SMEDWI-2

Overview
NameSMEDWI-2 (Q2Q5Y8)
Smed IDSMED30014446
Uniprot Best hitPiwi-like protein 2 OS=Schmidtea mediterranea GN=wi-2 PE=2 SV=1 (E=0)
Length (bp)4773
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMEDWI-2 (SMED30014446) t-SNE clustered cells

Violin plots show distribution of expression levels for SMEDWI-2 (SMED30014446) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMEDWI-2 (SMED30014446) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMEDWI-2 (SMED30014446) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

SMEDWI-2 ( piwi-2 ) is expressed during Stage 2, Stage 3, Stage 4, Stage 5, Stage 6, Stage 7 and Stage 8 in the neoblast compartment, blastomere and blastomere compartment

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-2.

SPIM reconstructed S4 embryo costained with piwi-1 (red) and piwi-2 (green). piwi-1+ blastomeres co-express the nuage factor piwi-2, and virtually all piwi-2+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (green). 

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-2.

SPIM reconstructed S3 embryo costained with piwi-1 (green) and piwi-2 (red). piwi-1+ blastomeres co-express the nuage factor piwi-2, and virtually all piwi-2+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (green).

 

piwi-1+ blastomeres co-express the adult asexual neoblast enriched gene piwi-2.

SPIM reconstructed S5 embryo costained with piwi-1 (green) and piwi-2 (red). piwi-1+ blastomeres co-express the nuage factor piwi-2, and virtually all piwi-2+ cells co-express piwi-1. Several fluorescent beads used for 3-dimensional reconstruction are visible (green).

Homology
BLAST of SMEDWI-2 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 259.61 bits (662), Expect = 5.755e-71
Identity = 219/847 (25.86%), Postives = 392/847 (46.28%), Query Frame = 1
Query:   85 MGNRGGLRRTFRIVEPNL-QPADITE--KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSH----DEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            +  RGG RR F  +  N  Q  D  +  KTG+ G  V+L +N   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++   +   + FS     ++ ++T+ L + + P +    Q  N++   L  ++  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++++YN  +T   QP ++++ K+                                 + IP ELC+L G +D+ +++ ++ K+L    +  P +R  ++    ++I  +D        W L  D+  L   GR L    +  GG   +      DW        +   +  +  ++I  R +++  N  + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +G     P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:   76 LAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTN--HFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQ-QKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGP---------------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          
BLAST of SMEDWI-2 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 259.61 bits (662), Expect = 5.755e-71
Identity = 219/847 (25.86%), Postives = 392/847 (46.28%), Query Frame = 1
Query:   85 MGNRGGLRRTFRIVEPNL-QPADITE--KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSH----DEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKN-FMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            +  RGG RR F  +  N  Q  D  +  KTG+ G  V+L +N   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++   +   + FS     ++ ++T+ L + + P +    Q  N++   L  ++  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++++YN  +T   QP ++++ K+                                 + IP ELC+L G +D+ +++ ++ K+L    +  P +R  ++    ++I  +D        W L  D+  L   GR L    +  GG   +      DW        +   +  +  ++I  R +++  N  + ++ +    M +  R   +     +  E  L    +  +   ++ +  +  +R   Y  +K +  +     +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +G     P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:   76 LAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTN--HFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQ-QKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGP---------------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLLIYTRRNYEAANSLIQNLFKVTPAMGMQMRKAIMIEVD-DRTEAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 861          
BLAST of SMEDWI-2 vs. Ensembl Human
Match: PIWIL1 (piwi like RNA-mediated gene silencing 1 [Source:HGNC Symbol;Acc:HGNC:9007])

HSP 1 Score: 224.942 bits (572), Expect = 9.813e-60
Identity = 204/817 (24.97%), Postives = 359/817 (43.94%), Query Frame = 1
Query:   85 MGNRGGLRRTFRIVEPNL-QPADITE--KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSH----DEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSK-------------------INEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNW 2400
            +  RGG RR F  +  N  Q  D  +  KTG+ G  V+L +N   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++   +   + FS     ++ ++T+ L + + P +    Q  N++   L  ++  ++IG+ Y+ +PN           P    ++   +  GF T++ +      E + +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++++YN  +T   QP ++++ K+                                 + IP ELC+L G +D+ +++ ++ K+L    +  P +R  ++    ++I  +D        W L  D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    M    ++   + +D R             R L     + +      L     D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V+I L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P RI+V+RDGVGD QL+   N+EV      +++I +G     P++  ++VKKRV T+ F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D            + P+ +Q++TY L H+Y+NW
Sbjct:   76 LAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTN--HFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGKCHAFDGTILFLPKRLQ-QKVTEVFSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-NPN----------DPIDIPSHRLVIWPGFTTSILQY-----ENSIMLCTDVSHKVLRSETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGP---------------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKNDNVQRELRDWGLSFDSNLLSFSGRILQTEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGMQMRKAIMIEVDDRT--------EAYLRVLQQKVTADTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDIPLKLVMIVGIDCYHDMTAGRRSIAGFVASINEGMTRWFSRCIFQDRGQELVDGLKVCLQAALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGYN---PRLTVIVVKKRVNTRFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDN---------SGLKPDHIQRLTYKLCHIYYNW 822          
BLAST of SMEDWI-2 vs. Ensembl Human
Match: PIWIL4 (piwi like RNA-mediated gene silencing 4 [Source:HGNC Symbol;Acc:HGNC:18444])

HSP 1 Score: 206.453 bits (524), Expect = 7.203e-54
Identity = 198/823 (24.06%), Postives = 357/823 (43.38%), Query Frame = 1
Query:  160 KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQ-ENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEK-----KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERIN-RVLNDNSVMK------------AYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEM-GGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDW-KFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTC--GPNDVERCLNDAARSGSGCAKMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKK-SIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            KTG+ G  VKL +N       +  +   Y   +     S ++++  +    +  NK   A  FDG  LF S+K   E  + E S + +     KMT+ L   +   +    Q+ N++   +   L   +IG+ ++             S P     +   +  GF  ++    +       LL+   ++ +VL + +V++             + +    QLIG  ++T+YNN+TY I +I   +     F+   G  ++Y +Y+K++Y+I ++  +QP +++ +KK      + +                          IP ELCFL G +DQ  S+  L K +    +  P  R   +    + I+ +  A      W L   ++ + + GR +P   ++            DW K  R    +     +   ++  DR ++  ++F+N + +   +M  +    K+      P    R +           ++ +  +P ++   Y  +K +  S   + +QCV  R  T         +++K  MQ+  K G + W VEI L+  M+VG+D   +  SK   +   V S+N   T++ S     +   +  + L      AL  + K    LP RI+V+R GVGD QL+    +EV     L+ ++ + +     ++  ++V+K+   + F   N    NP  GTVVD E  +  +Y+F+L+SQ   +GT +PT YNV+ D          + + P+ +Q++T+ L HLY+NW G + VP P  YAH+L  LV + +HK       +  + N LFYL
Sbjct:   98 KTGSSGIPVKLVTNLFNLDFPQDWQLYQYHVTYIPDLASRRLRIALLYSHSELSNK---AKAFDGAILFLSQKL--EEKVTELSSETQRGETIKMTITLKRELPSSSPVCIQVFNIIFRKILKKLSMYQIGRNFY-----------NPSEPMEIPQHKLSLWPGFAISVSYFER------KLLFSADVSYKVLRNETVLEFMTALCQRTGLSCFTQTCEKQLIGLIVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLLKKKRNDNSEAQLAHL----------------------IP-ELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDNIQRNTNARFELETWGLHFGSQ-ISLTGRIVPSEKILMQDHICQPVSAADWSKDIRTCKILNAQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYVDPD---VQLVMCILPSNQKTYYDSIKKYLSSDCPVPSQCVLAR--TLNKQGMMMSIATKIAMQMTCKLGGELWAVEIPLKSLMVVGIDVCKDALSKDVMVVGCVASVNPRITRWFSRCILQRTMTDVADCLKVFMTGALNKWYKYNHDLPARIIVYRAGVGDGQLKTLIEYEVPQ---LLSSVAESSSNTSSRLSVIVVRKKCMPRFFTEMNRTVQNPPLGTVVDSEATRNEWYDFYLISQVACRGTVSPTYYNVIYDD---------NGLKPDHMQRLTFKLCHLYYNWPGIVSVPAPCQYAHKLTFLVAQSIHKEP-----SLELANHLFYL 852          
BLAST of SMEDWI-2 vs. Ensembl Human
Match: PIWIL3 (piwi like RNA-mediated gene silencing 3 [Source:HGNC Symbol;Acc:HGNC:18443])

HSP 1 Score: 203.756 bits (517), Expect = 3.126e-53
Identity = 144/504 (28.57%), Postives = 240/504 (47.62%), Query Frame = 1
Query: 1057 LNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRND----FQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDD--RVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            L IP +LC + G +D+   +  + K L    +  PR R   +  + N ++++     +   W LK D   L + GR L   +++ G   +      DW     +  +         +++  R+        K  +  V   +      A + +V+     D    ++   +      +M +  +P+D  R Y  +K +  +   + +QCV  +  T    + R +V+ K   Q+  K G   W VE  ++ TM VG+D +H+  + +KSI   V S N+  T++ S     K  +E  + L      AL+ + K    +P  ++V+RDGVGD QLQ   + E   M   ++ I   N      + +++VKKR+ T+ F +      NP PGTV+D E+ +  +Y+FF+VSQ    GT TPT+YNV+ DT           ++P+ +Q++TY L H+Y+N  G IRVP P HYAH+LA LVG+ +H+       N  +  RLFYL
Sbjct:  287 LLIP-QLCHMTGLTDEICKDYSIVKELAKHTRLSPRRRHHTLKEFINTLQDNKKVRELLQLWDLKFDTNFLSVPGRVLKNANIVQGRRMVKANSQGDWSREIRELPLLNAMPLHSWLILYSRSSHREAMSLKGHLQSVTAPMGITMKPAEMIEVD----GDANSYIDTLRKYTRPTLQMVICILPNDDKRRYDSIKRYLCTKCPIPSQCVVKK--TLEKVQARTIVT-KIAQQMNCKMGGALWKVETDVQRTMFVGIDCFHDIVNRQKSIAGFVASTNAELTKWYSQCVIQKTGEELVKELEICLKAALDVWCKNESSMPHSVIVYRDGVGDGQLQALLDHEAKKMSTYLKTISPNNF----TLAFIVVKKRINTRFFLKHGSNFQNPPPGTVIDVELTRNEWYDFFIVSQSVQDGTVTPTHYNVIYDT---------IGLSPDTVQRLTYCLCHMYYNLPGIIRVPAPCHYAHKLAYLVGQSIHQEP-----NRSLSTRLFYL 764          
BLAST of SMEDWI-2 vs. Ensembl Celegans
Match: prg-2 (Piwi-like protein [Source:RefSeq peptide;Acc:NP_500994])

