+     +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQRTTKGTA+PTNYNVL DT+   KK   + PMAP+ LQ+IT++LTHLYFNWMGTIRVPVP HYAHRLAELVGKVH+G+ P  INERIR RLFYL
Sbjct:   16 RGGLQRRFAIIEPALQPETIIDKVGKDGRVVNLKSNYANFSIKVEGPFYMYDVVMEPKSIRSKLELLLAYGKTKGDGQP--FCFDGRRLFTTTKWNRTDDVEKFTVNNVEISIRLLTTFLKNSEEYYQMINIVFNNIQLFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMENFKILGGYSTTITRGTNDDGTASTLLYLERINRVLNENSVLAVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDFNDEIDLNGSKISYSNYFKQRYNINLKTDKQPFVISRIKRSAAHNPKEKSENEPEGPKEMDQ----------SLSIPGELCYLCGFSDSERSNLNLQKSLGGVLKREPRERLNDIKDFCKWTGGGKSKNFMTN-WNMSIEEQPITIRGRELPPVDIASNDVKINAKIPDDWKFGEVKFDVPKGIAHRFGVLVVDRNPNHFNNFIDDVKREIGRLRINYTIDNISSCRGNEVEEALSEFVRVNK--VHLALVFIPDDKIYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISSKFSQYISFVNSSKGKNEFHENLGKNFLTAITTFQQKFGTMPHRFIIYRDGVGDSQLAFTKKFETEAVMKMIEKIYENQN--LPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYNNKKTNEISPMAPSVLQQITFSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGATPPTINERIRERLFYL 809          
BLAST of SMEDWI-2 vs. Ensembl Cavefish
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:103023762])

HSP 1 Score: 283.108 bits (723), Expect = 1.467e-79
Identity = 235/854 (27.52%), Postives = 400/854 (46.84%), Query Frame = 1
Query:   46 AKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITE-----KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKV---KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEK-KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMK-AYNRR-----------SIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVG----KVNTCGPNDVERCLNDAARSGSGC-AKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSN 2484
            A L+ +    + K+G RGG RR F   +  +    + E     KTG  G  ++L++NF +  +L   ++ +Y      V   P +   +L+  +    +  L  A  FDG  LF   + H    +   E  H E+ ++T+ L + + P +    Q  N++   +  ML  ++IG+ Y+ +P+           P     +   +  GF T + +      E + +L  +  ++VL   +V+   YN R              +L+G  ++TKYNNKTYRI +I  +   +  F+ G   +S+ +Y+K +Y + +T G+Q  +++ VK+                                 L IP E C+L G +D+ +++ ++ K+L    +  P +R   +  +   I  +  A    + W L  +NK L + GR LP   ++ G    +      DW        +      E  ++   R +       +DV Q L     R+   +G    +       D +  L  A +   G   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W++EI L+  MIVG+D YH+ ++ K+SI A V S+N   +++ S        QE  + L      AL+ + K  + LP RI+V+RDGVGD  LQ   N+EV  +   I+ +  G  + +P++  V+VKKR+ ++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D   L          P+ +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ +HK  N
Sbjct:   59 ALLQISAGFQQVKIGERGGRRRDFH--DAGVHTRQLMEHVKESKTGVSGSKIELRANFMR--LLSRPQWALYQY---HVDFKPPMESRRLRSALLFQHDETLGKARTFDGAILFLPHRLHNTETVLCSETRHGERVQITVTLTNELPPSSPVCLQFYNIIFRRILRMLNMQQIGRHYY-NPD----------DPLNIPQHRLTIWPGFVTNILQY-----ESSIMLCTDVSHKVLRSETVLDFMYNLRKQCGDQRFPDACTKELVGLIVLTKYNNKTYRIDDIAWDHTPNNTFKRGDADISFKDYYKTQYGLDITDGNQVLLVSEVKRMGPSGAPPPGP---------------------ALLIP-EFCYLTGLTDKMRNDFNIMKDLSSHTRLTPEQRESRLNRFITNISRNTEAQNELSTWGLSFENKLLGLTGRVLPAERILQGSRTYDYNPWAADWSKEMRGLPLISSMPLESWLMFYTRRN-------SDVAQSLLQTLNRVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVGPDTQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TLSRPQALMTVATKIALQMNCKMGGELWSIEIPLKQLMIVGIDCYHDTAAGKRSIGALVASLNHGMSRWFSKCVLQSRGQEIIDGLKGALKGALKAYWKYNNCLPSRIIVYRDGVGDGMLQSVVNYEVPQIMQSIKTM--GEDY-MPKLTVVVVKKRIASRFFARIDGKLTNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVFDNSGL---------KPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 846          
BLAST of SMEDWI-2 vs. Ensembl Cavefish
Match: piwil2 (piwi like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:103024883])

HSP 1 Score: 188.734 bits (478), Expect = 6.110e-48
Identity = 187/839 (22.29%), Postives = 365/839 (43.50%), Query Frame = 1
Query:  157 EKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVK---LQFIVRVCQENKLPGAFCFDGRRLFTSEKW----HGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM-----------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQ-FDIKRDRKHEIDVVIVDRNDFQYKNFMN---------------DVEQELRNMRIDARVGKVN---TCGPN-DVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKK-SIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFP--VPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            +K G  G ++ + +N+      ++E    Y   F+     P V+   ++F +     +       FDG  L+  ++     H +++ ++  + E  + +++   + P  +      NV+L  +  ++G + +G+ ++          P N+       +  +V  G+ T ++      G L   L ++  ++VL ++SV+           + +      + +G  +IT+YNN+TYRI +IK   +  + F +  G   ++ +Y+++ Y I + + DQP ++                    + KE+ +           L +P EL F+ G  ++ + +    K+L   +     +    I      I ++  A     +W L+I  + L  +GR LP   +    +        DW    V+   I     +   V    R   Q +  +                 +  ELR+ R +  V  +    T  PN  +  C+    R               D +Y+ +K    + +   +Q +  R  T    ++ + ++ K ++Q+  K G + WTV + L+  M++G+D +H+ S KK S+   V S+NS  T++ S V      +E           AL+ + +     P++I+++RDGV D QL+  + +E+  +    E       FP   P++ +++V+KR+ T L++ G      P PGTV+D  +   ++ +FFL++    +G   PT+Y  + +T  LT         P+ LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+ +  S P     ++ ++L++L
Sbjct:  345 KKAGTKGNSITIGANYIPIRC-KNEAVFQYHVTFT-----PNVEALSMRFGMMKDHRSTTGEVVAFDGSILYLPKRLDEVVHLKAE-RKTDNQEIDIKIQMTKVLPPHCDLCIPFYNVVLRRVMKIVGLKLVGRDHY---------DPSNA--IVLGKHRLQVWPGYSTCIKETD---GGL--YLGVDVSHKVLRNDSVLNIMGVIYQQSPEHFQDECTKEFVGAIVITRYNNRTYRIDDIKWSKSPKDSFTLADGSETTFIDYYRKNYGITVKEIDQPLLV-------------------HRPKERSKPGGKQIITGEILLLP-ELSFMTGIPEKMRKDFRAMKDLTVHINVSAEQHTHSIKQLLQNINSNPEALNELQRWGLEISPEILMTQGRTLPMETICLQSASFVSSSSADWSREVVRDASISSIPLYCWAVFYPRRAAEQAEELVTMFGKVAGPIGIKLERPIRVELRDDRTETYVKSIQSQLTSEPNVQLVVCIITGNR---------------DDLYSAIKKLCCVQSPCPSQAINVR--TISQPQKLRSIAQKILLQMNCKLGGELWTVSVPLKHLMVIGVDVHHDVSKKKRSVMGFVASLNSLLTRWYSRVTFQMPNEEIINGFRVCLLAALQKYYEMNHSFPEKIVIYRDGVSDGQLKTVEQYEIPQILKCFET------FPNYEPKLTFIVVQKRISTTLYSYGGERFGTPPPGTVLDHTVTNKDWVDFFLMAHSIRQGCGLPTHYISVYNTANLT---------PDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQ-YLHSEPAI---QLADKLYFL 1104          
BLAST of SMEDWI-2 vs. Ensembl Cavefish
Match: piwil2 (piwi like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:103024883])