HSP 1 Score: 206.838 bits (525), Expect = 8.699e-55
Identity = 171/621 (27.54%), Postives = 282/621 (45.41%), Query Frame = 1
Query:  772 GRDIITKYNNKTYRISEI-KEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVI---VDRNDFQYKNFMNDVEQELRNMRI---DARVGKVNTCGPNDVERCLNDAARSGSGCA-KMALVFVPDD---RVYAKVKSFTMSTGLLTQCVTTRN--GTNRNDKRRKVVSS---KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNF-NLALEDFKKRYD----ILPQRILVFRDGVGDNQLQFTKNFEV----DAMKPLIENIYKGNGFPVPQI--IYVIVKKRVGTKLFNRGN------NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            G  IIT+YNNK +R + +  E+    KF+  G  +   EYFK +Y+I +T  +Q  +++  K     E  + +                         I  ELCF  G +D+ + +  + K +    +  P++RLD+       +  +         W + +      ++ R L   + + G  +   K  + W  G  +  I R       +VI      +    + F+ +     R +++   +    K+N   PND    L  A +S  G    M +V + DD   R  +  K   +   +  QCV  R   G +++    K + S   K V+Q+  K G   W V I L+ TMIVG D YH+ + K K++ A V + ++ FTQ+ S         E    LG N  +   +  K+ YD     LP R++++RDG GD Q+ + KN EV    DA   + +   + +     +I   ++IV KRV  ++  +G+      NP PGTVVD  + +P   +F+LV Q   +GT TP +YN++ D   L          P++ Q++ + L HLY+NW GT+RVP P  YAH+LA L  + +H  +N       +R++LF+L
Sbjct:  146 GSTIITRYNNKLHRFTRLDNEITPLSKFQKDGEQIILKEYFKNQYDIDITDDEQFIIISEGKPKQPGEPPQVNY------------------------IVPELCFPTGLTDEMRKDFKMMKEIAKHTRMSPQQRLDETRKLITKLSQNQTMMECFQYWGISLGQDLANVQARVLK-SEPLQGKRQYEGKQAE-WARGVKECGIYRGSNMTNWIVIGPGSGNSGLLAQKFIAEARNLGRTLQVQLGEPMCVKINGISPNDYLEGLKAAIKSVDGEEIHMLVVMLADDNKTRYDSLKKYLCVECPIPNQCVNLRTLAGKSKDGGENKNLGSIVLKIVLQMICKTGGALWKVNIPLKSTMIVGYDLYHDSTLKGKTVGACVSTTSNDFTQFYSQTRP----HENPTQLGNNLTHFVRKSLKQYYDNNDKTLPSRLILYRDGAGDGQIPYIKNTEVKLVRDACDAVTDKAAELSNKVQEKIKLAFIIVTKRVNMRILKQGSSSKSAINPQPGTVVDTTVTRPERMDFYLVPQFVNQGTVTPVSYNIIHDDTGL---------GPDKHQQLAFKLCHLYYNWQGTVRVPAPCQYAHKLAFLTAQSLHDDANGY-----LRDKLFFL 722          
BLAST of SMEDWI-2 vs. Ensembl Celegans
Match: prg-1 (Piwi-like protein [Source:RefSeq peptide;Acc:NP_492121])

HSP 1 Score: 196.823 bits (499), Expect = 2.885e-51
Identity = 164/617 (26.58%), Postives = 279/617 (45.22%), Query Frame = 1
Query:  772 GRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVI---VDRNDFQYKNFMNDVEQELRNMRI---DARVGKVNTCGPNDVERCLNDAARSGSG-CAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRN--GTNRNDKRRKVVSS---KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYD-ILPQRILVFRDGVGDNQLQFTKNFEV----DAMKPLIENIYKGNGFPVPQI--IYVIVKKRVGTKLFNRGN------NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            G  IIT+YNNK +R + +   ++   +F   G++++  EYFK +Y I +T  DQP +++  K     E  +                           I  ELCF  G +D+ + +  + K +    +  P++RL +       +  ++        W + +      ++ R L    +   G K  E    +W  G  +  I R       +VI      +    + F+ +  +  + +++   +     +    PND    +  A +   G    M +V + DD    Y  +K F  +   +  QCV  R   G +++    K + S   K V+Q+  K G   W V I L+ TMIVG D YH+ + K K++ A V + ++ FTQ+ S     +   +    L      AL+ +    D  LP R++++RDG GD Q+ + KN EV    DA   + +   + +     +I   ++IV KRV  ++  +G+      NP PGTVVD  + +P   +F+LV Q   +GT TP +YN++ D   L          P++ Q++ + L HLY+NW GT+RVP P  YAH+LA L  + +H  +N       +R++LF+L
Sbjct:  248 GTTIITRYNNKLHRYTRLDYSISPLSEFVKDGQSITLKEYFKNQYGIEITVDDQPIIISEGKPKQPGEPPQVSY------------------------IVPELCFPTGLTDEMRKDFKMMKEIAKHTRMSPQQRLVESRKLIVDLSKNEKVMECFKYWGISLGQDLANVQARVLKSEPL--QGKKTYEGKQAEWARGVKECGIYRGSNMTNWIVIGPGSGNSGLLSQKFIEEARRLGKILQVQLGEPMCVPIRGISPNDYLEGVKGAIKQVDGEDIHMLVVMLADDNKTRYDSLKKFLCVECPIPNQCVNLRTLAGKSKDGGENKNLGSIVLKIVLQMICKTGGALWKVNIPLKNTMIVGYDLYHDSTLKGKTVGACVSTTSNDFTQFYSQTRPHENPTQLGNNLTHFVRKALKQYYDSNDQTLPSRLILYRDGAGDGQIPYIKNTEVKLVRDACDAVTDKAAELSNKVQEKIKLAFIIVTKRVNMRILKQGSSLDNAINPQPGTVVDTTVTRPERMDFYLVPQFVNQGTVTPVSYNIIHDDTDL---------GPDKHQQLAFKLCHLYYNWQGTVRVPAPCQYAHKLAFLTAQSLHDDANGC-----LRDKLFFL 824          
BLAST of SMEDWI-2 vs. Ensembl Celegans
Match: alg-1 (pep:known chromosome:WBcel235:X:13951262:13956256:1 gene:WBGene00000105 transcript:F48F7.1a gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-1)

HSP 1 Score: 120.939 bits (302), Expect = 3.105e-27
Identity = 130/516 (25.19%), Postives = 220/516 (42.64%), Query Frame = 1
Query: 1063 IPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSD-AATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDD--WKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKV-NTC------GPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMST-GLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRP------TMIVGMDTYH---NKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA-----ELVGKVH---KGSNPVAINE 2502
            +PG+ C +   +D + S M     +    +  P ER  +I    N ++ ++ +A    +++ + I+    E++GR L    ++ GG      + +   W     QF    D +         +   + +N +     +L+ +  DA +  V N C      G   VE       ++ SG   + +V      VYA+VK    +  G+ TQCV  +N      +      S   +++  K G     +   +RP       +  G D  H     S K SI A V S+++  ++Y + V   + RQE    L       L  F +     P RI+V+RDGV + Q      +E+ A++     + +G     P I ++ V+KR  T+LF         +  N  PGT VD  I  P  ++F+L S    +GT+ P++Y+VL D   LT          +ELQ++TY + H Y     ++ +P P +YAH +A      LV + H   +GS P   +E
Sbjct:  490 VPGQRC-IKKLTDVQTSTM-----IKATARSAP-EREREI---SNLVRKAEFSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRTRATALPNQGVWDMRGKQFHTGIDVRVWAIACFAQQQHVK-ENDLRMFTNQLQRISNDAGMPIVGNPCFCKYAVGVEQVEPMFKYLKQNYSGIQLVVVVLPGKTPVYAEVKRVGDTVLGIATQCVQAKNAIRTTPQ----TLSNLCLKMNVKLGGVNSILLPNVRPRIFNEPVIFFGCDITHPPAGDSRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIISDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQFFNVLQYELRAIREACMMLERGYQ---PGITFIAVQKRHHTRLFAVDKKDQVGKAYNIPPGTTVDVGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNNLTA---------DELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDREHDSGEGSQPSGTSE 978          
BLAST of SMEDWI-2 vs. Ensembl Celegans
Match: alg-1 (pep:known chromosome:WBcel235:X:13949142:13956256:1 gene:WBGene00000105 transcript:F48F7.1b gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-1)

HSP 1 Score: 120.939 bits (302), Expect = 3.490e-27
Identity = 130/516 (25.19%), Postives = 220/516 (42.64%), Query Frame = 1
Query: 1063 IPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSD-AATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDD--WKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKV-NTC------GPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMST-GLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRP------TMIVGMDTYH---NKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA-----ELVGKVH---KGSNPVAINE 2502
            +PG+ C +   +D + S M     +    +  P ER  +I    N ++ ++ +A    +++ + I+    E++GR L    ++ GG      + +   W     QF    D +         +   + +N +     +L+ +  DA +  V N C      G   VE       ++ SG   + +V      VYA+VK    +  G+ TQCV  +N      +      S   +++  K G     +   +RP       +  G D  H     S K SI A V S+++  ++Y + V   + RQE    L       L  F +     P RI+V+RDGV + Q      +E+ A++     + +G     P I ++ V+KR  T+LF         +  N  PGT VD  I  P  ++F+L S    +GT+ P++Y+VL D   LT          +ELQ++TY + H Y     ++ +P P +YAH +A      LV + H   +GS P   +E
Sbjct:  511 VPGQRC-IKKLTDVQTSTM-----IKATARSAP-EREREI---SNLVRKAEFSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRTRATALPNQGVWDMRGKQFHTGIDVRVWAIACFAQQQHVK-ENDLRMFTNQLQRISNDAGMPIVGNPCFCKYAVGVEQVEPMFKYLKQNYSGIQLVVVVLPGKTPVYAEVKRVGDTVLGIATQCVQAKNAIRTTPQ----TLSNLCLKMNVKLGGVNSILLPNVRPRIFNEPVIFFGCDITHPPAGDSRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIISDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQFFNVLQYELRAIREACMMLERGYQ---PGITFIAVQKRHHTRLFAVDKKDQVGKAYNIPPGTTVDVGITHPTEFDFYLCSHAGIQGTSRPSHYHVLWDDNNLTA---------DELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDREHDSGEGSQPSGTSE 999          
BLAST of SMEDWI-2 vs. Ensembl Celegans
Match: alg-2 (pep:known chromosome:WBcel235:II:874160:878954:1 gene:WBGene00000106 transcript:T07D3.7b gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:alg-2)

HSP 1 Score: 119.398 bits (298), Expect = 9.056e-27
Identity = 127/516 (24.61%), Postives = 222/516 (43.02%), Query Frame = 1
Query: 1063 IPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSD-AATGMCNKWQLKIDNKPLEIEGRELPPCDVISGG-SKINEKMGDD--WKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNT-------CGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMST-GLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRP------TMIVGMDTYHNKSS---KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKP---LIENIYKGNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA-----ELVGKVH----KGSNP 2487
            +PG+ C L   +D + S M     +    +  P ER  +I   C  +  ++ +A    +++ + I+    E++GR L    ++ GG  +    + +   W     QF    + +         ++  + +N +     +L+ +  DA +  + T        G   VE       ++ S    + +V      +YA+VK    +  G+ TQCV  +N      +      S   +++  K G     +   +RP       + +G D  H  +    K SI A V S+++  ++Y + V   + RQE    L       L  F +     P RI+V+RDGV + QL     +E+ A++    ++E+ Y+      P I ++ V+KR  T+LF         +  N  PGT VD  I  P  ++FFL S    +GT+ P++Y+VL D   LT          +ELQ++TY + H Y     ++ +P P +YAH +A      LV + H    +GS P
Sbjct:  376 VPGQRC-LKKLTDVQTSTM-----IKATARSAP-EREREI---CKLVSKAELSADPFAHEFGITINPAMTEVKGRVLSAPKLLYGGRHRATTALPNQGVWDMRGKQFHTGMEVRTWAIACFAQQSHVK-ENDLRMFTTQLQRISTDAGMPIIGTPMFCKYASGVEQVEPMFKYLKQTYSAIQLIVVVLPGKTPIYAEVKRVGDTVLGIATQCVQAKNAIRTTPQ----TLSNLCLKMNVKLGGVNSILLPNVRPRIFNEPVIFLGCDITHPAAGDTRKPSIAAVVGSMDAHPSRYAATVRVQQHRQEIITDLTYMVRELLVQFYRNTRFKPARIVVYRDGVSEGQLFNVLQYELRAIREACVMLESGYQ------PGITFIAVQKRHHTRLFAADKADQVGKAFNIPPGTTVDVGITHPTEFDFFLCSHAGIQGTSRPSHYHVLWDDNDLTA---------DELQQLTYQMCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDRDHGSGEEGSQP 861          
BLAST of SMEDWI-2 vs. Ensembl Fly
Match: piwi (piwi [Source:FlyBase gene name;Acc:FBgn0004872])

HSP 1 Score: 262.307 bits (669), Expect = 3.947e-72
Identity = 212/810 (26.17%), Postives = 365/810 (45.06%), Query Frame = 1
Query:  133 NLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEK-----KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK--VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRD----------IITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDW-KFGRVQ--FDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGK---VNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS--SKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSI----NSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVG 2463
            N +PA++  K G  G  V LQ+NF +       + + Y   F     +P+V++  +      N L   + FDG +LFT+ K+  E +I   S   K     K++++ V  I      + Q++N++L      L  E +G+  F          PR       E   FK  +  G+ T++++  K       LL  E  ++V+   ++     R S +    +D          ++T YNN+TYRI+++         F   GR +S+ EY+  +YNIR+   +QP ++++ +    +    +                        + IP ELC + G + + +SN  L + +    +  P++R D + A+ + ++N+  +  +   W +++D    E++GR +   +++    K+      DW +  R Q       D      V+   RN  + +  ++ + +    M +  R  +   +         R ++D  RS     K+ L  VP+D    Y+ +K      G + + V T+  T +  K R ++S  +K  +Q+  K GY PW +E+ L   M +G D   + +  K++  A + S+    NST   Y S V           TL      AL  ++  +  LP RI+ +RDGV    L+    FEV  +   ++  Y       PQ+ Y++V + + T+ F  G NP PGT+VD  I  P  Y+F+LVSQ+  +GT +PT+YNVL  +  L         +P ++QK+TY + HLY+NW GT RVP    YA +LA LVG
Sbjct:   80 NTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSN--HANLLGSGYLFDGLQLFTTRKF--EQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---------DPRAK----IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKTNASEL----------------------VVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSD---PKLILCLVPNDNAERYSSIKK----RGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGL---------SPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          
BLAST of SMEDWI-2 vs. Ensembl Fly
Match: piwi (piwi [Source:FlyBase gene name;Acc:FBgn0004872])

HSP 1 Score: 262.307 bits (669), Expect = 3.947e-72
Identity = 212/810 (26.17%), Postives = 365/810 (45.06%), Query Frame = 1
Query:  133 NLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEK-----KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK--VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRD----------IITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDW-KFGRVQ--FDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGK---VNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS--SKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN-KSSKKSIQASVFSI----NSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVG 2463
            N +PA++  K G  G  V LQ+NF +       + + Y   F     +P+V++  +      N L   + FDG +LFT+ K+  E +I   S   K     K++++ V  I      + Q++N++L      L  E +G+  F          PR       E   FK  +  G+ T++++  K       LL  E  ++V+   ++     R S +    +D          ++T YNN+TYRI+++         F   GR +S+ EY+  +YNIR+   +QP ++++ +    +    +                        + IP ELC + G + + +SN  L + +    +  P++R D + A+ + ++N+  +  +   W +++D    E++GR +   +++    K+      DW +  R Q       D      V+   RN  + +  ++ + +    M +  R  +   +         R ++D  RS     K+ L  VP+D    Y+ +K      G + + V T+  T +  K R ++S  +K  +Q+  K GY PW +E+ L   M +G D   + +  K++  A + S+    NST   Y S V           TL      AL  ++  +  LP RI+ +RDGV    L+    FEV  +   ++  Y       PQ+ Y++V + + T+ F  G NP PGT+VD  I  P  Y+F+LVSQ+  +GT +PT+YNVL  +  L         +P ++QK+TY + HLY+NW GT RVP    YA +LA LVG
Sbjct:   80 NTRPAELVSKKGTDGVPVMLQTNFFRLKTKPEWRIVHYHVEFEPSIENPRVRMGVLSN--HANLLGSGYLFDGLQLFTTRKF--EQEITVLSGKSKLDIEYKISIKFVGFISCAEPRFLQVLNLILRRSMKGLNLELVGRNLF---------DPRAK----IEIREFKMELWPGYETSIRQHEK-----DILLGTEITHKVMRTETIYDIMRRCSHNPARHQDEVRVNVLDLIVLTDYNNRTYRINDVDFGQTPKSTFSCKGRDISFVEYYLTKYNIRIRDHNQPLLISKNRDKALKTNASEL----------------------VVLIP-ELCRVTGLNAEMRSNFQLMRAMSSYTRMNPKQRTDRLRAFNHRLQNTPESVKVLRDWNMELDKNVTEVQGRIIGQQNIVFHNGKVPAGENADWQRHFRDQRMLTTPSDGLDRWAVIAPQRNSHELRTLLDSLYRAASGMGLRIRSPQEFIIYDDRTGTYVRAMDDCVRSD---PKLILCLVPNDNAERYSSIKK----RGYVDRAVPTQVVTLKTTKNRSLMSIATKIAIQLNCKLGYTPWMIELPLSGLMTIGFDIAKSTRDRKRAYGALIASMDLQQNST---YFSTVTECSAFDVLANTLWPMIAKALRQYQHEHRKLPSRIVFYRDGVSSGSLKQLFEFEVKDIIEKLKTEYARVQLSPPQLAYIVVTRSMNTRFFLNGQNPPPGTIVDDVITLPERYDFYLVSQQVRQGTVSPTSYNVLYSSMGL---------SPEKMQKLTYKMCHLYYNWSGTTRVPAVCQYAKKLATLVG 825          
BLAST of SMEDWI-2 vs. Ensembl Fly
Match: AGO3 (Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250816])

HSP 1 Score: 254.218 bits (648), Expect = 2.063e-69
Identity = 214/816 (26.23%), Postives = 377/816 (46.20%), Query Frame = 1
Query:  166 GNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKA-----------YNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP-------NDVERCLNDAARSGSGCAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            G+ G +V +  N+ K +   S+    Y+  F     S  ++++++     ++KL G   FDG  L+       +  +     ++ ++ +R++     E     Q+ N+L + +  +L   +  +  F  P          S P        +V  G+ T +    +  G L  +L  +  +R+L   +V++            Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K+ +NI +   +QP + +  K       ++  +  +                     IP ELC+L G  D+ +S+  L + +    +  P +R   +  +   + N+ AA  + N W L + N   +I GR++    +    SKI+   G   +F +     +  +   +   I+       +N+       L NM+       +N   P       + ++  +    R+ +   +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+    S    + E +  +LFYL
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND--HKDKLGGTKTFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQF-DP----------SRPKIIPLAKLEVWPGYVTAVD---EYKGGL--MLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGIPAERENLQFCL---------------------IP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF--SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWII----IHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQ----SIQRDVAEALSEKLFYL 867          
BLAST of SMEDWI-2 vs. Ensembl Fly
Match: AGO3 (Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250816])

HSP 1 Score: 254.218 bits (648), Expect = 2.063e-69
Identity = 214/816 (26.23%), Postives = 377/816 (46.20%), Query Frame = 1
Query:  166 GNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKA-----------YNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP-------NDVERCLNDAARSGSGCAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            G+ G +V +  N+ K +   S+    Y+  F     S  ++++++     ++KL G   FDG  L+       +  +     ++ ++ +R++     E     Q+ N+L + +  +L   +  +  F  P          S P        +V  G+ T +    +  G L  +L  +  +R+L   +V++            Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K+ +NI +   +QP + +  K       ++  +  +                     IP ELC+L G  D+ +S+  L + +    +  P +R   +  +   + N+ AA  + N W L + N   +I GR++    +    SKI+   G   +F +     +  +   +   I+       +N+       L NM+       +N   P       + ++  +    R+ +   +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+    S    + E +  +LFYL
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND--HKDKLGGTKTFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQF-DP----------SRPKIIPLAKLEVWPGYVTAVD---EYKGGL--MLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGIPAERENLQFCL---------------------IP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF--SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWII----IHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQ----SIQRDVAEALSEKLFYL 867          
BLAST of SMEDWI-2 vs. Ensembl Fly
Match: AGO3 (Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250816])

HSP 1 Score: 254.218 bits (648), Expect = 2.063e-69
Identity = 214/816 (26.23%), Postives = 377/816 (46.20%), Query Frame = 1
Query:  166 GNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKA-----------YNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP-------NDVERCLNDAARSGSGCAKMALVFVP---DDRVYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRG----NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            G+ G +V +  N+ K +   S+    Y+  F     S  ++++++     ++KL G   FDG  L+       +  +     ++ ++ +R++     E     Q+ N+L + +  +L   +  +  F  P          S P        +V  G+ T +    +  G L  +L  +  +R+L   +V++            Y   +   L+G  ++T+YNN+TY+I++I  + N   +FE+     SY EY+K+ +NI +   +QP + +  K       ++  +  +                     IP ELC+L G  D+ +S+  L + +    +  P +R   +  +   + N+ AA  + N W L + N   +I GR++    +    SKI+   G   +F +     +  +   +   I+       +N+       L NM+       +N   P       + ++  +    R+ +   +M +       DDR YA +K    S   + +Q +  +  T +ND + + V  K V+Q+  K G   WTV+I  +  MI G+D+YH+ S++  S+ A V SINS+++Q+ S       R+E    L  +F +AL+ ++KR   LP  I+++RDG+GD QL    N+E+   + +  N  K        I Y++V+KR+ T++F+       NP PGTVVD+ I K N Y+FFLVSQ   +GT TPT+Y VL D              P+ +QK++Y L  LY+NW GT+R+P    YAH+LA L+G+    S    + E +  +LFYL
Sbjct:  122 GSKGSSVNIYCNYLKLTTDESKGVFNYEVRFFPPIDSVHLRIKYLND--HKDKLGGTKTFDGNTLYLPILLPNKMTVFISKAEDVELQIRILYKKKEEMRNCTQLYNILFDRVMKVLNYVKFDRKQF-DP----------SRPKIIPLAKLEVWPGYVTAVD---EYKGGL--MLCCDVSHRILCQKTVLEMLVDLYQQNVEHYQESARKMLVGNIVLTRYNNRTYKINDICFDQNPTCQFEIKTGCTSYVEYYKQYHNINIKDVNQPLIYSIKKSRGIPAERENLQFCL---------------------IP-ELCYLTGLRDEVRSDNKLMREIATFTRVSPNQRQMALNKFYENVSNTPAAQEILNSWGLSLTNNSNKISGRQMDIEQIYF--SKISVSAGRSAEFSKHAVTNEMLKVVHLSKWII----IHLRNYRQAATSLLDNMKQACESLGMNISNPTMISLDHDRIDAYIQALRRNITMNTQMVVCICHNRRDDR-YAAIKKICCSEIPIPSQVINAK--TLQNDLKIRSVVQKIVLQMNCKLGGSLWTVKIPFKNVMICGIDSYHDPSNRGNSVAAFVASINSSYSQWYSKAVVQTKREEIVNGLSASFEIALKMYRKRNGKLPTNIIIYRDGIGDGQLYTCLNYEIPQFEMVCGNRIK--------ISYIVVQKRINTRIFSGSGIHLENPLPGTVVDQHITKSNMYDFFLVSQLVRQGTVTPTHYVVLRDDC---------NYGPDIIQKLSYKLCFLYYNWAGTVRIPACCMYAHKLAYLIGQ----SIQRDVAEALSEKLFYL 867          
BLAST of SMEDWI-2 vs. Ensembl Zebrafish
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:ZFIN;Acc:ZDB-GENE-030813-2])

HSP 1 Score: 275.789 bits (704), Expect = 1.439e-76
Identity = 240/852 (28.17%), Postives = 393/852 (46.13%), Query Frame = 1
Query:   46 AKLEANGSETRGKMGNRGGLRRTFR---IVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKV---KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEK-KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSV---MKAYNRRSIDQ---------LIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVG-----KVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSN 2484
            A L+ +    + K+G RGG RR F    +    L       KTG  G  ++L++NF +  +L    + +Y      V   P +   +L+  +    E  L  A  FDG  LF   K      +   E  + EK ++T+ L + + P +    Q  N+L   +  +L  ++IG+ Y+ +P+           P     +   +  GF TT+ +      E + +L  +  ++VL   +V   M +  ++  DQ         L+G  I+TKYNNKTYRI +I  +   +  F+ G   +S+  YFK +Y + +T G+Q  +++ VK+     R                           + +P E C+L G +D+ +++ ++ K+L    +  P +R   I    + I  +         W L  +NK L + GR LP   +I GG          DW        +       I  + +D     Y     DV Q L     ++   +G      V     +  E  L    ++ +   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VEI LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S        QE  + L  +   AL+ + K  + LP RI+V+RDGVGD  LQ   ++EV  +   I+ +  G  +  P++  V+VKKR+ ++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G   PT+YNV+ D   L          P+ +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ +HK  N
Sbjct:   61 AMLQISAGFQQVKIGERGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMR--LLSRPMWALYQY---HVDYKPPMESRRLRSALLFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY-NPD----------DPFNIPQHRLTIWPGFMTTILQY-----ESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGRPPPGP---------------------AMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTM--GQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGL---------KPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848          
BLAST of SMEDWI-2 vs. Ensembl Zebrafish
Match: piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:ZFIN;Acc:ZDB-GENE-030813-2])