HSP 1 Score: 187.963 bits (476), Expect = 1.334e-47
Identity = 187/839 (22.29%), Postives = 365/839 (43.50%), Query Frame = 1
Query:  157 EKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVK---LQFIVRVCQENKLPGAFCFDGRRLFTSEKW----HGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM-----------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQ-FDIKRDRKHEIDVVIVDRNDFQYKNFMN---------------DVEQELRNMRIDARVGKVN---TCGPN-DVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKK-SIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFP--VPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            +K G  G ++ + +N+      ++E    Y   F+     P V+   ++F +     +       FDG  L+  ++     H +++ ++  + E  + +++   + P  +      NV+L  +  ++G + +G+ ++          P N+       +  +V  G+ T ++      G L   L ++  ++VL ++SV+           + +      + +G  +IT+YNN+TYRI +IK   +  + F +  G   ++ +Y+++ Y I + + DQP ++                    + KE+ +           L +P EL F+ G  ++ + +    K+L   +     +    I      I ++  A     +W L+I  + L  +GR LP   +    +        DW    V+   I     +   V    R   Q +  +                 +  ELR+ R +  V  +    T  PN  +  C+    R               D +Y+ +K    + +   +Q +  R  T    ++ + ++ K ++Q+  K G + WTV + L+  M++G+D +H+ S KK S+   V S+NS  T++ S V      +E           AL+ + +     P++I+++RDGV D QL+  + +E+  +    E       FP   P++ +++V+KR+ T L++ G      P PGTV+D  +   ++ +FFL++    +G   PT+Y  + +T  LT         P+ LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+ +  S P     ++ ++L++L
Sbjct:  375 KKAGTKGNSITIGANYIPIRC-KNEAVFQYHVTFT-----PNVEALSMRFGMMKDHRSTTGEVVAFDGSILYLPKRLDEVVHLKAE-RKTDNQEIDIKIQMTKVLPPHCDLCIPFYNVVLRRVMKIVGLKLVGRDHY---------DPSNA--IVLGKHRLQVWPGYSTCIKETD---GGL--YLGVDVSHKVLRNDSVLNIMGVIYQQSPEHFQDECTKEFVGAIVITRYNNRTYRIDDIKWSKSPKDSFTLADGSETTFIDYYRKNYGITVKEIDQPLLV-------------------HRPKERSKPGGKQIITGEILLLP-ELSFMTGIPEKMRKDFRAMKDLTVHINVSAEQHTHSIKQLLQNINSNPEALNELQRWGLEISPEILMTQGRTLPMETICLQSASFVSSSSADWSREVVRDASISSIPLYCWAVFYPRRAAEQAEELVTMFGKVAGPIGIKLERPIRVELRDDRTETYVKSIQSQLTSEPNVQLVVCIITGNR---------------DDLYSAIKKLCCVQSPCPSQAINVR--TISQPQKLRSIAQKILLQMNCKLGGELWTVSVPLKHLMVIGVDVHHDVSKKKRSVMGFVASLNSLLTRWYSRVTFQMPNEEIINGFRVCLLAALQKYYEMNHSFPEKIVIYRDGVSDGQLKTVEQYEIPQILKCFET------FPNYEPKLTFIVVQKRISTTLYSYGGERFGTPPPGTVLDHTVTNKDWVDFFLMAHSIRQGCGLPTHYISVYNTANLT---------PDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQ-YLHSEPAI---QLADKLYFL 1134          
BLAST of SMEDWI-2 vs. Ensembl Cavefish
Match: piwil2 (piwi like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:103024883])

HSP 1 Score: 162.54 bits (410), Expect = 7.427e-40
Identity = 129/514 (25.10%), Postives = 231/514 (44.94%), Query Frame = 1
Query: 1072 ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQ-FDIKRDRKHEIDVVIVDRNDFQYKNFMN---------------DVEQELRNMRIDARVGKVN---TCGPN-DVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKK-SIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFP--VPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            EL F+ G  ++ + +    K+L   +     +    I      I ++  A     +W L+I  + L  +GR LP   +    +        DW    V+   I     +   V    R   Q +  +                 +  ELR+ R +  V  +    T  PN  +  C+    R               D +Y+ +K    + +   +Q +  R  T    ++ + ++ K ++Q+  K G + WTV + L+  M++G+D +H+ S KK S+   V S+NS  T++ S V      +E           AL+ + +     P++I+++RDGV D QL+  + +E+  +    E       FP   P++ +++V+KR+ T L++ G      P PGTV+D  +   ++ +FFL++    +G   PT+Y  + +T  LT         P+ LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+ +  S P     ++ ++L++L
Sbjct:  626 ELSFMTGIPEKMRKDFRAMKDLTVHINVSAEQHTHSIKQLLQNINSNPEALNELQRWGLEISPEILMTQGRTLPMETICLQSASFVSSSSADWSREVVRDASISSIPLYCWAVFYPRRAAEQAEELVTMFGKVAGPIGIKLERPIRVELRDDRTETYVKSIQSQLTSEPNVQLVVCIITGNR---------------DDLYSAIKKLCCVQSPCPSQAINVR--TISQPQKLRSIAQKILLQMNCKLGGELWTVSVPLKHLMVIGVDVHHDVSKKKRSVMGFVASLNSLLTRWYSRVTFQMPNEEIINGFRVCLLAALQKYYEMNHSFPEKIVIYRDGVSDGQLKTVEQYEIPQILKCFET------FPNYEPKLTFIVVQKRISTTLYSYGGERFGTPPPGTVLDHTVTNKDWVDFFLMAHSIRQGCGLPTHYISVYNTANLT---------PDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQ-YLHSEPAI---QLADKLYFL 1103          
BLAST of SMEDWI-2 vs. Ensembl Cavefish
Match: ago3b (argonaute RISC catalytic component 3b [Source:NCBI gene;Acc:568159])

HSP 1 Score: 118.242 bits (295), Expect = 2.278e-26
Identity = 112/451 (24.83%), Postives = 187/451 (41.46%), Query Frame = 1
Query: 1219 ATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGS--KINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARV---GKVNTC----GPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMST-GLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS---KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPL---IENIYKGNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA-----ELVGKVHKGSN 2484
            A     ++Q ++ ++  E+ GR LP   +  GG    +       W     QF    + K         +   + +  +     +LR +  DA +   G+   C    G + VE        + +G   + ++      VYA+VK    +  G+ TQCV  +N            S +T+  +  K            +P + +G D  H  +    K SI A V S+++  ++Y + V   + RQE  + L       L  F K     P R++ +RDGV + Q +    +E+ A++     +E  Y+      P I Y++V+KR  T+LF         R  N   GT VD +I  P  ++F+L S    +GT+ P++Y+VL D    T          +E Q +TY L H Y     ++ +P P +YAH +A      LV K H  + 
Sbjct:  322 ADPFVQEFQFRVRDEMAEVTGRVLPAPMLQYGGRNRTVATPSHGVWDMRGKQFHTGVEIKMWAIACFATQRQCR-EEILKSFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVVK--------TSPQTLSNLCLKINRCAL-----FQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQEIIQDLASMVRELLIQFYKSTRYKPTRLIFYRDGVSEGQFRQVLYYELLAIREACISLEREYQ------PGITYIVVQKRHHTRLFCADRNERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTA---------DEFQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAE 743          
BLAST of SMEDWI-2 vs. Ensembl Sea Lamprey
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:572134])

HSP 1 Score: 231.491 bits (589), Expect = 1.391e-63
Identity = 195/740 (26.35%), Postives = 340/740 (45.95%), Query Frame = 1
Query:  415 EKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKA-------------YNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEK--FEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFD-IKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAAR---SGSGCAKMALVFVP---DDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKS-SKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPV------PQIIYVIVKKRVGTKLF--NRG--NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            E  ++++    I P+++    + N++   +  +L  + IGK Y           PR   P         +  G+   +Q   K  G L  +L +   +RVL  +SV++              +       L+G  +IT+YNN+TYRI +I      +       G+T+S+ EY+K +Y I +    QP +L                      + K+R +   +    T+ +  EL ++ G +D  +S+  + K +   ++  P  R + +  + + +K +  A    + W L++D+   ++ GR+LPP  +             DW    V    I         V+   R+ F    F+  +      M +  ++  +    PND  +   D  R   S S   +M +   P   DDR Y+ VK    +   + +Q V TR  T    KR + V+ K V+Q+  K G + W ++I L+  M+VG+D +HN    K+S+   V S+N + +++ S V      QE  + L      A++ + +    LP++I+++RDGV DNQL   ++FEV  +          NGF        P+++ V+V+KR+ T +F  N G   N   G+V+D       +++FFLVSQ   +GT +PT+Y V+ ++  L+          + +Q++TY +THLY+NW GT+RVP P  YAH+LA LVG+ +H   +P      + ++LF+L
Sbjct:  100 EITLSIKCTKIIKPDSDLCLPIYNIIFKKIMRLLELKLIGKSYL---------NPRQ--PIVINRYRIHIWPGYVVAVQ---KKDGGLMLMLDVS--HRVLRMDSVLEVMTHLYESCQSSANFQEECTKALVGHVVITRYNNRTYRIDDIAWDKTPKSTFLNSAGKTMSFVEYYKTQYEITIDDLGQPLLL---------------------HRAKQRNRTDDQVVIQTICLIPELAYMTGITDLMRSDFSMMKAISEHMRLGPSLRHNSLMEFISNVKRNPEAQQELSNWGLQMDSDIYKLSGRQLPPEIIRLQYKAFAFSPEADWTRHIVNTPCITAVAMKNWQVLCTHRDSFLVHEFVTMMCNVGPPMGLVHQLPNIIEL-PNDHTKTYIDCIRKNYSYSQGVQMVMCIFPTLRDDR-YSTVKQVCCVELAVPSQVVQTR--TISQQKRLRSVAQKVVLQMNCKLGGELWILDIPLKNLMVVGVDVFHNVVLGKQSVVGFVASMNRSVSRWYSRVVRQSTSQELVDGLNLCMTSAIKKYYELNHYLPEKIIMYRDGVSDNQLAIVRDFEVMQLT---------NGFRTFDLSYQPKMLVVVVQKRISTNIFLNNSGAMENAPSGSVLDTVATSQEWFDFFLVSQHVRQGTVSPTHYVVIFNSLKLSA---------DHVQRLTYKMTHLYYNWSGTVRVPAPCQYAHKLASLVGENLHSDPDP-----GLCDKLFFL 775          
BLAST of SMEDWI-2 vs. Ensembl Sea Lamprey
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:368200])