HSP 1 Score: 275.789 bits (704), Expect = 1.439e-76
Identity = 240/852 (28.17%), Postives = 393/852 (46.13%), Query Frame = 1
Query:   46 AKLEANGSETRGKMGNRGGLRRTFR---IVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKV---KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEK-KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSV---MKAYNRRSIDQ---------LIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVG-----KVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSN 2484
            A L+ +    + K+G RGG RR F    +    L       KTG  G  ++L++NF +  +L    + +Y      V   P +   +L+  +    E  L  A  FDG  LF   K      +   E  + EK ++T+ L + + P +    Q  N+L   +  +L  ++IG+ Y+ +P+           P     +   +  GF TT+ +      E + +L  +  ++VL   +V   M +  ++  DQ         L+G  I+TKYNNKTYRI +I  +   +  F+ G   +S+  YFK +Y + +T G+Q  +++ VK+     R                           + +P E C+L G +D+ +++ ++ K+L    +  P +R   I    + I  +         W L  +NK L + GR LP   +I GG          DW        +       I  + +D     Y     DV Q L     ++   +G      V     +  E  L    ++ +   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VEI LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S        QE  + L  +   AL+ + K  + LP RI+V+RDGVGD  LQ   ++EV  +   I+ +  G  +  P++  V+VKKR+ ++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G   PT+YNV+ D   L          P+ +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ +HK  N
Sbjct:   61 AMLQISAGFQQVKIGERGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMR--LLSRPMWALYQY---HVDYKPPMESRRLRSALLFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY-NPD----------DPFNIPQHRLTIWPGFMTTILQY-----ESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGRPPPGP---------------------AMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTM--GQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGL---------KPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848          
BLAST of SMEDWI-2 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:ZFIN;Acc:ZDB-GENE-060526-345])

HSP 1 Score: 205.297 bits (521), Expect = 3.457e-53
Identity = 188/836 (22.49%), Postives = 368/836 (44.02%), Query Frame = 1
Query:  157 EKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFS-QVGLSPKVK---LQFIVRVCQENKLPGAFCFDGRRLFTSEKW----HGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYN------RRSID-----QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQEL----------------RNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDR--VYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNN----PNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            +K G  G  + + SN+              D+VF   V  +P V+   ++F +             FDG  L+  ++     H +++ ++  + E  + ++L   + P ++      NV+L  +  +LG + +G+ ++  PN                 +  +V  G+ T+++      G L   L ++  ++VL ++SV+   N      R S       + +G  +IT+YNN+TYRI +I+   +  + F +  G   ++ +Y+++ Y I + + DQP ++                       ++             L +P EL F+ G  ++ + +    K+L   +    ++    +    + I +++ A     +W L I  + L  +GR LP   +    +        DW    V       R   I  V ++     Y     D  +EL                R +R++ R  +  T     +   L    R      ++ +  +  +R  +Y+ +K    + + + +Q +  R  T    ++ + V+ K ++QI  K G + WTV + L+  M++G+D +H+ S K +S+   V S+NS  T++ S V      +E           AL+ + +     P++I+++RDGV D QL+  +++E+  +    E I        P++ +++V+KR+ T L++ G++    P+PGTV+D  +   ++ +F+L++    +G   PT+Y  + +T  LT         P+ LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+       + ++E    +LF+L
Sbjct:  288 QKIGTKGSPIPIGSNYIPICCKN-------DAVFQYHVTFTPNVESLSMRFGMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAE-RKTDNQEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHY-DPNAV----------VILGKHRLQVWPGYSTSIKHTD---GGL--YLVVDVSHKVLRNDSVLDVMNLIYQGSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLI--------------------HRPKERSRPGGKVITGEILLLP-ELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICLHSASFVTSPAVDWSRELV-------RDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFV-KSIHSQLTSEPR-----VQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVR--TISQPQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETIPNYE----PKLAFIVVQKRISTTLYSYGSDHFGTPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNTANLT---------PDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLHSEPAIQLSE----KLFFL 1046          
BLAST of SMEDWI-2 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:ZFIN;Acc:ZDB-GENE-060526-345])

HSP 1 Score: 205.297 bits (521), Expect = 3.457e-53
Identity = 188/836 (22.49%), Postives = 368/836 (44.02%), Query Frame = 1
Query:  157 EKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFS-QVGLSPKVK---LQFIVRVCQENKLPGAFCFDGRRLFTSEKW----HGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYN------RRSID-----QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQEL----------------RNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDR--VYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNN----PNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            +K G  G  + + SN+              D+VF   V  +P V+   ++F +             FDG  L+  ++     H +++ ++  + E  + ++L   + P ++      NV+L  +  +LG + +G+ ++  PN                 +  +V  G+ T+++      G L   L ++  ++VL ++SV+   N      R S       + +G  +IT+YNN+TYRI +I+   +  + F +  G   ++ +Y+++ Y I + + DQP ++                       ++             L +P EL F+ G  ++ + +    K+L   +    ++    +    + I +++ A     +W L I  + L  +GR LP   +    +        DW    V       R   I  V ++     Y     D  +EL                R +R++ R  +  T     +   L    R      ++ +  +  +R  +Y+ +K    + + + +Q +  R  T    ++ + V+ K ++QI  K G + WTV + L+  M++G+D +H+ S K +S+   V S+NS  T++ S V      +E           AL+ + +     P++I+++RDGV D QL+  +++E+  +    E I        P++ +++V+KR+ T L++ G++    P+PGTV+D  +   ++ +F+L++    +G   PT+Y  + +T  LT         P+ LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+       + ++E    +LF+L
Sbjct:  288 QKIGTKGSPIPIGSNYIPICCKN-------DAVFQYHVTFTPNVESLSMRFGMMKEHRPTTGEVVAFDGSILYLPKRLEEVVHLKAE-RKTDNQEIDIKIQLTKILPPSSDLCIPFYNVVLRRVMKILGLKLVGRNHY-DPNAV----------VILGKHRLQVWPGYSTSIKHTD---GGL--YLVVDVSHKVLRNDSVLDVMNLIYQGSRESFQDECTKEFVGSIVITRYNNRTYRIDDIEWSKSPKDTFTLADGSVTTFVDYYRKNYGITIKELDQPLLI--------------------HRPKERSRPGGKVITGEILLLP-ELSFMTGIPEKMRKDFRAMKDLTMHINVGAQQHTQSLKQLLHNINSNNEALSELGRWGLSISQEILVTQGRTLPSETICLHSASFVTSPAVDWSRELV-------RDPSISTVPLNCWAVFYPRRATDQAEELVTTFSRVAGPMGMRVERPIRVELRDDRTETFV-KSIHSQLTSEPR-----VQLVVCIMTGNRDDLYSAIKKLCCIQSPVPSQAINVR--TISQPQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETIPNYE----PKLAFIVVQKRISTTLYSYGSDHFGTPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNTANLT---------PDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLHSEPAIQLSE----KLFFL 1046          
BLAST of SMEDWI-2 vs. Ensembl Zebrafish
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:ZFIN;Acc:ZDB-GENE-060526-345])

HSP 1 Score: 162.155 bits (409), Expect = 1.051e-42
Identity = 89/288 (30.90%), Postives = 160/288 (55.56%), Query Frame = 1
Query: 1681 TNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK-KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNN----PNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            T    ++ + V+ K ++QI  K G + WTV + L+  M++G+D +H+ S K +S+   V S+NS  T++ S V      +E           AL+ + +     P++I+++RDGV D QL+  +++E+  +    E I        P++ +++V+KR+ T L++ G++    P+PGTV+D  +   ++ +F+L++    +G   PT+Y  + +T  LT         P+ LQ++T+ + HLY+NW GTIRVP P  YAH+LA L G+       + ++E    +LF+L
Sbjct:   22 TISQPQKLRSVAQKILLQINCKLGGELWTVNVPLKYLMVIGVDVHHDTSKKSRSVMGFVASLNSMLTKWYSRVTFQMPNEEIINGFRVCLLAALQKYYEVNHAFPEKIVIYRDGVSDGQLKTVEHYEIPQILKCFETIPNYE----PKLAFIVVQKRISTTLYSYGSDHFGTPSPGTVLDHTVTNRDWVDFYLMAHSIRQGCGLPTHYITVYNTANLT---------PDHLQRLTFKMCHLYWNWPGTIRVPAPCKYAHKLAFLSGQYLHSEPAIQLSE----KLFFL 292          
BLAST of SMEDWI-2 vs. Ensembl Xenopus
Match: piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:Xenbase;Acc:XB-GENE-982236])

HSP 1 Score: 220.705 bits (561), Expect = 1.321e-58
Identity = 200/773 (25.87%), Postives = 352/773 (45.54%), Query Frame = 1
Query:  340 CFDGRRLFTSEKWHGESDIQEFSHDEK---KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYN-----------RRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEK-----MGDDWKFGR-VQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVGKVNTCGPNDVERCLND-----AARS------GSGCAKMALVFVPDDR--VYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKS-SKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
             FDG  L+   K     +++     +    K+T+++   + P ++      NV++  +  +L  + +G+ ++          P +S  T  +    +V  G+   ++   K  G L   L ++  ++++  +SV+   N                QL+G  +IT+YNN+TYRI +I+  M+  + F M  G  +S+ +Y+ + Y I + + DQP +L                      +  ER+    +  D+ L +P EL F+ G  ++ + +    K+L   +   P++    +      I++S  A     +W L +D       GR LP         KIN +      G+D  + R V  +  R   H +   ++      Y    +   QEL +M  RI   +G +    PN VE  L D      ARS      G G  ++ +  +   R  +Y  +K    +   + +Q + TR  T    ++ + ++ K ++QI  K G + W V+I L+  M++GMD YH+ S   +S+   V SINS  T + S V      QE  ++L      AL+ F +    LP++I+V+RDGV D QL   +N+E+  ++   +     N    P+++ ++V+KRV T L++        P PGTV+D  +    + +FFL+S    +G   PT+Y  + +T  L          P+ LQ++T+ L H+Y+NW GTIRVP P  YAH+LA L G+       +    ++ ++LF+L
Sbjct:  250 AFDGSILYLPVKLAQTVELESERRTDGQKIKITIQMTKILDPSSDLCLPFYNVVMRRVFKILDLKLVGRNFY---------DPASS--TVLQQYRLQVWPGYAANIR---KTDGGL--FLLVDITHKIIRSDSVLDIMNILYQQSPENFQDEVTKQLVGSIVITRYNNRTYRIDDIEWNMSPKDSFSMSDGSKVSFIDYYSKNYGITVKELDQPLLL---------------------HRPSERKAPKGKALDIVLLLP-ELAFMTGIPEKMRKDFRAMKDLTQQIHLSPKQHHISLGKLLKRIESSADAKNELQRWGLFLDTDIHMTTGRILP-------IEKINLRNNSFPAGEDLNWNREVTREACRSSVHLLYWAMI------YPKRASAQAQELSSMLERIGGPIG-IRVNHPNCVE--LRDDRVETYARSIKSLLEGEGKVQLLVCLISGTRDDLYGAIKKLCCVQNPVPSQVINTR--TISQPQKLRSIAQKILLQINCKLGGELWGVDIPLKSVMVIGMDVYHDPSRGMRSVLGFVASINSCLTAWYSRVVFQLPNQEIMDSLKLCLVAALQKFFEVNHSLPEKIVVYRDGVSDGQLNTVENYEIPQLQTCFQTFDNYN----PRMVVIVVQKRVSTNLYSTATGQFLTPQPGTVIDHTVTNRKWIDFFLMSHHVRQGCGIPTHYICVMNTANL---------GPDHLQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQFLHHEPSI----KLCDKLFFL 949          
BLAST of SMEDWI-2 vs. Ensembl Xenopus
Match: piwil3 (piwi-like RNA-mediated gene silencing 3 [Source:Xenbase;Acc:XB-GENE-6469412])

HSP 1 Score: 215.698 bits (548), Expect = 3.184e-57
Identity = 214/850 (25.18%), Postives = 393/850 (46.24%), Query Frame = 1
Query:   85 MGNRGGLRRTFRIVEPNLQPA--DITE-KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVK---LQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNS-GPTF---FETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELC-----FLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGG--SKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVG-KVNTCGPNDVERCLNDAAR----SGSGCAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNK-SSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            +G+RGG RR F  +  N + A   + E KTG+ G  ++L +N  K  ++   +++++      +  +P+++   L+  +    E  +  A  FDG  LF  ++    +++  Q  + +  K+T+ L + + P +   +Q  N++   L  M+  ++IG+ Y+ +PN   D++  +S G T    F T+  +       ++    K     T L Y+  +N+ +  +   K ++  S D LIG+ ++TKYNNKTYRI +I  +   +  F+   G  +S+ +Y++       T+ + P  +          +   +    +K ++                I   LC     F  G +D+ +S+ ++ K+L    +  P +R   +  +   I   D+       W L  D+K L   GR  P   ++  G  +  N +  D W        + R +  +  V++  R ++   +  N + Q L   ++  ++G K+N     +V+   +   +      +   +M +  +  +R   Y  +K +  +   + +QCV  +  T    +    V++K  +Q+  K G + WTVEI L+  MIVG+D YH+  S K+SI A V S+N + T++ S       +QE  + L    +     F     +   +  +        Q+    +F +     LI++         P++  ++VKKRV  + F     R  NP PGT+VD EI +P +Y+FF++SQ    G+ +PT+YNV+ D+  L          P+ +Q++TY L HLY+NW G IRVP P  YAH+LA LVG+ +H+  +       + +RL+YL
Sbjct:   73 LGDRGGRRRDFHDLGINTRQAIEHVKESKTGSSGSIIQLSTNHIK--LISRPQWVLFQY---HIDYAPQMESRGLRCALLFQHEELIGKARAFDGTMLFLPKRLDKVNEVFSQTRNGETVKITITLTNELPPTSPTCFQFYNIIFRRLLKMMNMKQIGRNYY-NPN---DQIEISSHGLTIYPGFSTSILQYENNIMLSIDVSHKVLRSETVLDYMYNVNQKVESH---KFHDICSKD-LIGQIVLTKYNNKTYRIDDINWDFTPESTFKKSDGSEISFVDYYR-------TEFEHPLPIRSAAMEQFMTKILNEAFKKDKGEKGRPI------------IRDVLCVKIIPFHSGLTDRMRSDFNVMKDLAIHTRLAPEQREIQVGKFLKNIHKDDSVQKELQDWGLNFDSKLLPFAGRVAPAEKILQAGKTADYNPQFAD-WSRELRGPTLIRVKHLDNWVLLYTRRNY---DAANTLTQNL--FKVSGQMGIKMNRAVMVEVDDTTDAYVKVLQQKVTPDVQMVVCLLSSNRKDKYDAIKKYLCIDCPVPSQCVLAK--TLNKPQTVVSVATKIALQMNCKMGGELWTVEIPLKELMIVGIDCYHDTLSGKRSIGAFVASLNPSMTRWFSRCVLQAQKQEIVDGLKVCMHEGKRCFLNSCQVCLYKSKIQGTVFLQGQVHLAVHFRLSV---LIQSRLALQEDYNPKLTVIVVKKRVSARFFAHVGGRLQNPPPGTIVDVEITRPEWYDFFIISQSVRVGSVSPTHYNVVYDSGAL---------KPDHMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPHLT-----LSDRLYYL 865          
BLAST of SMEDWI-2 vs. Ensembl Xenopus
Match: piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:Xenbase;Acc:XB-GENE-993661])

HSP 1 Score: 198.749 bits (504), Expect = 5.017e-52
Identity = 195/840 (23.21%), Postives = 365/840 (43.45%), Query Frame = 1
Query:  157 EKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEK--------KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM--------KAYNRRSID----QLIGRDIITKYNNKTYRISEIKEMN--VDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRND----FQYKNFMNDVEQELRN--MRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDR-----VYAKVKSFTMSTG--LLTQCV---TTRNGTNRNDKRRKV----VSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKK-SIQASVF-SINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFN---RG-NNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
             KTG  G  VKL +N    ++    K   Y   FS    S K+K   +        L  A  F G  LF S       +I + +H E         K+T+ L + +  ++    +  +V    +   L   ++G+ Y+             + P     +   +  GF  ++ +      E    L  +  ++VL + +V+        K    R  D    +L+G  ++T+YNNKTYR+ +I       D      G  ++Y +Y+ ++Y+I ++   QP +++ +K                                  +++  ELC+L G S +  S+  L K+L    + +P  R   +    + I+ +  A+    KW L++D K + + GR  PP  +    +        DW          RD ++E  + +    +    F Y+N   DV + L    M++ + +G        D+ R +       S    +     PD +     V + V+ F  S+   ++ +C           R+ ++R +    V ++   +++   G   + + +  +  ++  +    ++++ +  I+AS+  S++ +FT + S     K   +F + L      A++++++  + LP RI+V+RDGVGD QL+   ++E+     L+ +  +      P++  ++V+K+  ++ +    RG  NP  GT+VD E  +P +Y+F+L+SQ   +GT  PT YNVL D          + + P+ +Q++TY L HLY+NW G IRVP P  YAH+L  LVG+ +H+  +P      + ++LFYL
Sbjct:   38 HKTGTSGAPVKLMTNLFGLTLPTQWKLYQYRVDFSPEFASRKLKTALLYS--HGETLGRARAFHGEILFLSR------NIGKLNHLESTTRKGETVKITITLTNQLPADSPVCLEFCHVYFLRVFKSLNMYQVGRNYY-----------NPADPVIIPQHRLMLWPGFVLSIMKL-----ESQLALCADVSHKVLRNETVLDSMKALYSKVPKERFTDICEKELLGLVVLTRYNNKTYRVDDIDWSTKPTDSFPRKDGSEITYTDYYSQQYSINISDLQQPMLVSALKAKKSDNPDAPR----------------------AVHLIPELCYLTGLSSRALSDFRLMKDLSMETQLDPERRQQRLQRLADSIQRTPEASAELEKWGLRMD-KQIPVTGRIAPPERIFMRDNVCTPGSPADWA---------RDTRNEKVICVAPLQNWLMLFSYRN--ADVAENLLQCLMKVASGMG-----FHMDMPRIVQVEDNPVSFLRTLQKNVTPDLQLPVCLVSSPVRKFHKSSEARIIAKCCYPPAPLCVALRSVEKRAIDLLCVGTELHTEVYCSLGSQQFCIAMPHKYRIMENISNLWSRTTGRVQIRASIIASVSPSFTLWHSRCIIQKTTSDFADCLKMCMKGAIQNWQRCNNDLPNRIVVYRDGVGDGQLKMVVDYEIPQ---LLSSFRETKTSYCPRLSVIVVRKKCISRFYTQTGRGIQNPVLGTIVDSEATRPEWYDFYLISQNARQGTVNPTYYNVLLDE---------NGLKPDHMQRLTYKLCHLYYNWPGVIRVPAPCQYAHKLTFLVGQSIHREPSP-----ELSHKLFYL 797          
BLAST of SMEDWI-2 vs. Ensembl Xenopus
Match: ago3 (argonaute RISC catalytic component 3 [Source:Xenbase;Acc:XB-GENE-6462752])

HSP 1 Score: 120.553 bits (301), Expect = 2.725e-27
Identity = 115/454 (25.33%), Postives = 188/454 (41.41%), Query Frame = 1
Query: 1219 ATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGS--KINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARV---GKVNTC----GPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMST-GLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFG------YDPWTVEIKLRPTMIVGMDTYHNKSS---KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF--------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA-----ELVGKVHKGSN 2484
            A     ++Q K+ ++   + GR LP   +  GG    +       W     QF    + K         +   + +  +     +LR +  DA +   G+   C    G + VE        + SG   + ++      VYA+VK    +  G+ TQCV  +N    + +      S   ++I  K G             +  +P + +G D  H  +    K SI A V S+++  ++Y + V   + RQE    L       L  F K     P RI+ +RDGV + Q +    +E+ A++    ++ K      P I Y++V+KR  T+LF         R  N   GT VD +I  P  ++F+L S    +GT+ P++Y+VL D    T          +ELQ +TY L H Y     ++ +P P +YAH +A      LV K H  + 
Sbjct:  389 ADPFVQEFQFKVRDEMAHVTGRVLPAPMLQYGGRNRTVATPSHGVWDMRGKQFHTGVEIKMWAIACFATQRQCR-EEILKGFTDQLRKISKDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYSGLQLIIVILPGKTPVYAEVKRVGDTLLGMATQCVQVKNVIKTSPQ----TLSNLCLKINVKLGGINNILVPHQRPSVFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPSRYCATVRVQRPRQEIIHDLASMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFRQVLYYELLAIREACISLEKDYQ---PGITYIVVQKRHHTRLFCADRTERVGRSGNIPAGTTVDTDITHPYEFDFYLCSHAGIQGTSRPSHYHVLWDDNCFTA---------DELQLLTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAE 825          
BLAST of SMEDWI-2 vs. Ensembl Xenopus
Match: ago2 (argonaute RISC catalytic component 2 [Source:Xenbase;Acc:XB-GENE-1001916])

HSP 1 Score: 114.39 bits (285), Expect = 2.043e-25
Identity = 104/372 (27.96%), Postives = 164/372 (44.09%), Query Frame = 1
Query: 1462 QELRNMRIDARV---GKVNTC----GPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMST-GLLTQCVTTRN------GTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS---KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF---------NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLA-----ELVGKVHKGSN 2484
            ++LR +  DA +   G+   C    G + VE        + +G   + ++      VYA+VK    +  G+ TQCV  +N       T  N   +  V    V  I    G  P    +  +P + +G D  H  +    K SI A V S+++   +Y + V   + RQE  + L       L  F K     P RI+ +RDGV + Q Q   + E+ A++     + K      P I +++V+KR  T+LF           GN P  GT VD +I  P+ ++F+L S    +GT+ P++Y+VL D    +          +ELQ +TY L H Y     ++ +P P +YAH +A      LV K H  + 
Sbjct:  487 EQLRKISRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYTGLQLVVVILPGKTPVYAEVKRVGDTVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPP----VFQQPVIFLGADVTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLSAMVRELLIQFYKSTRFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQ---PGITFIVVQKRHHTRLFCTDRNERVGKSGNIPA-GTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSS---------DELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAE 841          
BLAST of SMEDWI-2 vs. Ensembl Mouse
Match: Piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:MGI Symbol;Acc:MGI:1928897])

HSP 1 Score: 258.455 bits (659), Expect = 1.028e-70
Identity = 224/875 (25.60%), Postives = 387/875 (44.23%), Query Frame = 1
Query:   40 KVAKLEANGSETRGKMGNRGGLRRTFRIVEPNL-QPADITE--KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKW-HGESDI--QEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSK-------------------INEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            K  +L+ +       +  RGG RR F  +  N  Q  D  +  KTG+ G  VKL +N   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++  H  +++  Q  + +  ++T+ L + + P +    Q  N++   L  ++  ++IG+ Y+             S P     +   +  GF T++ +      E   +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++++YN  +T   QP ++++ K+                                 + IP ELC+L G +D+ +++ ++ K+L    +  P +R  ++    ++I   D        W L  D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    M    ++   + +D R             R L     S +      L     D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V++ L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P R++V+RDGVGD QL+   N+EV      ++++ +G     P++  ++VKKRV  + F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D+           + P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+       N  + NRL+YL
Sbjct:   62 KSQELQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVKLSTN--HFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGRCHAFDGTILFLPKRLQHKVTEVFSQTRNGEHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPSDPIDIPNHRLVIWPGFTTSILQY-----ENNIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQVSKELIGLIVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGP---------------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGIQMKKAIMIEVDDRT--------EAYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQFLDCLKSVGRGYN---PRLTVIVVKKRVNARFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDS---------SGLKPDHIQRLTYKLCHVYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREP-----NLSLSNRLYYL 862          
BLAST of SMEDWI-2 vs. Ensembl Mouse
Match: Piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:MGI Symbol;Acc:MGI:3041167])