HSP 1 Score: 202.986 bits (515), Expect = 9.676e-54
Identity = 222/890 (24.94%), Postives = 401/890 (45.06%), Query Frame = 1
Query:   34 PVKVAKLEANGSETRGKMG-NRGGLRR-TFRIVEPNLQPADITE-----KTGN--IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKV--KLQFIVRVCQENKLPGAF-CFDGRRLFTSEKWHGESDIQEFSHDEKKM--TLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTF-FETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKF-EMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP---------------NDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETL-----GKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            PV    L + G E  G M  +RGG RR   + ++  L      E     KTG    G+ VKL +N+  F ++  + +M+Y      V  SP++  K   I  + + N+L G    FDG  L+  +K    S++   +  E+K+  T+ L + + P +     + N++   +  M+  ++IG+ Y+            N    F    +   V  GF T++        E   +L  +  +++L + SV+            + ++     +L+G+ I+T+YNN+TYRI +I    N    F +  G  ++Y EY+ + Y++ +    QP +++R K+     +  + E                      L++  E+ +L G SD+ +S+  L K+LG   +  P +R      +   ++++        KW L  D + L + GR +P C+      K+ +K    +++ + Q D  R+ ++   +  +   ++    F ++   E R     A V  +   GP               +  +  +    ++ +   +M +  +P      Y  +K F  +     +QCV  R  T    +  + V++K  +Q+  K G + W+VEI ++  M+VG+D+YH+  ++ +S+   V S+N T T++ S        QE  + L      KNF ++L+      D++   ++++        L F  ++   +                P++  V+VKKR   + F  G     NP+PGTV+D E  +  +Y+F+LVSQ   +GT TPT+YNV+ DT           M P+ +Q++ Y + HLY+NW G IRVP P HYAH+LA LVG+ +HK       +  + +RL+YL
Sbjct:   75 PVTDVSLVSAGME--GLMVVDRGGRRRGQMQAMDVGLMTRQTMEHVRQSKTGERLSGQPVKLLTNY--FKLMSRKMWMVYQY---HVTFSPELESKRLRIALLHEHNELLGETRAFDGCILYLPKKLEKVSEVWSKTRQEQKIKITITLTNELPPSSPTAIVLFNIIFRKVLKMVNMQQIGRNYY------------NPDDAFTIPQHRLHVWPGFVTSIM-----CYESDVMLCADVSHKILRNESVLDFMYTLFEQIEERHFHDACQKELVGQVILTRYNNRTYRIDDISWNRNPSMTFLKSDGTEVTYYEYYTKHYSLEVKDMQQPLLISRSKRKDSVGKTVEIE----------------------LHLLPEISYLTGLSDKMRSDFHLMKDLGLQTQVGPDKRAMTTQKFIEKLQSNPETCNEFAKWGLSFDRQLLSLTGRVVP-CE------KLYQK-DQSYQYNQRQADWSRESRNMKLMTPISLEEWMLL-FTHNNSNEAR-----AIVDNLMQVGPPMGMHINKPEMFEVLDRAQSFVQTLQQNLNHHTQMVMCVLPTIHKGKYDSIKQFLCVERPFPSQCVLAR--TLSKPQMIRSVATKIALQMNCKLGGELWSVEIPIKQLMVVGVDSYHDSITRGQSVCGFVASLNQTLTRWYSRCIFQHAAQEMIDGLKVCMQCKNF-ISLQIASHSNDVMINVVIIYF-------LSFLNSYCCGSR---------------PKVTVVVVKKRGIARFFEFGRSGLQNPSPGTVIDTEATRHEWYDFYLVSQSVRQGTVTPTHYNVVYDT---------SNMKPDHMQRLAYKMCHLYYNWPGVIRVPAPCHYAHKLAFLVGQSIHKEP-----SLDLSDRLYYL 865          
BLAST of SMEDWI-2 vs. Ensembl Sea Lamprey
Match: ago2 (argonaute RISC catalytic component 2 [Source:ZFIN;Acc:ZDB-GENE-110606-6])

HSP 1 Score: 105.531 bits (262), Expect = 4.855e-25
Identity = 75/243 (30.86%), Postives = 114/243 (46.91%), Query Frame = 1
Query: 1783 RPTMIVGMDTYH---NKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF---------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVL-EDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVH 2472
            +P + +G +  H       K SI A V S+++  ++Y + V     RQE  + LG      L  F K     P RI+ +RDGV + Q Q     E+ A++     + K      P I YV V+KR  T+LF           GN P   T VD +I  P+ ++F+L S    +GT+ P++Y+VL +D R           + +ELQ +TY L H Y     ++ +P P +YA RL     + H
Sbjct:    8 QPVIFLGAEVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQHHRQEIIQDLGTMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLFHELLAIRDACIKLEKDYQ---PGITYVAVQKRHHTRLFCADRNERIGKSGNIPAGTTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNRF----------SADELQVLTYQLCHTYVRCTRSVSIPAPAYYA-RLVAFRARYH 236          
BLAST of SMEDWI-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009610.1 (pep scaffold:Pmarinus_7.0:GL477777:44890:66775:1 gene:ENSPMAG00000008651.1 transcript:ENSPMAT00000009610.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.102e-9
Identity = 70/268 (26.12%), Postives = 113/268 (42.16%), Query Frame = 1
Query: 1438 KNFMNDVEQELRNMRIDARV---GKVNTC----GPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMST-GLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPT------MIVGMDTYHNKSS---KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPL---IENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNN 2181
            KNF +    +LR +  DA +   G+   C    G  +VE        +  G   + ++      VYA+VK    +  G+ TQCV  +N    + +      S   ++I  K G     +   +RP       + +G D  H  +    K SI A V S+++  ++Y + V   + RQE    L       L  F K     P RI+ +RDGV + Q Q     E+ A++     +E  Y+      P I +++V+KR  T+LF    N
Sbjct:  469 KNFTD----QLRKISKDAGMPIQGQPCFCKYAQGAENVEPMFRHLKNAYMGLQLIVVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVLKTSPQ----TLSNLCLKINVKLGGVNNILVPHIRPAVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQQHRQEIIHDLSSMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLYHELLAIREACIRLEKEYR------PGITFIVVQKRHHTRLFCADRN 722          
BLAST of SMEDWI-2 vs. Ensembl Nematostella
Match: EDO49931 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFC2])

HSP 1 Score: 255.758 bits (652), Expect = 1.055e-70
Identity = 229/831 (27.56%), Postives = 387/831 (46.57%), Query Frame = 1
Query:  160 KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKV---KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGE-------SDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM----KAYNR---------RSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVI--SGGSKINEKMGDDWKFGRVQFDIKRDRKHEI----DVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLND----------AARSGSGCAKMALVFVPDDRV--YAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFT---QYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKG--NGFPVPQIIYVIVKKRVGTKLFNRGN---------NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHK 2475
            K G++G  V + SN+ +           Y+     V  SP+V   K +F +   Q   L     FDG  LF  +K   +          +E   +  ++T+ L + +  ++     + N++L  +   +  +++G+ Y+   N     +P++           ++  G+ T++ +      E + LL  +  ++VL   +V+    + YN+          +  +L+G  ++T+YNNKTYR+ +I      +  F      +S+ +Y+K+ Y+  +T  +QP + ++ KK    +                            L +P ELCFL G SD  +++  + K+L    + +P+ R  D+    + I N+  A+G  + W L+     L+ +GR LP   +   + GS  + K  D W       +I+    H      + VIV  N  +      D +Q L   R+   +G +NT  P  V   LND          +    +   ++ +  VP +R   Y  +K    +  G+ +Q V +R  + +  +    V +K  +Q+  K G + W V+I L+  MIVG+DTYH+ S K +S+   V S+N   T   +Y S        QE  + L      AL  +++   +LP +I+VFRDGVGD QL+     EV    P I + +K   +G+  P+  + +VKKR+ T+LF R           NP PGTVVDKE+ +  +++FF+VSQ   +GT +PT+YNV+ DT  L          P+  Q+++Y LTHLY+NW GT+RVP P  YAH+LA LVG+ +HK
Sbjct:  104 KEGSVGTKVGIVSNYFRLETRPQAAIYQYN-----VSFSPEVDFKKARFALIGEQRELLGNIRAFDGMVLFLPKKLPDQVTKIMAVRTRRETPDEPVEITITLTNELPADSPTCLHLFNIILKRILKYIDMKQVGRNYYYIKNAI--AIPKHG---------LELWPGYTTSILKY-----EHSILLGADVSHKVLRKQTVLDFLYELYNKMQGRGNFHDEAAKKLVGEIVLTRYNNKTYRVDDIDWNKRPNSTFTTPKGEISFNDYYKKNYDFTITDQEQPLLFSKPKKRKGADDP-------------------------VLLLP-ELCFLTGLSDDMRADFSVMKDLAVHTRLDPKARSKDLNKLISEINNNPDASGELSGWGLRFGRNLLDFDGRILPGEKIFQKNKGSNYDPKSAD-W-----SREIRGAPLHSTVNLENWVIVHTN--RDSGVATDFQQTL--ARVCGPMG-INTTKPRMVP--LNDDRTDSYLKALSNEIQADFPQIVVTIVPSNRKDRYDSIKKLCCLEKGVPSQVVVSRTLSKK--QMLMSVCTKIGIQLNCKLGGEAWAVDIPLKNLMIVGIDTYHDSSQKGRSVGGFVASLNKPCTRQREYYSRCTFQHSGQELVDGLKVCMTAALRQWQQINGVLPDKIIVFRDGVGDGQLRAVIEHEV----PQILSTFKQFQDGYD-PKFGFTVVKKRIQTRLFMREARDPDMRNLMNPPPGTVVDKEVTRSEWFDFFIVSQSVRQGTVSPTHYNVIHDTTGLR---------PDHWQQLSYKLTHLYYNWPGTVRVPAPCQYAHKLAFLVGQSLHK 858          
BLAST of SMEDWI-2 vs. Ensembl Nematostella
Match: EDO34027 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQI3])