HSP 1 Score: 229.95 bits (585), Expect = 1.582e-61
Identity = 210/824 (25.49%), Postives = 366/824 (44.42%), Query Frame = 1
Query:  160 KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEK-----KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERIN-RVLNDNSV------------MKAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEM-GGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDW-KFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDA---RVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS-VFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEV-DAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            KTG+ G  V+L +N     + +  +   Y   +S    S ++++  +           A  FDG  LF SEK   +  + E + + +     K+TL L S + P +    Q  NV+   +   L   +IG+ ++           + S P         +  GF  ++          + LL+   +N +VL + +V            M  +      QL+G  ++T+YNNKTYRI +I   +   + F+   G  ++Y +Y+K++Y+I L+  +QP +++ +K+      + +                        +++  ELCFL G S Q  S+  L K +    +  P  R   +    + I+ +  A      W L   ++ L + GR +P   ++            DW K  R    +     +   +V  +R +   + F++ + +   +M  +    ++ KV+   P    R +      G    ++ +  +P ++   Y  +K +  S   + +QCV TR  T         V++K  MQ+  K G + W+VEI L+  M+VG+D   +  +K  +    V SINS  T++ S     +   +  + L      AL  + +    LP RI+V+RDGVG+ QL+    +EV   +K + E    G+     ++  V+V+KR   +LF   +    NP  GTVVD E  +P +Y+F+L+SQ   +GT +PT+YNV+ D          + + P+ +Q++T+ L HLY+NW G I VP P  YAH+L  LV + VHK       +  + N LFYL
Sbjct:   93 KTGSSGIPVRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYN--HSILSDKAKAFDGASLFLSEKL--DQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQIGRNFY-----------KPSEPVEIPQYKLSLWPGFAISVSHFE------SKLLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCHKQLVGLVVLTRYNNKTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKRKRNDNSEPQM-----------------------VHLMPELCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRNPVARFELETWGLHFGSQ-LSLTGRVVPSEKILLQDHTCQPAFAADWSKDMRSCKVLSSQPLNRWLIVCCNRAEHLIEAFLSCLRRVGGSMGFNVGYPKIIKVDE-TPAAFLRAIQ---VHGDPDVQLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTR--TLNKQGTMLSVATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTEC---GSDARSCRLSVVVVRKRCLLRLFASTDHTVQNPPLGTVVDSEATRPEWYDFYLISQTANRGTVSPTHYNVIYDD---------NALKPDHMQRLTFKLCHLYYNWQGLISVPAPCQYAHKLTFLVAQSVHKEP-----SLELANNLFYL 848          
BLAST of SMEDWI-2 vs. Ensembl Mouse
Match: Piwil1 (piwi-like RNA-mediated gene silencing 1 [Source:MGI Symbol;Acc:MGI:1928897])

HSP 1 Score: 223.016 bits (567), Expect = 2.434e-59
Identity = 203/831 (24.43%), Postives = 360/831 (43.32%), Query Frame = 1
Query:   40 KVAKLEANGSETRGKMGNRGGLRRTFRIVEPNL-QPADITE--KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKW-HGESDI--QEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM------------KAYNRRSIDQLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSK-------------------INEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLF----NRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNW 2400
            K  +L+ +       +  RGG RR F  +  N  Q  D  +  KTG+ G  VKL +N   F +    ++ +Y        L    +L+  +    E+ +     FDG  LF  ++  H  +++  Q  + +  ++T+ L + + P +    Q  N++   L  ++  ++IG+ Y+             S P     +   +  GF T++ +      E   +L  +  ++VL   +V+              +  +   +LIG  ++TKYNNKTYR+ +I  + N    F+   G  +S+ EY++++YN  +T   QP ++++ K+                                 + IP ELC+L G +D+ +++ ++ K+L    +  P +R  ++    ++I   D        W L  D+  L   GR L    +  GG                     I+ K  D+W        I   R +E    ++ +N F+    M    ++   + +D R             R L     S +      L     D+  A  K         +QCV  R  T    +    +++K  +Q+  K G + W V++ L+  MIVG+D YH+ ++ ++SI   V SIN   T++ S        QE  + L      AL  +    + +P R++V+RDGVGD QL+   N+EV      ++++ +G     P++  ++VKKRV  + F     R  NP PGTV+D E+ +P +Y+FF+VSQ    G+ +PT+YNV+ D+           + P+ +Q++TY L H+Y+NW
Sbjct:   62 KSQELQISAGFQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVKLSTN--HFRLTSRPQWALYQYHIDYNPLMEARRLRSALLFQHEDLIGRCHAFDGTILFLPKRLQHKVTEVFSQTRNGEHVRITITLTNELPPTSPTCLQFYNIIFRRLLKIMNLQQIGRNYY-----------NPSDPIDIPNHRLVIWPGFTTSILQY-----ENNIMLCTDVSHKVLRSETVLDFMFNLYQQTEEHKFQEQVSKELIGLIVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKRRRGPGGTLPGP---------------------AMLIP-ELCYLTGLTDKMRNDFNVMKDLAVHTRLTPEQRQREVGRLIDYIHKDDNVQRELRDWGLSFDSNLLSFSGRILQSEKIHQGGKTFDYNPQFADWSKETRGAPLISVKPLDNWLL------IYTRRNYEAANSLI-QNLFKVTPAMGIQMKKAIMIEVDDRT--------EAYLRALQQKVTSDTQIVVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVAR--TLGKQQTVMAIATKIALQMNCKMGGELWRVDMPLKLAMIVGIDCYHDTTAGRRSIAGFVASINEGMTRWFSRCVFQDRGQELVDGLKVCLQAALRAWSGCNEYMPSRVIVYRDGVGDGQLKTLVNYEVPQFLDCLKSVGRGYN---PRLTVIVVKKRVNARFFAQSGGRLQNPLPGTVIDVEVTRPEWYDFFIVSQAVRSGSVSPTHYNVIYDS---------SGLKPDHIQRLTYKLCHVYYNW 823          
BLAST of SMEDWI-2 vs. Ensembl Mouse
Match: Piwil4 (piwi-like RNA-mediated gene silencing 4 [Source:MGI Symbol;Acc:MGI:3041167])

HSP 1 Score: 169.088 bits (427), Expect = 1.402e-43
Identity = 108/328 (32.93%), Postives = 172/328 (52.44%), Query Frame = 1
Query: 1576 KMALVFVPDDR--VYAKVKSFTMS-TGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQAS-VFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEV-DAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            ++ +  +P ++   Y  +K +  S   + +QCV TR    +       V++K  MQ+  K G + W+VEI L+  M+VG+D   +  +K  +    V SINS  T++ S     +   +  + L      AL  + +    LP RI+V+RDGVG+ QL+    +EV   +K + E    G+     ++  V+V+KR   +LF   +    NP  GTVVD E  +P +Y+F+L+SQ   +GT +PT+YNV+ D          + + P+ +Q++T+ L HLY+NW G I VP P  YAH+L  LV + VHK       +  + N LFYL
Sbjct:  150 QLVMCILPSNQKNYYDSIKKYLSSDCPVPSQCVLTRTLNKQGTMLS--VATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKNVVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKAVLEYEVPQLLKSVTEC---GSDARSCRLSVVVVRKRCLLRLFASTDHTVQNPPLGTVVDSEATRPEWYDFYLISQTANRGTVSPTHYNVIYDD---------NALKPDHMQRLTFKLCHLYYNWQGLISVPAPCQYAHKLTFLVAQSVHKEP-----SLELANNLFYL 458          
BLAST of SMEDWI-2 vs. Ensembl Mouse
Match: Piwil2 (piwi-like RNA-mediated gene silencing 2 [Source:MGI Symbol;Acc:MGI:1930036])

HSP 1 Score: 170.629 bits (431), Expect = 2.101e-42
Identity = 130/487 (26.69%), Postives = 229/487 (47.02%), Query Frame = 1
Query: 1072 ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVGKVNTCGPNDVERCLND-----------AARSGSGCAKMALVFVPDDR--VYAKVKSFT-MSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKS-SKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNN----PNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKV 2469
            EL F+ G  ++ K +    K+L   +   P++    +      I  ++ A+    +W L +     +IEGR LP         +IN +         + +  +  R   I  + +      Y     D  +EL NM  +I   +G +    P  VE  L D           +     G  +M +  +   R  +Y  +K    + + + +Q +  R  T     R + V+ K ++Q+  K G + W V+I L+  M++GMD YH+ S   +S+   V SIN T T++ S V      QE  ++L      +L+ + +    LP++I+V+RDGV D QL+   N+E+    P ++  ++      P+++  +V+K++ T L+    +    P+PGTVVD  I    + +F+L++    +G   PT+Y  + +T  L+         P+ +Q++T+ L H+Y+NW GTIRVP P  YAH+LA L G++
Sbjct:  494 ELSFMTGIPEKMKKDFRAMKDLTQQINLSPKQHHGALECLLQRISQNETASNELTRWGLSLHKDVHKIEGRLLP-------MERINLRNTSFVTSEDLNWVKEVTRDASILTIPMHFWALFYPKRAMDQARELVNMLEKIAGPIG-MRISPPAWVE--LKDDRIETYIRTIQSLLGVEGKIQMVVCIIMGTRDDLYGAIKKLCCVQSPVPSQVINVR--TIGQPTRLRSVAQKILLQMNCKLGGELWGVDIPLKQLMVIGMDVYHDPSRGMRSVVGFVASINLTLTKWYSRVVFQMPHQEIVDSLKLCLVGSLKKYYEVNHCLPEKIVVYRDGVSDGQLKTVANYEI----PQLQKCFEAFDNYHPKMVVFVVQKKISTNLYLAAPDHFVTPSPGTVVDHTITSCEWVDFYLLAHHVRQGCGIPTHYICVLNTANLS---------PDHMQRLTFKLCHMYWNWPGTIRVPAPCKYAHKLAFLSGQI 955          
BLAST of SMEDWI-2 vs. UniProt
Match: sp|Q2Q5Y8|PIWI2_SCHMD (Piwi-like protein 2 OS=Schmidtea mediterranea GN=wi-2 PE=2 SV=1)

HSP 1 Score: 1633.62 bits (4229), Expect = 0.000e+0
Identity = 825/837 (98.57%), Postives = 826/837 (98.69%), Query Frame = 1
Query:   22 MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSF-VNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            MEEIPVKVAKLEANGSETRGKMGNRGGLR TFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKE  +E       TLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSF VNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL
Sbjct:    1 MEEIPVKVAKLEANGSETRGKMGNRGGLRGTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEAPEEKDM----TLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 833          
BLAST of SMEDWI-2 vs. UniProt
Match: sp|Q2PC95|PIWIL_DUGJA (Piwi-like protein OS=Dugesia japonica GN=iwi PE=2 SV=1)