HSP 1 Score: 249.595 bits (636), Expect = 1.357e-69
Identity = 198/722 (27.42%), Postives = 342/722 (47.37%), Query Frame = 1
Query:  448 ILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIER--------INRVLNDNSVMKAYNRRSID-QLIGRDIITKYNNKTYRISEI---KEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRK------HEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVP---DDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKS-SKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDI---LPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFN---RGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            ++P  +  +Q+ N+L   +  +L  +++G+ YF +P            P     ++  +  G+ T+LQ      G L  L  +          ++ +LN +S +    R  +  +LIG  ++T YNNKTYR+ +I   K       F   G  +++ EY+K+ Y I +   DQP ++ R KK  ++     +                       L IP ELC L G +D  + +  + K++    +  P +R + +  +   I ++  A      W L++D   L  EGR+ PP  +I G +      GD   +GR   D  R++       +   V    R+  +  +F+  + +    M I     K+N    +  E  L     +     ++ +V  P   DDR  A  K   + + + +Q + ++  T  N  + + V  K  +QI  K G + W ++I  R  M+ G+D YH+K+   +S+   V S+N + T++ S V      QE  + L     L ++  +K +D+   LP+RI+V+RDGVGD QL+    +EV   +    +   G  +  P++  ++V+KR+ T++F+   R  NP PG+V+D  + + ++ +FFLVSQ   +GT TPT+Y V+ DT             P+ +QK++Y LTHLY+NW GT+RVP P  YAH+LA  VG+   G      ++ + +RLF+L
Sbjct:   89 VVPPDDAIFQVYNILFRRVMKILDMQQVGR-YFYNPKT----------PAHIPQHNLVLWPGYITSLQHYE---GGLMLLCDVHHRLLRTDSCLDYMLNMHSKVGDRFRDEVSKELIGSVVLTTYNNKTYRVDDIDWNKRPTSTFTFH-NGEQMTFVEYYKKSYEIEIRDLDQPMIVNRPKKTEQKRGGVIEV---------------------ILLIP-ELCKLTGLNDAMRKDFRVMKDIAAHTRVNPMQRQEAMKKFVMSINSTPEALEQLTAWNLRLDTSTLMTEGRQFPPEKIIYGNT--TGSAGDQADWGR---DATREKVISAVNLNNWMVFFTQRDSGKANDFVQTMNKCAPAMGIQVNQPKMNQLRDDRTETYLRSIRENLHPQVQVVVVIFPTSRDDRYAAVKKLCCVESPVPSQVIISK--TISNPTKLRSVVQKIALQINVKLGGELWALDIPSRSLMVCGIDVYHDKARGGRSVGGLVCSMNRSLTRWYSDVCFQSPGQELIDGLKM---LLIKGIRKWHDVNNALPERIIVYRDGVGDGQLKVVAGYEVQQFEECFASF--GESYK-PKLAVLVVQKRINTRIFSAEPRLGNPGPGSVLDHTVTRKDWNDFFLVSQHVRQGTVTPTHYVVVYDT---------SNWKPDIMQKLSYKLTHLYYNWPGTVRVPAPCQYAHKLAYQVGQSIHGQP----SQELCDRLFFL 747          
BLAST of SMEDWI-2 vs. Ensembl Nematostella
Match: EDO46431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQ46])

HSP 1 Score: 128.642 bits (322), Expect = 5.198e-30
Identity = 115/439 (26.20%), Postives = 189/439 (43.05%), Query Frame = 1
Query: 1240 WQLKIDNKPLEIEGRELPPCDVISGG----SKINEKMGDDWKF-GRVQFDIKRDRKHEIDVVIVDR--NDFQYKNFMNDVEQELRNMRIDARVGKVNTC---------GPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSF--TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRP------TMIVGMDTYHNKSS---KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA 2451
            + + I    +E++GR LPP  ++ GG     KI       W   GR  F     R   I   +  +   +   + F N +      M+I    G   +C          P++VER       +      + +V      VYA+VK    TM  G++TQC+  +N T  + +      S   ++I AK G     +  ++RP       + +G D  H  +    + S+ A V S+++  ++Y + V     RQE    L       L  F +     PQRI+ +RDGV + Q +     E+ A++     +  G     P I +++V+KR  T+LF         +  N  PGT VD+ I  P  ++F+L S    +GT+ P++Y+VL D          +  + +ELQ +TY L H Y      + +P P +YAH +A
Sbjct:  389 FSISIGKNMVELQGRVLPPPKLVYGGKVRIEKIIHSFSGVWDMRGRQLFHGIEIRTWAIACFVKQQMCTEDSLRRFSNQL------MKISVEQGMPISCPPVFFRYARNPDEVERMFRRLKEAHPDLQMILVVLPGKTPVYAEVKRVGDTM-LGVITQCIQGKNVTKPSPQ----TLSNLCLKINAKLGGVNNILAPEIRPPVFREPVIFLGADVTHPAAGDDKRPSVAAVVGSMDAHPSRYYASVRVQTHRQEIIAELAAMVRELLVQFYRSTRHKPQRIVFYRDGVSEGQFRQVLVHELKAIREACIKLEVGYQ---PGISFIVVQKRHHTRLFCQRDQDKCGKSGNVPPGTTVDRGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDD---------NNFSADELQALTYQLCHTYVRCTRAVSIPAPAYYAHLVA 804          
BLAST of SMEDWI-2 vs. Ensembl Nematostella
Match: EDO28124 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7C9])

HSP 1 Score: 60.4622 bits (145), Expect = 3.034e-10
Identity = 45/181 (24.86%), Postives = 83/181 (45.86%), Query Frame = 1
Query: 1783 RPTMIVGMDTYHNKS-SKKSIQASVFSINSTFTQYMSFV--NSP-------------KGRQEFHETLGK---------------------------------NFNLALEDFKKRYDI---LPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFN 2169
            R  M+ G+D YH+K+   +S+   V S+N + T++ S V   SP             KG +++H+ + K                                 N  + ++  +K +D+   LP+RI+V+RDGVGD QL+    +EV   +    +   G  +  P++  ++V+KR+ T++F+
Sbjct:    1 RSLMVCGIDVYHDKARGGRSVGGLVCSMNRSLTRWYSDVCFQSPGQELIDGLKMLLIKGIRKWHDAIRKWHDVCYLTMFVSLSRPSGSGMMPSGSGMMYVIFNVCVLIKAIRKWHDVNNALPERIIVYRDGVGDGQLKVVAGYEVQQFEECFASF--GESYK-PKLAVLVVQKRINTRIFS 178          
BLAST of SMEDWI-2 vs. Ensembl Medaka
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:100301587])

HSP 1 Score: 275.404 bits (703), Expect = 5.824e-77
Identity = 243/866 (28.06%), Postives = 406/866 (46.88%), Query Frame = 1
Query:   46 AKLEANGSETRGKMGNRGGLRRTFRIVEPN---LQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKV---KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEKKM-TLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM--------KAYNRRSID----QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM-----RIDARVGKVNTCGPNDVERCLNDAARSGSG-CAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            A L+ +    + K+G RGG RR F     N   L       K G  G  ++L +NF  + +L   ++++Y      V   P +   +L+  +       +  A  FDG  L    + H +  +   E    EK + T+ L + + P +    Q  N+L   +  +L  ++IG+ Y+          P+N  P     ++  +  G+ TT+ +      E + +L  +  ++VL   +V+        K  N+R  D    +LIG  ++TKYNNKTYRI +I  +      F  G   +S+  Y+K +Y + +T  +Q  +++ VKK                                 + IP ELC+L G +D+ +S+  + ++L    +  P +R+  +  +   I  +        KW +  DN  L +  R L P  +  G    +   M  DW   R    I       ++  I+    F  +   N+ +  L+ +      +  R+ +       D +  L  A +   G   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VEI L+  MIVG+D YH+ S+ K+SI A V S+N + +++ S        QE  + L   F  AL+D+ K  + LP RI+V+RDGVGD QL    NFE+  +   I+++  G  +  P++  V+VKKR+ ++ F    ++ +NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ DT  L          P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N ++ N LFYL
Sbjct:   57 ALLQISAGFQQIKLGERGGHRRDFNDFGVNTRQLMEHVKESKCGTSGSPIQLTANF--YRILSRPQWVLYQY---HVDFKPPMESRRLRTALLYRHAEVIGDARTFDGALLILPRRLHCKETVLYSETKSGEKVLITVTLTNELPPTSPVCIQFYNILFKRVLRLLEMQQIGRNYY---------NPKN--PLNIPEHNLTIWPGYSTTILQY-----ESSIMLCTDVSHKVLRSETVLDFMVNLRQKCGNQRFPDACAKELIGLIVLTKYNNKTYRIDDIAWDHTPKNTFTRGDADISFMNYYKTQYGLDITDVNQVLLVSHVKKRTGPGGGPPLGP--------------------AMLIP-ELCYLTGLTDKMRSDFTIMRDLSENTRLSPDKRISRLSGFIEDICGNAGVQEELKKWGIGFDNHLLNLSARVLAPERIFQGPRSYDYNPMSGDW--SREMRGIPIISSPPLNNWIM----FSTRRNSNEAQSLLQTLGKVSGPLGLRLQRAVMIEYEDHQESLLRALKQNVGPTTQMVVVVLPSNRKDKYDSVKKYLCVDCPTPSQCVLSR--TLSRPQALMTVATKIALQMSCKMGGELWSVEIPLKQLMIVGIDCYHDISAGKRSIGAMVASLNQSMSRWYSKCVLQHKGQELMDGLKMAFTGALKDYLKFNNCLPSRIIVYRDGVGDGQLHSVVNFEISQILESIKSL--GQDYN-PKVSVVVVKKRISSRFFAMINDKVSNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVYDTSGL---------KPDHMQRLTYKLCHMYYNWQGLIRVPAPCQYAHKLAFLVGQSIHREP-----NIKLDNYLFYL 855          
BLAST of SMEDWI-2 vs. Ensembl Medaka
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:100301587])

HSP 1 Score: 271.552 bits (693), Expect = 5.954e-76
Identity = 244/869 (28.08%), Postives = 407/869 (46.84%), Query Frame = 1
Query:   37 VKVAKLEANGSETRGKMGNRGGLRRTFRIVEPN---LQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKV---KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEKKM-TLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM--------KAYNRRSID----QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM-----RIDARVGKVNTCGPNDVERCLNDAARSGSG-CAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            V+V  L+ +    + K+G RGG RR F     N   L       K G  G  ++L +NF  + +L   ++++Y      V   P +   +L+  +       +  A  FDG  L    + H +  +   E    EK + T+ L + + P +    Q  N+L   L   L  ++IG+ Y+          P+N  P     ++  +  G+ TT+ +      E + +L  +  ++VL   +V+        K  N+R  D    +LIG  ++TKYNNKTYRI +I  +      F  G   +S+  Y+K +Y + +T  +Q  +++ VKK                                 + IP ELC+L G +D+ +S+  + ++L    +  P +R+  +  +   I  +        KW +  DN  L +  R L P  +  G    +   M  DW   R    I       ++  I+    F  +   N+ +  L+ +      +  R+ +       D +  L  A +   G   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VEI L+  MIVG+D YH+ S+ K+SI A V S+N + +++ S        QE  + L   F  AL+D+ K  + LP RI+V+RDGVGD QL    NFE+  +   I+++  G  +  P++  V+VKKR+ ++ F    ++ +NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ DT           + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N ++ N LFYL
Sbjct:   24 VRVTLLQISAGFQQIKLGERGGHRRDFNDFGVNTRQLMEHVKESKCGTSGSPIQLTANF--YRILSRPQWVLYQY---HVDFKPPMESRRLRTALLYRHAEVIGDARTFDGALLILPRRLHCKETVLYSETKSGEKVLITVTLTNELPPTSPVCIQFYNILFKRL---LEMQQIGRNYY---------NPKN--PLNIPEHNLTIWPGYSTTILQY-----ESSIMLCTDVSHKVLRSETVLDFMVNLRQKCGNQRFPDACAKELIGLIVLTKYNNKTYRIDDIAWDHTPKNTFTRGDADISFMNYYKTQYGLDITDVNQVLLVSHVKKRTGPGGGPPLGP--------------------AMLIP-ELCYLTGLTDKMRSDFTIMRDLSENTRLSPDKRISRLSGFIEDICGNAGVQEELKKWGIGFDNHLLNLSARVLAPERIFQGPRSYDYNPMSGDW--SREMRGIPIISSPPLNNWIM----FSTRRNSNEAQSLLQTLGKVSGPLGLRLQRAVMIEYEDHQESLLRALKQNVGPTTQMVVVVLPSNRKDKYDSVKKYLCVDCPTPSQCVLSR--TLSRPQALMTVATKIALQMSCKMGGELWSVEIPLKQLMIVGIDCYHDISAGKRSIGAMVASLNQSMSRWYSKCVLQHKGQELMDGLKMAFT-ALKDYLKFNNCLPSRIIVYRDGVGDGQLHSVVNFEISQILESIKSL--GQDYN-PKVSVVVVKKRISSRFFAMINDKVSNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVYDT---------SGLKPDHMQRLTYKLCHMYYNWQGLIRVPAPCQYAHKLAFLVGQSIHREP-----NIKLDNYLFYL 821          
BLAST of SMEDWI-2 vs. Ensembl Medaka
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:100301587])

HSP 1 Score: 233.032 bits (593), Expect = 1.213e-61
Identity = 222/830 (26.75%), Postives = 382/830 (46.02%), Query Frame = 1
Query:   46 AKLEANGSETRGKMGNRGGLRRTFRIVEPN---LQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSP-----KVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEKKM-TLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM--------KAYNRRSID----QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMR-----IDARVGKVNTCGPNDVERCLNDAARSGSG-CAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRV 2418
            A L+ +    + K+G RGG RR F     N   L       K G  G  ++L +NF  + +L   ++++Y      V   P     +++   + R      +  A  FDG  L    + H +  +   E    EK + T+ L + + P +    Q  N+L   +  +L  ++IG+ Y+          P+N  P     ++  +  G+ TT+ +      E + +L  +  ++VL   +V+        K  N+R  D    +LIG  ++TKYNNKTYRI +I  +      F  G   +S+  Y+K +Y + +T  +Q  +++ VKK                                 + IP ELC+L G +D+ +S+  + ++L    +  P +R+  +  +   I  +        KW +  DN  L +  R L P  +  G    +   M  DW   R    I       ++  I+    F  +   N+ +  L+ +      +  R+ +       D +  L  A +   G   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VEI L+  MIVG+D YH+ S+ K+SI A V S+N + +++ S        QE  + L   F  AL+D+ K  + LP RI+V+RDGVGD QL    NFE+  +   I+++  G  +  P++  V+VKKR+ ++ F    ++ +NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ DT           + P+ +Q++TY L H+Y+NW  +I +
Sbjct:   57 ALLQISAGFQQIKLGERGGHRRDFNDFGVNTRQLMEHVKESKCGTSGSPIQLTANF--YRILSRPQWVLYQY---HVDFKPPMESRRLRTALLYR--HAEVIGDARTFDGALLILPRRLHCKETVLYSETKSGEKVLITVTLTNELPPTSPVCIQFYNILFKRVLRLLEMQQIGRNYY---------NPKN--PLNIPEHNLTIWPGYSTTILQY-----ESSIMLCTDVSHKVLRSETVLDFMVNLRQKCGNQRFPDACAKELIGLIVLTKYNNKTYRIDDIAWDHTPKNTFTRGDADISFMNYYKTQYGLDITDVNQVLLVSHVKKRTGPGGGPPLGP--------------------AMLIP-ELCYLTGLTDKMRSDFTIMRDLSENTRLSPDKRISRLSGFIEDICGNAGVQEELKKWGIGFDNHLLNLSARVLAPERIFQGPRSYDYNPMSGDWS--REMRGIPIISSPPLNNWIM----FSTRRNSNEAQSLLQTLGKVSGPLGLRLQRAVMIEYEDHQESLLRALKQNVGPTTQMVVVVLPSNRKDKYDSVKKYLCVDCPTPSQCVLSR--TLSRPQALMTVATKIALQMSCKMGGELWSVEIPLKQLMIVGIDCYHDISAGKRSIGAMVASLNQSMSRWYSKCVLQHKGQELMDGLKMAFTGALKDYLKFNNCLPSRIIVYRDGVGDGQLHSVVNFEISQILESIKSL--GQDYN-PKVSVVVVKKRISSRFFAMINDKVSNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVYDT---------SGLKPDHMQRLTYKLCHMYYNWQVSISL 822          
BLAST of SMEDWI-2 vs. Ensembl Medaka
Match: piwil1 (piwi like RNA-mediated gene silencing 1 [Source:NCBI gene;Acc:100301587])

HSP 1 Score: 233.032 bits (593), Expect = 1.213e-61
Identity = 222/830 (26.75%), Postives = 382/830 (46.02%), Query Frame = 1
Query:   46 AKLEANGSETRGKMGNRGGLRRTFRIVEPN---LQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSP-----KVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEKKM-TLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM--------KAYNRRSID----QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMR-----IDARVGKVNTCGPNDVERCLNDAARSGSG-CAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRV 2418
            A L+ +    + K+G RGG RR F     N   L       K G  G  ++L +NF  + +L   ++++Y      V   P     +++   + R      +  A  FDG  L    + H +  +   E    EK + T+ L + + P +    Q  N+L   +  +L  ++IG+ Y+          P+N  P     ++  +  G+ TT+ +      E + +L  +  ++VL   +V+        K  N+R  D    +LIG  ++TKYNNKTYRI +I  +      F  G   +S+  Y+K +Y + +T  +Q  +++ VKK                                 + IP ELC+L G +D+ +S+  + ++L    +  P +R+  +  +   I  +        KW +  DN  L +  R L P  +  G    +   M  DW   R    I       ++  I+    F  +   N+ +  L+ +      +  R+ +       D +  L  A +   G   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VEI L+  MIVG+D YH+ S+ K+SI A V S+N + +++ S        QE  + L   F  AL+D+ K  + LP RI+V+RDGVGD QL    NFE+  +   I+++  G  +  P++  V+VKKR+ ++ F    ++ +NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ DT           + P+ +Q++TY L H+Y+NW  +I +
Sbjct:   57 ALLQISAGFQQIKLGERGGHRRDFNDFGVNTRQLMEHVKESKCGTSGSPIQLTANF--YRILSRPQWVLYQY---HVDFKPPMESRRLRTALLYR--HAEVIGDARTFDGALLILPRRLHCKETVLYSETKSGEKVLITVTLTNELPPTSPVCIQFYNILFKRVLRLLEMQQIGRNYY---------NPKN--PLNIPEHNLTIWPGYSTTILQY-----ESSIMLCTDVSHKVLRSETVLDFMVNLRQKCGNQRFPDACAKELIGLIVLTKYNNKTYRIDDIAWDHTPKNTFTRGDADISFMNYYKTQYGLDITDVNQVLLVSHVKKRTGPGGGPPLGP--------------------AMLIP-ELCYLTGLTDKMRSDFTIMRDLSENTRLSPDKRISRLSGFIEDICGNAGVQEELKKWGIGFDNHLLNLSARVLAPERIFQGPRSYDYNPMSGDWS--REMRGIPIISSPPLNNWIM----FSTRRNSNEAQSLLQTLGKVSGPLGLRLQRAVMIEYEDHQESLLRALKQNVGPTTQMVVVVLPSNRKDKYDSVKKYLCVDCPTPSQCVLSR--TLSRPQALMTVATKIALQMSCKMGGELWSVEIPLKQLMIVGIDCYHDISAGKRSIGAMVASLNQSMSRWYSKCVLQHKGQELMDGLKMAFTGALKDYLKFNNCLPSRIIVYRDGVGDGQLHSVVNFEISQILESIKSL--GQDYN-PKVSVVVVKKRISSRFFAMINDKVSNPPPGTVIDTEVTRPEWYDFFIVSQAVRCGSVSPTHYNVVYDT---------SGLKPDHMQRLTYKLCHMYYNWQVSISL 822          
BLAST of SMEDWI-2 vs. Ensembl Medaka
Match: piwil2 (piwi like RNA-mediated gene silencing 2 [Source:NCBI gene;Acc:100301588])