HSP 1 Score: 1263.44 bits (3268), Expect = 0.000e+0
Identity = 607/812 (74.75%), Postives = 702/812 (86.45%), Query Frame = 1
Query:   94 RGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            RGGL++ FRIVEP+LQP +  +K GN+G+ V+LQSNFTKFSV +SEK++MYD+ FS++GLSPK+KLQ +VR+C+E  LPG+FC+DGRRLFTS+ W   SDI+EF+ DEKK++LRLVST L +TEEYYQMINVLLNNLQ+++GQE+IGKGYFL  N  KD V +N GPTFFETN+FKVLGGFGTTLQRGT+P G+LTTLLYIERINRVLNDNSV+  YNR++IDQLIGRDI+TKYNNKTYRISEIKEMN++E FEM GRTLSYA+YFKERYNI LT   QPFVLTRVKK  RR+++K+  E    E               TLNI GELCFLCGFSDQEKSN+DLQKNLGCVLKR PRERLDDIP++C+WIK ++ + GM NKW LKIDN PLEIEGRELP CDVISGG +INEK+ DDWKFG+VQF++++  KHEIDVVIVDRND QY NF+NDVE E++ +R DA++G+V  C  NDVER LND  RSGSGCAK+ALVFVPDDRVYAKVKSFT+STGLLTQCVTTRNGTNRNDKRR+VVSSKTVMQIF+KFGYDPWT++IK+RPTMIVGMDT+HNK SKKSI ASVFSINSTF+QYMSF NSPKG+QEFH+TL  NF  AL +FK+ Y ILP RI+V+RDGVGD+QLQFTK FEVDAMKPL+ENIYK NG  VPQIIYVIVKKR+GTKLFNRG+N NPGT+VDKEIVKPNF+EFFLVSQR T+GTA+PTNYNVLEDTR   K G ++ + PNELQ+ITY LTHLYFNWMGTIRVPVPVHYAH+LAEL+GKVHKGS P  INERIRNRLFYL
Sbjct:   18 RGGLQKRFRIVEPDLQPNETKDKIGNVGKVVRLQSNFTKFSVNKSEKYIMYDTTFSKMGLSPKLKLQILVRICKEYNLPGSFCYDGRRLFTSDNWTEGSDIKEFTIDEKKVSLRLVSTFLSDTEEYYQMINVLLNNLQIIMGQEKIGKGYFLGSNSNKDNVVKNIGPTFFETNNFKVLGGFGTTLQRGTRPNGQLTTLLYIERINRVLNDNSVLVTYNRKNIDQLIGRDILTKYNNKTYRISEIKEMNINETFEMVGRTLSYAQYFKERYNINLTTEQQPFVLTRVKKIARRDKRKEHNENEAPEDMDL-----------TLNITGELCFLCGFSDQEKSNIDLQKNLGCVLKRGPRERLDDIPSFCDWIKTNNNSQGMSNKWGLKIDNTPLEIEGRELPHCDVISGGQRINEKIKDDWKFGKVQFNVQKGVKHEIDVVIVDRNDSQYGNFLNDVEYEIKQLRFDAKIGRVLVCSANDVERSLNDVMRSGSGCAKIALVFVPDDRVYAKVKSFTISTGLLTQCVTTRNGTNRNDKRRQVVSSKTVMQIFSKFGYDPWTIDIKMRPTMIVGMDTFHNKGSKKSIHASVFSINSTFSQYMSFANSPKGKQEFHDTLSGNFKAALTEFKRIYKILPVRIMVYRDGVGDSQLQFTKQFEVDAMKPLVENIYKENGCQVPQIIYVIVKKRIGTKLFNRGDNANPGTIVDKEIVKPNFFEFFLVSQRVTRGTASPTNYNVLEDTRYQNKAGIIEAITPNELQRITYTLTHLYFNWMGTIRVPVPVHYAHKLAELIGKVHKGSTPALINERIRNRLFYL 818          
BLAST of SMEDWI-2 vs. UniProt
Match: sp|Q2Q5Y9|PIWI1_SCHMD (Piwi-like protein 1 OS=Schmidtea mediterranea GN=wi-1 PE=2 SV=1)

HSP 1 Score: 902.508 bits (2331), Expect = 0.000e+0
Identity = 440/813 (54.12%), Postives = 589/813 (72.45%), Query Frame = 1
Query:   94 RGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            RGGL+R F I+EP LQP  +T+K G  GR V L+SN+  F++     F MYD V     +  K++L       + N  P  FCFDGRRLFT+ KWH + D +     + ++++RL++T L  +EEYYQMIN++ NN+Q+ +GQE+IG+ +FL  N     +    GP+FF+ ++FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+N+V+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+V+++ ++G + +SY  YFK+RYNI L    QPFV++RVK+ M R ++K + E     +  +           +L+IPGELC+LCGFSD E+SN++LQKNLG VLKREPRERL+DI  +C W     +   M   W + I+ +P+ I GREL P D+ S   KIN K+ DDWKFG ++FD+ +   H   V++VDRN   + NF+ DV++E+  +RI+  +  +++C  N+VE  L D  R       MALVF+PDD+VYAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI++ F+QY+SFVNS KG+ EFHE LGKNF  AL  F+ +++ +P R++++RDGVGD+QL FTK FE DA+  +IE IY+     +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQ+TTKGTA+PTNYNVL DT+   KK   +  M+P+ LQ+ITY+LTHLYFNWMGTIRVPVP HYAHRLAELVGK+H+G  P AIN+RIR RLFYL
Sbjct:   16 RGGLQRRFAIIEPALQPDTVTDKIGKDGRVVSLKSNYANFNIKVEGPFYMYDVVMENKSIRTKLELLLAYANSKNNGQP--FCFDGRRLFTTSKWHSDEDTENLVIKDVEISIRLLTTFLKNSEEYYQMINIVFNNIQIFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMDNFKILGGYSTTITRGTNENGTASTLLYLERINRVLNENNVVSVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDVNDEVQLGDKKISYLNYFKQRYNINLKNDKQPFVISRVKRSMVRPKEKTENEPEGPTETDQ-----------SLSIPGELCYLCGFSDSERSNINLQKNLGTVLKREPRERLNDIRDFCKWTGAGKSKDYM-KSWGMCIEEQPITIRGRELAPVDIFSNEVKINTKIPDDWKFGEIKFDVPKGTAHRFGVLVVDRNPSHFNNFIEDVKREIGRLRINYTMDSISSCRSNEVEDALTDFIRVSK--VHMALVFIPDDKVYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISAKFSQYISFVNSSKGKNEFHENLGKNFLTALTTFQNKFNTMPLRLIIYRDGVGDSQLAFTKKFETDAVMKMIEKIYENQ--TLPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQKTTKGTASPTNYNVLMDTKFTNKKTNEVSVMSPSVLQQITYSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKIHRGVTPPAINDRIRERLFYL 808          
BLAST of SMEDWI-2 vs. UniProt
Match: sp|Q8UVX0|PIWL1_DANRE (Piwi-like protein 1 OS=Danio rerio GN=piwil1 PE=1 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 1.259e-75
Identity = 240/852 (28.17%), Postives = 393/852 (46.13%), Query Frame = 1
Query:   46 AKLEANGSETRGKMGNRGGLRRTFR---IVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKV---KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDI--QEFSHDEK-KMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSV---MKAYNRRSIDQ---------LIGRDIITKYNNKTYRISEIK-EMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKIN-EKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNM--RIDARVG-----KVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRV--YAKVKSF-TMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSS-KKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSN 2484
            A L+ +    + K+G RGG RR F    +    L       KTG  G  ++L++NF +  +L    + +Y      V   P +   +L+  +    E  L  A  FDG  LF   K      +   E  + EK ++T+ L + + P +    Q  N+L   +  +L  ++IG+ Y+ +P+           P     +   +  GF TT+ +      E + +L  +  ++VL   +V   M +  ++  DQ         L+G  I+TKYNNKTYRI +I  +   +  F+ G   +S+  YFK +Y + +T G+Q  +++ VK+     R                           + +P E C+L G +D+ +++ ++ K+L    +  P +R   I    + I  +         W L  +NK L + GR LP   +I GG          DW        +       I  + +D     Y     DV Q L     ++   +G      V     +  E  L    ++ +   +M +V +P +R   Y  VK +  +     +QCV +R  T    +    V++K  +Q+  K G + W+VEI LR  MIVG+D YH+ ++ K+SI A V S+N   +++ S        QE  + L  +   AL+ + K  + LP RI+V+RDGVGD  LQ   ++EV  +   I+ +  G  +  P++  V+VKKR+ ++ F R +    NP PGTV+D E+ +P +Y+FF+VSQ    G   PT+YNV+ D   L          P+ +Q++TY L H+Y+NW G +RVP P  YAH+LA LVG+ +HK  N
Sbjct:   61 AMLQISAGFQQVKIGERGGRRRDFHDSGVHTRQLMEHVKESKTGVSGTAIELRANFMR--LLSRPMWALYQY---HVDYKPPMESRRLRSALLFQHEETLGKAHTFDGAILFLPNKLRNAETVLCSETRNGEKVEITVTLTNELPPSSPVCLQFYNILFRRILRILNMQQIGRHYY-NPD----------DPFNIPQHRLTIWPGFMTTILQY-----ESSIMLCSDVSHKVLRSETVLDFMYSLRQQCGDQRFPEACTKELVGLIILTKYNNKTYRIDDIAWDHTPNNTFKKGDTEISFKNYFKSQYGLDITDGNQVLLVSHVKRLGPSGRPPPGP---------------------AMLVP-EFCYLTGLTDKMRADFNIMKDLASHTRLSPEQREGRINRLISNINRNGDVQNELTTWGLSFENKLLSLNGRVLPSERIIQGGRAFEYNPWTADWSKEMRGLPL-------ISCMSLDNWLMFYTRRNADVAQSLLQTLNKVSGPMGIRMQRAVMIEYEDRQESLLRALQQNVARETQMVVVILPTNRKDKYDCVKKYLCVDCPTPSQCVVSR--TISKPQALMTVATKIALQMNCKMGGELWSVEIPLRQLMIVGIDCYHDTAAGKRSIGAMVASLNQGMSRWFSKCVLQNRGQEIIDALKGSLQGALKAYLKYNNSLPSRIIVYRDGVGDGMLQSVVDYEVPQIMQSIKTM--GQDYE-PKLSVVVVKKRISSRFFARIDGKIANPPPGTVIDTEVTRPEWYDFFIVSQAVRFGCVAPTHYNVVFDNSGL---------KPDHMQRLTYKLCHMYYNWQGIVRVPAPCQYAHKLAFLVGQSIHKEPN 848          
BLAST of SMEDWI-2 vs. UniProt
Match: sp|A6N7Y9|PIWL1_CHICK (Piwi-like protein 1 OS=Gallus gallus GN=PIWIL1 PE=2 SV=1)

HSP 1 Score: 266.159 bits (679), Expect = 2.794e-72
Identity = 231/865 (26.71%), Postives = 395/865 (45.66%), Query Frame = 1
Query:   40 KVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPA--DITE-KTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKV---KLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHG---ESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVM--------KAYNRRSID----QLIGRDIITKYNNKTYRISEIK-EMNVDEKFEMG-GRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGS--KINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPND----VERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNK-SSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGN----NPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGK-VHKGSNPVAINERIRNRLFYL 2529
            K   L+ +       + +RGG RR F  +  N + A   + E KTG+ G  +KL +NF  F +    ++ +Y      V  +P++   +L+  +    E+ +     FDG  LF  ++      E   +  + ++ ++T+ L + + P +    Q  N++   L  M+  ++IG+ Y+ +P   KD       P     +   V  GF +++ +      E + +L  +  +++L   +V+        +   RR  D    +LIG  ++TKYNN+TYR+ +I  + N    F    G  +SY +Y+K +YN  ++  +QP ++++ ++                                 + IP ELC+L G +++ +++ ++ K+L    +  P +R  +I    + +K  +        W L  D+  L   GR +    ++  G+    N +  D  +  RV   I         ++   RN       + ++ +   +M I  R+ K      +D      R L  +    +      L     D+  A  K       + +QCV  R  T    +    + +K  +Q+  K G + W+VEI L+  MIVG+D YH+  S K+SI   V S+N   T++ S        QE  + L      AL ++ K    LP RI+V+RDGVGD QL    N+EV      ++ + K      P++  ++VKKRV T+ F +      NP PGTVVD E+ +P +Y+FF+VSQ    G   PT+YNV+ DT  L          P+ +Q++TY L H+Y+NW G IRVP P  YAH+LA LVG+ +H+  N +     + +RL+YL
Sbjct:   69 KTLGLQISAGFQELSLADRGGRRRDFHDLGVNTRQAIEHVRESKTGSSGAMIKLIANF--FRLTSRPQWALYQY---HVDYNPEMEARRLRSGLLFQHEDLIGKTHAFDGSILFLPKRLPNKVTEVYSKTRNGEDVRITITLTNELPPTSPTCLQFYNIIFRRLLKMMNFQQIGRNYY-NP---KD-------PVSIPNHRLMVWPGFTSSILQY-----EESIMLCADVSHKILRSETVLDFMYSLYEQVEERRFRDACAKELIGVIVLTKYNNRTYRVDDIDWDANPQCTFRRADGSEISYIDYYKRQYNQDISDLNQPVLISQYRRKRGNVTVGP-----------------------VVLIP-ELCYLTGLTEKMRNDFNMMKDLAVHTRLSPEQRQREIGKLVDCMKKDECVQKELRDWGLSFDSSLLSFTGRVVQAEKILQAGNVFDYNPQFADWSRETRVAPLIHAKPLDNWLLIYTRRNYDAANMLLQNLFKVTPSMGI--RMNKATMIEVDDRTEAYLRVLQQSITPDTNIVVCILSSTRKDKYDAIKKYLCTDCPIPSQCVVAR--TLSKPQTALAIVTKIALQMNCKMGGELWSVEIPLKQLMIVGIDCYHDTLSGKQSIAGFVASLNEKMTRWFSRCVVQSRGQEIVDGLKACLQTALREWFKWNKYLPSRIIVYRDGVGDGQLNTLVNYEVPQFLDCLKTVGKDYN---PRLTVIVVKKRVSTRFFAQAGGGLKNPPPGTVVDIEVTRPEWYDFFIVSQAVRNGCVAPTHYNVVYDTSKL---------KPDHVQRLTYKLCHMYYNWSGVIRVPAPCQYAHKLAFLVGQSIHREPNLL-----LSDRLYYL 867          
BLAST of SMEDWI-2 vs. TrEMBL
Match: tr|D2Z0D9|D2Z0D9_DUGJA (DjPiwiB OS=Dugesia japonica GN=DjpiwiB PE=2 SV=1)