HSP 1 Score: 192.2 bits (487), Expect = 5.471e-49
Identity = 179/750 (23.87%), Postives = 325/750 (43.33%), Query Frame = 1
Query:  412 DEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNR-----------RSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFE-MGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYK----------------NFMNDVEQELRNMRIDARVGKVN---TCGPN-DVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFP--VPQIIYVIVKKRVGTKLFNRGNNP----NPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL*K 2535
            +E ++T+++   + P ++      NV+   +  ++G   +G+ ++          P N+          +V  G+ T ++R     G L   L ++  ++VL ++SV+   N                +LIG   IT+YNN+TYRI +I+ + +  + F  M G   ++ EY+ + Y I + + +QP ++                       ++             L +P EL FL G  ++ K++    K+L   +     +    I      I + +  T     W L++ +  + I GR LP   +    S         W    V           I VV   R   +                       +  ELR+ R +  V  ++   T  P+  +  C+ +  R               D +Y+ +K    +   + +Q +  R  T    ++ + ++ K ++Q+ +K G + WTV I L+  M+VG+D +H+ S K +S+   V S+NS+ T + S V      +E        F   L+ + +    LPQ+I+V+RDGV D QL+  + +E+  +    E       FP   P++++++V+KR+ T L++   N       GTV+D  +   ++ +F+L +    +G   PT+Y  L +T  LT         P+ LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+ +H  S P     ++ ++LF+L K
Sbjct:  361 EEIEITIKMTKVLPPNSDLCIPFYNVVFRRVMKVIGLRLVGRNHY---------DPENA--VILGKQRLQVWPGYSTAIKRMD---GGL--YLAVDVSHKVLRNDSVLDLMNTLYQQTKENFKDACTKELIGSIAITRYNNRTYRIDDIEWDKSPKDSFTLMDGTETTFLEYYSKNYGITVQETNQPLLV--------------------HRPKERSNPGGKVISGHILLVP-ELSFLTGIPEKMKNDYRAMKDLKIHINVSSDQHTHAIKQLLKNISSKEDCTKALEGWGLELGSDVMMITGRMLPFETICLKSSSFATGANVSWSREVVNGASISSIPLNIWVVFYPRRSAEQAVELISTFHKVAGPIGLRLQRPITVELRDDRTETYVKSIHSQLTSEPHLQLVVCVIEGNR---------------DDLYSAIKKLCCLKCPVPSQVINVR--TISQQQKLRGIAQKILLQLNSKLGGELWTVGIPLKSLMVVGVDVHHDTSKKHQSVMGFVASVNSSLTHWYSRVTFQTPTEELISGFRACFLSTLQKYYELNHDLPQKIVVYRDGVSDGQLKMVELYEIPQLIKCFET------FPNYEPKLVFIVVQKRINTILYSSSANGFSSVPAGTVLDHTLTNKDWVDFYLTAHDIRQGVGLPTHYVTLYNTANLT---------PDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQFLH--SEPAI---QLSDKLFFLGK 1036          
BLAST of SMEDWI-2 vs. Planmine SMEST
Match: SMESG000069984.1 (SMESG000069984.1)

HSP 1 Score: 1642.48 bits (4252), Expect = 0.000e+0
Identity = 836/836 (100.00%), Postives = 836/836 (100.00%), Query Frame = 1
Query:   22 MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL
Sbjct:    1 MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 836          
BLAST of SMEDWI-2 vs. Planmine SMEST
Match: SMESG000036375.1 (SMESG000036375.1)

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 440/813 (54.12%), Postives = 589/813 (72.45%), Query Frame = 1
Query:   94 RGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            RGGL+R F I+EP LQP  +T+K G  GR V L+SN+  F++     F MYD V     +  K++L       + N  P  FCFDGRRLFT+ KWH + D +     + ++++RL++T L  +EEYYQMIN++ NN+Q+ +GQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK+RYNI L    QPFV++RVK+ M R ++K + E     +  +           +L+IPGELC+LCGFSD E+SN++LQKNLG VLKREPRERL+DI  +C W     +   M   W + I+ +P+ I GREL P D+ S   KIN K+ DDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVNS KG+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY+     +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P AIN+RIR RLFYL
Sbjct:   16 RGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETDQ-----------SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYM-KSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          
BLAST of SMEDWI-2 vs. Planmine SMEST
Match: SMESG000069981.1 (SMESG000069981.1)

HSP 1 Score: 177.178 bits (448), Expect = 1.501e-68
Identity = 92/110 (83.64%), Postives = 93/110 (84.55%), Query Frame = -2
Query: 3129 DGSLWYI---GYLKVQLIIL**NHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGN*N 3449
            D  LW     G+L V       NHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTG  N
Sbjct: 2118 DSMLWAFKICGWLFV-------NHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGTIN 2220          

HSP 2 Score: 104.375 bits (259), Expect = 1.501e-68
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = -1
Query: 2902 GTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKF 3045
            GTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKF
Sbjct: 2217 GTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKF 2264          

HSP 3 Score: 223.402 bits (568), Expect = 3.513e-58
Identity = 132/147 (89.80%), Postives = 133/147 (90.48%), Query Frame = -3
Query: 4109 DNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQKVLIS*YLFVISFD*SLSLFRVYLYRKKSXXXXXXXXXXXXXLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWE 4549
            +NLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQK              SLSLFRVYLYRKKSQLQQNQNQWLSINLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWE
Sbjct: 1907 NNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQK--------------SLSLFRVYLYRKKSQLQQNQNQWLSINLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWE 2039          

HSP 4 Score: 122.479 bits (306), Expect = 1.931e-27
Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = -1
Query: 3436 MNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAXXXXXXXXXXXXXSMLWAFKICGWLFV 3657
            MNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILLLSILSNIDNDSMLWAFKICGWLFV
Sbjct: 2059 MNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILLLSILSNIDNDSMLWAFKICGWLFV 2132          

HSP 5 Score: 75.485 bits (184), Expect = 3.640e-13
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = -2
Query: 2547 KYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC 2654
            KYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC
Sbjct: 2267 KYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC 2302          
BLAST of SMEDWI-2 vs. Planmine SMEST
Match: SMESG000069981.1 (SMESG000069981.1)

HSP 1 Score: 177.178 bits (448), Expect = 1.513e-68
Identity = 92/110 (83.64%), Postives = 93/110 (84.55%), Query Frame = -2
Query: 3129 DGSLWYI---GYLKVQLIIL**NHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGN*N 3449
            D  LW     G+L V       NHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTG  N
Sbjct: 2115 DSMLWAFKICGWLFV-------NHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGTIN 2217          

HSP 2 Score: 104.375 bits (259), Expect = 1.513e-68
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = -1
Query: 2902 GTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKF 3045
            GTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKF
Sbjct: 2214 GTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKF 2261          

HSP 3 Score: 223.402 bits (568), Expect = 3.450e-58
Identity = 132/147 (89.80%), Postives = 133/147 (90.48%), Query Frame = -3
Query: 4109 DNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQKVLIS*YLFVISFD*SLSLFRVYLYRKKSXXXXXXXXXXXXXLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWE 4549
            +NLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQK              SLSLFRVYLYRKKSQLQQNQNQWLSINLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWE
Sbjct: 1904 NNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQK--------------SLSLFRVYLYRKKSQLQQNQNQWLSINLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWE 2036          

HSP 4 Score: 122.479 bits (306), Expect = 1.963e-27
Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = -1
Query: 3436 MNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAXXXXXXXXXXXXXSMLWAFKICGWLFV 3657
            MNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILLLSILSNIDNDSMLWAFKICGWLFV
Sbjct: 2056 MNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILLLSILSNIDNDSMLWAFKICGWLFV 2129          

HSP 5 Score: 75.485 bits (184), Expect = 3.640e-13
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = -2
Query: 2547 KYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC 2654
            KYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC
Sbjct: 2264 KYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC 2299          
BLAST of SMEDWI-2 vs. Planmine SMEST
Match: SMESG000069981.1 (SMESG000069981.1)

HSP 1 Score: 177.178 bits (448), Expect = 1.658e-68
Identity = 92/110 (83.64%), Postives = 93/110 (84.55%), Query Frame = -2
Query: 3129 DGSLWYI---GYLKVQLIIL**NHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGN*N 3449
            D  LW     G+L V       NHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTG  N
Sbjct: 2132 DSMLWAFKICGWLFV-------NHSTLLQSCLKSGFLEFMCNCPIIFYKASFTKQDPRFTAFLDLCAITSASIIVSNKIQEFSRLLEMCEILHVSALKLSKQLTKTGTIN 2234          

HSP 2 Score: 104.375 bits (259), Expect = 1.658e-68
Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = -1
Query: 2902 GTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKF 3045
            GTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKF
Sbjct: 2231 GTINHGTGTLAHYALEKILMTIIESICIINSNDPAFNIPITSSCIQKF 2278          

HSP 3 Score: 223.402 bits (568), Expect = 3.383e-58
Identity = 132/147 (89.80%), Postives = 133/147 (90.48%), Query Frame = -3
Query: 4109 DNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQKVLIS*YLFVISFD*SLSLFRVYLYRKKSXXXXXXXXXXXXXLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWE 4549
            +NLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQK              SLSLFRVYLYRKKSQLQQNQNQWLSINLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWE
Sbjct: 1921 NNLTDQPVISGQSESSRVHVIAGLISILENVIEVKVSDSILERCSNYDFFFEFILHLLSHTSALVRQK--------------SLSLFRVYLYRKKSQLQQNQNQWLSINLVSHVIHQNSTTKEILAEAISIMFGQNLFSIIMDIDWE 2053          

HSP 4 Score: 122.479 bits (306), Expect = 1.934e-27
Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = -1
Query: 3436 MNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAXXXXXXXXXXXXXSMLWAFKICGWLFV 3657
            MNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILLLSILSNIDNDSMLWAFKICGWLFV
Sbjct: 2073 MNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILLLSILSNIDNDSMLWAFKICGWLFV 2146          

HSP 5 Score: 75.485 bits (184), Expect = 3.583e-13
Identity = 36/36 (100.00%), Postives = 36/36 (100.00%), Query Frame = -2
Query: 2547 KYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC 2654
            KYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC
Sbjct: 2281 KYRLLTNQYGFQKNLNEQLSETIKSTIGIVINTEKC 2316          
The following BLAST results are available for this feature:
BLAST of SMEDWI-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PIWIL12.024e-7125.86piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
PIWIL12.024e-7125.86piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
PIWIL14.797e-6024.97piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
PIWIL46.203e-5424.06piwi like RNA-mediated gene silencing 4 [Source:HG... [more]
PIWIL31.679e-5328.57piwi like RNA-mediated gene silencing 3 [Source:HG... [more]
back to top
BLAST of SMEDWI-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prg-12.675e-5126.58Piwi-like protein [Source:UniProtKB/TrEMBL;Acc:P9... [more]
alg-13.401e-2725.19pep chromosome:WBcel235:X:13951262:13956261:1 gene... [more]
alg-13.823e-2725.19pep chromosome:WBcel235:X:13949114:13956261:1 gene... [more]
alg-29.913e-2724.61pep chromosome:WBcel235:II:874160:879001:1 gene:WB... [more]
alg-21.004e-2624.61pep chromosome:WBcel235:II:873176:878945:1 gene:WB... [more]
back to top
BLAST of SMEDWI-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piwi1.189e-7226.17gene:FBgn0004872 transcript:FBtr0080166[more]
piwi1.189e-7226.17gene:FBgn0004872 transcript:FBtr0340227[more]
AGO37.160e-7026.23gene:FBgn0250816 transcript:FBtr0299882[more]
AGO37.160e-7026.23gene:FBgn0250816 transcript:FBtr0299881[more]
AGO37.160e-7026.23gene:FBgn0250816 transcript:FBtr0299880[more]
back to top
BLAST of SMEDWI-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piwil15.017e-7728.17piwi-like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil15.017e-7728.17piwi-like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil23.843e-5322.49piwi-like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil23.843e-5322.49piwi-like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil21.298e-3721.00piwi-like RNA-mediated gene silencing 2 [Source:NC... [more]
back to top
BLAST of SMEDWI-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd742.754e-7627.08CD74 molecule [Source:Xenbase;Acc:XB-GENE-922847][more]
cd743.339e-7627.17CD74 molecule [Source:Xenbase;Acc:XB-GENE-922847][more]
piwil31.128e-7226.82piwi-like RNA-mediated gene silencing 3 [Source:NC... [more]
piwil32.383e-6826.50piwi-like RNA-mediated gene silencing 3 [Source:NC... [more]
bckdhb3.373e-6424.94branched chain keto acid dehydrogenase E1, beta po... [more]
back to top
BLAST of SMEDWI-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Piwil13.814e-7125.60piwi-like RNA-mediated gene silencing 1 [Source:MG... [more]
Piwil48.055e-6225.49piwi-like RNA-mediated gene silencing 4 [Source:MG... [more]
Piwil11.330e-5924.43piwi-like RNA-mediated gene silencing 1 [Source:MG... [more]
Piwil22.256e-4226.69piwi-like RNA-mediated gene silencing 2 [Source:MG... [more]
Piwil41.638e-3028.79piwi-like RNA-mediated gene silencing 4 [Source:MG... [more]
back to top
BLAST of SMEDWI-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2Q5Y8|PIWI2_SCHMD0.000e+098.57Piwi-like protein 2 OS=Schmidtea mediterranea OX=7... [more]
sp|Q2PC95|PIWIL_DUGJA0.000e+074.75Piwi-like protein OS=Dugesia japonica OX=6161 GN=i... [more]
sp|Q2Q5Y9|PIWI1_SCHMD0.000e+054.12Piwi-like protein 1 OS=Schmidtea mediterranea OX=7... [more]
sp|A8D8P8|SIWI_BOMMO3.674e-7727.15Piwi-like protein Siwi OS=Bombyx mori OX=7091 GN=S... [more]
sp|Q8UVX0|PIWL1_DANRE3.787e-7628.17Piwi-like protein 1 OS=Danio rerio OX=7955 GN=piwi... [more]
back to top
BLAST of SMEDWI-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D2Z0D90.000e+093.61DjPiwiB OS=Dugesia japonica OX=6161 GN=DjpiwiB PE=... [more]
G9B7C20.000e+065.78Piwi B (Fragment) OS=Seidlia auriculata OX=1051009... [more]
G9B7B60.000e+065.61Piwi B (Fragment) OS=Phagocata kawakatsui OX=10510... [more]
T1E1040.000e+053.78PIWI-1 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
D2Z0D80.000e+054.37DjPiwiA OS=Dugesia japonica OX=6161 GN=DjpiwiA PE=... [more]
back to top
BLAST of SMEDWI-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piwil11.467e-7927.52piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil26.110e-4822.29piwi like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil21.334e-4722.29piwi like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil27.427e-4025.10piwi like RNA-mediated gene silencing 2 [Source:NC... [more]
ago3b2.278e-2624.83argonaute RISC catalytic component 3b [Source:NCBI... [more]
back to top
BLAST of SMEDWI-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
piwil21.391e-6326.35piwi-like RNA-mediated gene silencing 2 [Source:NC... [more]
piwil19.676e-5424.94piwi-like RNA-mediated gene silencing 1 [Source:NC... [more]
ago24.855e-2530.86argonaute RISC catalytic component 2 [Source:ZFIN;... [more]
ENSPMAT00000009610.11.102e-926.12pep scaffold:Pmarinus_7.0:GL477777:44890:66775:1 g... [more]
back to top
BLAST of SMEDWI-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMEDWI-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO499311.055e-7027.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340271.357e-6927.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO464315.198e-3026.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281243.034e-1024.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMEDWI-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
piwil15.824e-7728.06piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil15.954e-7628.08piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil11.213e-6126.75piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil11.213e-6126.75piwi like RNA-mediated gene silencing 1 [Source:NC... [more]
piwil25.471e-4923.87piwi like RNA-mediated gene silencing 2 [Source:NC... [more]
back to top
BLAST of SMEDWI-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069984.10.000e+0100.00SMESG000069984.1[more]
SMESG000036375.10.000e+054.12SMESG000036375.1[more]
SMESG000069981.11.501e-6883.64SMESG000069981.1[more]
SMESG000069981.11.513e-6883.64SMESG000069981.1[more]
SMESG000069981.11.658e-6883.64SMESG000069981.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014446
GenBankQ2Q5Y8
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014446 ID=SMED30014446|Name=SMEDWI-2|organism=Schmidtea mediterranea sexual|type=transcript|length=4773bp
ATTTAATTTTCGAAAAAAAATATGGAGGAAATACCAGTAAAAGTAGCTAA
ACTTGAAGCGAATGGAAGTGAAACAAGAGGTAAAATGGGAAATCGTGGTG
GCCTGAGAAGAACATTTAGAATTGTTGAACCTAACTTGCAACCTGCTGAT
ATCACTGAAAAAACAGGAAACATAGGAAGAACAGTTAAATTACAATCAAA
TTTTACCAAATTCTCTGTTTTGCGTTCAGAAAAGTTCATGATGTATGATT
CCGTGTTTTCTCAAGTTGGTTTGTCACCCAAAGTAAAATTACAGTTTATT
GTTCGAGTCTGCCAAGAAAATAAATTGCCAGGGGCTTTTTGTTTTGATGG
AAGACGTCTATTTACTAGTGAAAAATGGCATGGAGAATCGGACATTCAAG
AATTTAGTCATGATGAAAAAAAAATGACACTAAGATTGGTATCAACTATC
CTTCCTGAAACTGAAGAATATTACCAAATGATCAATGTATTACTCAATAA
TTTACAAGTAATGTTAGGTCAAGAAAGAATTGGTAAAGGTTATTTTTTAA
GCCCAAATATTACAAAAGATGAAGTTCCCCGTAATTCTGGACCGACATTT
TTTGAAACCAATAGTTTTAAAGTTCTTGGGGGCTTTGGTACAACTTTACA
AAGAGGCACAAAACCAACTGGTGAATTAACCACTCTTTTATATATTGAGC
GTATTAACAGAGTATTAAACGATAACTCTGTTATGAAGGCATACAACAGA
AGAAGTATCGATCAGTTGATAGGCAGAGATATCATAACAAAATATAATAA
CAAAACTTATAGGATAAGTGAAATAAAAGAAATGAACGTAGATGAGAAAT
TTGAAATGGGTGGTAGAACTTTATCGTATGCCGAATATTTTAAGGAACGA
TATAATATTCGATTAACTCAAGGCGATCAACCATTTGTTCTAACGCGAGT
GAAGAAACCAATGCGTCGAGAAAGAAAGAAAAAAGACGAAGAAGGAGTGG
AAAAAGAGAAAGAAAAAGAACGCGAAAAAGAGGCTCCAGAAGAGAAGGAC
ATGACTCTCAATATTCCTGGAGAGTTGTGTTTCTTATGTGGGTTTTCAGA
TCAAGAGAAATCGAATATGGATCTGCAGAAGAATTTAGGGTGCGTTTTAA
AAAGAGAGCCACGTGAAAGATTGGATGATATACCAGCTTATTGTAACTGG
ATTAAAAATAGTGATGCGGCAACTGGAATGTGCAATAAATGGCAGCTGAA
AATAGATAACAAACCATTAGAAATCGAAGGTAGAGAATTACCTCCATGCG
ATGTAATAAGTGGTGGCAGCAAAATTAATGAAAAAATGGGAGATGATTGG
AAATTTGGTCGAGTTCAATTTGATATTAAGCGTGATCGTAAGCATGAAAT
CGATGTGGTCATCGTTGATCGAAATGACTTTCAGTATAAAAATTTTATGA
ATGATGTGGAACAAGAATTAAGAAACATGAGAATTGATGCTCGAGTTGGA
AAGGTTAATACTTGTGGTCCAAATGATGTTGAAAGATGTTTGAATGATGC
CGCTAGAAGTGGAAGTGGGTGTGCTAAAATGGCGCTGGTATTCGTCCCAG
ATGATAGAGTATATGCCAAGGTGAAATCATTTACCATGAGTACTGGTCTT
TTAACCCAATGTGTAACAACACGTAATGGTACTAATAGAAACGATAAACG
AAGAAAGGTGGTTTCAAGTAAAACCGTGATGCAAATATTTGCAAAATTCG
GATATGATCCATGGACAGTTGAAATTAAATTGAGACCAACTATGATTGTC
GGTATGGATACCTATCATAACAAGTCCAGCAAGAAATCAATTCAAGCATC
TGTATTTTCGATCAACAGCACATTTACACAATATATGAGCTTTGTTAATT
CTCCTAAAGGACGTCAGGAATTCCACGAAACTTTAGGCAAAAATTTCAAT
TTAGCGTTAGAAGATTTCAAGAAACGTTATGACATATTGCCCCAGCGAAT
TTTAGTCTTTAGAGATGGTGTTGGAGATAACCAACTTCAATTTACTAAAA
ATTTTGAAGTTGATGCAATGAAACCGCTTATTGAAAATATATACAAAGGC
AACGGATTCCCTGTTCCACAAATCATTTATGTCATCGTAAAGAAAAGAGT
CGGCACTAAGCTTTTCAACAGAGGAAATAATCCAAATCCTGGAACTGTTG
TGGATAAAGAAATTGTCAAACCGAATTTCTATGAATTTTTCCTAGTTTCA
CAAAGAACAACGAAAGGAACTGCAACTCCAACTAATTATAATGTTTTAGA
AGATACTCGATTGCTAACGAAAAAAGGTACTATGGATCCTATGGCACCGA
ATGAGCTGCAAAAGATTACCTATGCTCTAACTCATTTATATTTCAATTGG
ATGGGAACTATCCGAGTTCCGGTTCCAGTGCATTATGCGCATAGATTGGC
TGAATTAGTTGGAAAGGTGCATAAGGGCTCTAATCCCGTTGCCATTAATG
AAAGAATAAGAAATAGGCTCTTCTATTTATAAAAAGATCAAAACTTACAT
TTTTCTGTGTTGATTACTATCCCAATTGTGGATTTAATTGTTTCTGAAAG
CTGTTCATTCAAATTCTTCTGAAATCCATATTGATTCGTAAGCAGCCTGT
ATTTGAATACTAAAATTGATAAAGTAGTTATAAGTATTGTAAAAGTATTA
AATATTTGTTTATGTTATTCGTAATACACTTGGGTTATTGCAATGTTTTA
GTTGTTTTTCAATGATAATAAAGCTTAGCTGTATAAATTCTTTTAGGTTT
TTTAGAAGGTTTATTTATATCGTGTAATTGATTGTCGTGTTAATATTAAT
TAAATAAAAGTTTGATGTAATTGCTTTGTGTTACGCATAATAAATCTTAC
GAAATTTCTGAATACAACTGCTGGTGATCGGGATATTGAATGCCGGGTCG
TTTGAATTAATAATACAAATGCTTTCGATTATTGTCATTAATATTTTCTC
CAGTGCGTAATGGGCCAGAGTTCCGGTGCCATGATTAATGGTTCCTAAAT
TTTAGAAATAACATTTTGAATGACATGTTAAATGTGTATATAATAAATTT
TCTAGTTTTTTTGCTAAGATTTTGAGAAATTTTAGTTACCTGTTTTTGTT
AATTGCTTTGATAATTTCAATGCTGACACGTGCAGAATTTCACACATCTC
CAGCAGTCGACTGAATTCTTGGATTTTGTTTGATACAATTATGCTTGCAG
ATGTTATGGCGCATAGATCCAAGAAGGCTGTGAATCTTGGGTCTTGTTTT
GTAAAGGAAGCTTTGTAAAATATGATGGGACAGTTGCACATAAATTCTAG
GAATCCAGATTTTAGGCAAGATTGAAGTAATGTTGAATGGTTCTATTATA
GAATAATCAGTTGCACTTTTAGATAACCAATATACCACAAAGAGCCATCC
GCAAATTTTGAAAGCCCAAAGCATTGAATCGTTGTCTATGTTACTCAGTA
TAGACAGCAGTAAAATGGCGCTTTTTTGATATTGTAAACCGAAATGATTA
CTAGAATTCATTGTTTCGTCAAGAGATTTCGCGAAACTCTGAATATTATC
TGATTGATTTGATACTATTCCTTGGAGTTTACAAATTGATTTCAGTTCCA
AATTCATACTATTGTGTTCTGCTGATTTGCTACTATTGGAGCTCTATAAG
GAATTATTAGAATCAATTTTGGTTTGATAGTGGGTTTTGCAATCATTGGC
TTATTGTGGGTTGTGTAACCATGGAAGTAATTGTGAATAGTTATAGTGCT
CGCTCTGCATAAAATAATATTTAATCAGTGCTTTAAAGTAGATTTTTAAC
GATTATTATGAAAGATTTCTCTTATATATTAATGTTTTTGTATCCTTCAA
AAGTTTACTAAAAATAATGCACATTTGAAATTTACGCGTTACCATAAAAT
GTCTGAAGTGGTCCAAAGCAATAAAAGCTTAAAAAGAAAGTTCTTGTTTT
TAAATGTATTGGGATATACTCCCACTAACCTTCCGTACTCCGCTGCCTCC
CTTCCCATCACATACAATATTTGCTAGTTCTACTTACAGAGTTGAAAATC
GAAAAATTTTCCCAGTCAATGTCCATGATTATGCTGAATAAATTTTGTCC
GAACATAATAGAGATTGCCTCAGCCAGTATTTCTTTCGTTGTTGAGTTTT
GATGAATGACATGTGAGACTAAATTTATGGACAACCATTGATTTTGGTTT
TGCTGAAGTTGAGACTTCTTACGGTAAAGATAAACACGAAATAATGATAA
ACTCTAATCAAAAGATATTACAAACAAATATTATGATATCAAAACCTTCT
GTCGAACCAAGGCACTTGTGTGAGATAATAAATGAAGAATGAATTCGAAA
AAGAAGTCATAATTCGAACATCGCTCCAGAATGCTGTCACTGACTTTGAC
TTCAATCACATTTTCCAATATTGAAATCAGACCGGCGATCACATGGACCC
TTGATGATTCAGACTGACCACTGATTACGGGTTGATCGGTTAAATTATCT
AGAGATTAAAATAATAGTCGGTAAAGGAAATTATCCATATAAACGGGAAA
CAGAAAAGTTTTAACCATGGTTTCAAAAGCTTTTGGGACTACCCCCAGCT
TTGCAAAACAATTTTTTAACGCTCTTGTTATGACTTGAATCAACATTGTA
CAATTGTTACAATAGACTTGATGATTTACTTATTTACACCCCATCTAAAT
TGTTTCTTAACCCTTTGCCACCC
back to top

protein sequence of SMED30014446-orf-1

>SMED30014446-orf-1 ID=SMED30014446-orf-1|Name=SMED30014446-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
MNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILL
LSILSNIDNDSMLWAFKICGWLFVVYWLSKSATDYSIIEPFNITSILPKI
WIPRIYVQLSHHILQSFLYKTRPKIHSLLGSMRHNICKHNCIKQNPRIQS
TAGDV*
back to top

protein sequence of SMED30014446-orf-2

>SMED30014446-orf-2 ID=SMED30014446-orf-2|Name=SMED30014446-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=837bp
MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
back to top
Aliases
The feature 'SMEDWI-2' has the following synonyms
Synonym
piwi-2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000208testis
PLANA:0000478pharynx musculature
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
PLANA:0004517blastomere
PLANA:0000429neoblast
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000005Stage 5
PLANA:0000008Stage 8
PLANA:0000002Stage 2
PLANA:0000006Stage 6
PLANA:0000007Stage 7
PLANA:0000004Stage 4
Vocabulary: INTERPRO
TermDefinition
IPR036397RNaseH_sf
IPR036085PAZ_dom_sf
IPR003165Piwi
IPR003100PAZ_dom
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0031047gene silencing by RNA
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 316..336
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 460..575
e-value: 2.7E-8
score: 36.0
NoneNo IPR availableGENE3DG3DSA:2.170.260.10coord: 223..365
e-value: 1.2E-21
score: 78.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 317..342
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 311..342
NoneNo IPR availablePANTHERPTHR22891:SF47PROTEIN ARGONAUTE-3coord: 47..834
NoneNo IPR availablePANTHERPTHR22891EUKARYOTIC TRANSLATION INITIATION FACTOR 2Ccoord: 47..834
NoneNo IPR availableCDDcd04658Piwi_piwi-like_Eukcoord: 367..815
e-value: 3.69242E-156
score: 461.735
IPR003165Piwi domainSMARTSM00950Piwi_a_2coord: 520..817
e-value: 5.5E-80
score: 281.7
IPR003165Piwi domainPFAMPF02171Piwicoord: 528..816
e-value: 1.2E-62
score: 211.9
IPR003165Piwi domainPROSITEPS50822PIWIcoord: 519..818
score: 34.199
IPR003100PAZ domainSMARTSM00949PAZ_2_a_3coord: 220..377
e-value: 1.3E-16
score: 71.1
IPR003100PAZ domainPFAMPF02170PAZcoord: 242..368
e-value: 5.9E-16
score: 58.5
IPR003100PAZ domainPROSITEPS50821PAZcoord: 254..309
score: 14.836
IPR036397Ribonuclease H superfamilyGENE3DG3DSA:3.30.420.10coord: 583..835
e-value: 1.6E-63
score: 216.4
IPR036085PAZ domain superfamilySUPERFAMILYSSF101690PAZ domaincoord: 223..357
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 308..836