HSP 1 Score: 1529.23 bits (3958), Expect = 0.000e+0
Identity = 776/829 (93.61%), Postives = 806/829 (97.23%), Query Frame = 1
Query:   43 VAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            +AKLE NGSE RG+    G LRRTFRIVEPNLQPA+I EKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVF+QVG+ PKVKLQFIVRVCQEN+LPGAFCFDGRRLFTSEKWHGESDIQEF++D+KKMTLRLV+TILPETEEYYQMINVLLNNLQ+M+GQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEM+VDEKFEM GRTLSYAEYFK+RYNIRL+QGDQPFVLTRVKKPMRRER+K  EE  EK+KEKE+EKEAP++KDMTLNIPGELCFLCGFSDQEKSNMDLQK+LG VLKREPRERLDDIPA+CNWIK+SD A GMCNKWQLKI+NKPLEIEGRELPPCDVISG +KINEK+ DDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFM+DVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVS+KTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVN PKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYK NGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKG++P  INERIRNRLFYL
Sbjct:    1 MAKLETNGSENRGRGNRGG-LRRTFRIVEPNLQPAEIIEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFTQVGIPPKVKLQFIVRVCQENRLPGAFCFDGRRLFTSEKWHGESDIQEFTYDDKKMTLRLVATILPETEEYYQMINVLLNNLQIMMGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMSVDEKFEMSGRTLSYAEYFKDRYNIRLSQGDQPFVLTRVKKPMRRERRKPGEEDKEKDKEKEKEKEAPQDKDMTLNIPGELCFLCGFSDQEKSNMDLQKSLGSVLKREPRERLDDIPAFCNWIKSSDNANGMCNKWQLKIENKPLEIEGRELPPCDVISGNNKINEKIPDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMSDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSNKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNQPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKSNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGNSPAVINERIRNRLFYL 828          
BLAST of SMEDWI-2 vs. TrEMBL
Match: tr|G9B7C2|G9B7C2_9PLAT (Piwi B (Fragment) OS=Seidlia auriculata GN=piwiB PE=2 SV=1)

HSP 1 Score: 1120.53 bits (2897), Expect = 0.000e+0
Identity = 519/789 (65.78%), Postives = 642/789 (81.37%), Query Frame = 1
Query:  166 GNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFS-HDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            GNIG+TVKL SNF KF + + E + MYD V S +G++PK KL+ I +V + N L G FCFDGRRLFT EKWH ESDI+EF+  D+KK+T+RL++ +   TEEYYQM+NV+ NN+QV +GQERIG+ YFL  N  K ++ + SGPT+FE N+F+VLGGF TTLQRGT+P G  +TLLYIERINRVLN+NSV+ AY++   D L+GRD+ITKYNNKTYRIS+IKEM+V E+F++ GR LSY +YFKERYNI+L   +QPFVLTR+++ + R++K  +       +     +        TLNIPGELCFLCGFSDQEK N+DLQKNLG +LKREPR+RLDDIPA+C+WI   +       +W L+++N+PLEIEGRELPP DV+SGG K+NE++ DDWKFGRV+F     + +EID+VIVDRNDF Y+ F+ DV+ EL+N+ ++A+V  V  CGPND+E  L    R      KMA+VFVPDD+VYA+VK+FTMSTGLLTQCVTTRNGTNR DKRR+VV+SK+VMQIF+KFGYDPW+VEIKLRPTMIVG+DTYHNK+ KKSIQASV+SINSTFTQY+SFVNSP GRQEFHE LG+NF  AL+ F  +Y+I PQRI+++RDGVGD+Q+ FTK FE DA+KP++E +Y+  GFP+PQIIYV+VKKR+ TK F  G NP PGT+VDKE+VKPNFYEFFLVSQRTTKGTA+PTNYNVLEDT+LLTKKG+M+PMAPNELQKITY LTHLYFNWMGTIRVP P HYAHRLAEL+GK+HKG+NP  IN+RIR+RLFYL
Sbjct:    2 GNIGKTVKLASNFAKFQICQLETYYMYDVVLSDLGVAPKAKLKIISKVQEMNDLKGPFCFDGRRLFTGEKWHNESDIREFAAEDDKKVTIRLITNVTAGTEEYYQMVNVMFNNIQVFMGQERIGRAYFLGANTDKRDIAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGTSSTLLYIERINRVLNENSVVNAYSKGRADTLVGRDVITKYNNKTYRISDIKEMSVGEQFDLSGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTIVRKKKAPEGTEEVPVEPPPEPEPEM-----TLNIPGELCFLCGFSDQEKGNIDLQKNLGGILKREPRQRLDDIPAFCDWIGKCEKVNSFMKEWGLRVENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVRFATSSRKSYEIDIVIVDRNDFNYQKFIQDVKTELKNLNVNAKVTSVEKCGPNDIENILTSIMRQSRDAVKMAMVFVPDDKVYARVKNFTMSTGLLTQCVTTRNGTNRMDKRRQVVASKSVMQIFSKFGYDPWSVEIKLRPTMIVGLDTYHNKTGKKSIQASVYSINSTFTQYLSFVNSPHGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGSMEPMAPNELQKITYTLTHLYFNWMGTIRVPAPTHYAHRLAELIGKIHKGTNPPVINDRIRDRLFYL 785          
BLAST of SMEDWI-2 vs. TrEMBL
Match: tr|G9B7B6|G9B7B6_9PLAT (Piwi B (Fragment) OS=Phagocata kawakatsui GN=piwiB PE=2 SV=1)

HSP 1 Score: 956.822 bits (2472), Expect = 0.000e+0
Identity = 454/692 (65.61%), Postives = 563/692 (81.36%), Query Frame = 1
Query:  478 MINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSK--------KSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            M+NV+ NN+Q+ +GQERIG+ YFL  N  K ++ + SGPT+FE N+F+VLGGF TTLQRGT+P G  +TLLYIERINRVLN+NSV+ AY++   DQL+GRDIITKYNNKTYRIS+IKEM+V E+F++ GR LSY +YFKERYNI+L   +QPFVLTR+++ + R++K +  E  E+  E+   +  PE    TLNIPGELCFLCGFSDQEKSN DLQKNLG +LKREPR+RLDDIP   +WI  ++ A+    +W L+++N+PLEIEGRELPP DV+SGG K+NE++ DDWKFGRV+F I   + HEID+V++DRNDF Y+ F+ DV+ E+RN+ ++A+V  V  CGPND+E  LND  R      KMA+VFV DD+VYA+VK+FT+ TGLLTQCVTTRN TNR DKRR+VV+SK+VMQIF+KFGYDPW VEIKLRPTMIVG+DTYH+K+ K        KSIQASV+SINSTFTQY+SF+NSP+GRQEFHE LG+NF  AL+ F  +Y+I PQRI+++RDGVGD+Q+ FTK FE DA+KP++E +Y+  GFP+PQIIYV+VKKR+ TK F  G NP PGT+VDKE+VKPNFYEFFLVSQRTTKGTA+PTNYNVLEDT+LLTKKG M+PMAPNELQKITY LTHL     GTIRVP P HYAHRLAEL+GK+ KG+NP  IN+RIR+RLFYL
Sbjct:    1 MVNVMFNNIQLFMGQERIGRAYFLGANTDKRDIAKGSGPTYFEVNNFRVLGGFSTTLQRGTRPDGSSSTLLYIERINRVLNENSVVNAYSKGRSDQLVGRDIITKYNNKTYRISDIKEMSVSEQFDLAGRKLSYYDYFKERYNIKLQHSNQPFVLTRMRRTVIRKKKPEKPENPEEAPEEPPAEPEPEM---TLNIPGELCFLCGFSDQEKSNNDLQKNLGGILKREPRQRLDDIP---DWIGKNEKASSFMKEWNLRVENRPLEIEGRELPPVDVVSGGQKMNERIPDDWKFGRVKFAISSRKNHEIDIVVIDRNDFNYQKFIQDVKTEIRNLNVNAKVTSVEKCGPNDIENVLNDIMRRSRDAVKMAMVFVADDKVYARVKNFTLQTGLLTQCVTTRNATNRMDKRRQVVASKSVMQIFSKFGYDPWNVEIKLRPTMIVGLDTYHSKTGKTYHSKTGKKSIQASVYSINSTFTQYLSFINSPRGRQEFHEVLGRNFAAALQQFHSKYEIYPQRIMIYRDGVGDSQMFFTKQFEADALKPIMEKLYQDKGFPIPQIIYVVVKKRISTKFFKNGQNPEPGTIVDKEVVKPNFYEFFLVSQRTTKGTASPTNYNVLEDTKLLTKKGNMEPMAPNELQKITYTLTHL-----GTIRVPAPTHYAHRLAELIGKIRKGTNPAVINDRIRDRLFYL 681          
BLAST of SMEDWI-2 vs. TrEMBL
Match: tr|T1E104|T1E104_9PLAT (PIWI-1 OS=Dendrocoelum lacteum PE=2 SV=1)

HSP 1 Score: 909.827 bits (2350), Expect = 0.000e+0
Identity = 441/820 (53.78%), Postives = 598/820 (72.93%), Query Frame = 1
Query:   70 ETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            E R     RGGL++ F I+EP LQPA+I EK G  G+ V L+SN+  F +     F MYD   S VG S + KL+ +  V    +    +CFDGRRLFT+ +WH  S+IQ F+  E++++LR +++ L  TEEYYQM+N++ NN+Q  +GQERIG+ +FL  N   DEV    GPTFF+ ++FK+LGGF TTL RGT   G  +TLLY+ERINRVLN+NSV   YN+  +D LIGRD+ITKYNNKTYRIS+IKE+++ ++ E+  + +SYA+YFK+RYNI L    QPFV++R+++   + ++  + E    ++  +           +L+IPGELCFLCGFSD E+SN++LQK+LG VLKREPRERL+DI  +C+W K   A + M  KW ++I+++P+ I+GREL   DV S   +IN K  DDWKFG V+FDI +  +H   ++++DRN  Q+  F++D+++E+  +RI+  +  V++C  N++E  L D  R       MA+VF+ DD+VYA+VK+FT+STGLLTQCVT RN TNR+D+RRKVV+ K+VMQ+FAK GYDPW VE+K+ PTM+VG+DT+H+K+ K+SIQASVFSI+  F+QY+SFVNS KG+ E+H+ L +NF  A++ FK +++ LPQR +++RDGVGD+QL FTK +E D +  L+E +Y+     +PQIIY+IVKKR+  K F  GNNPNPGT+VD+ +VKPNFYEF+LVSQRTTKGTATPTNYNVL DT+L    G   P+ P +LQ ITYALTHLYFNWMGTIRVPVP HYAHRLAELVG VH+G+NP  I++RIR RLFYL
Sbjct:    2 EERKPFVKRGGLQKRFYIIEPVLQPAEIVEKVGKEGKIVSLKSNYANFKLKPKGPFCMYDVKMS-VGKSLRGKLEILGAVAALKEPNEPYCFDGRRLFTASEWHN-SEIQSFTVKEEEVSLRFLTSFLENTEEYYQMVNIIFNNVQSFMGQERIGRAFFLGSNC--DEVTSRYGPTFFKKDNFKILGGFSTTLTRGTNNDGTASTLLYLERINRVLNENSVYNIYNKNQLDLLIGRDVITKYNNKTYRISDIKEIDIKDEIELNDKKISYADYFKQRYNITLNHAKQPFVISRMRRIAIQRKENIENEPDAPKEADQ-----------SLSIPGELCFLCGFSDNERSNINLQKSLGSVLKREPRERLNDIADFCHWTKEGKADSFM-KKWGVEIEDQPITIKGRELNGVDVFSNRQRINTKSSDDWKFGEVKFDIPQGAQHRFGILVIDRNANQFNQFIDDMKREMSRLRINNTIEAVSSCRANEIEDALTDFVRVQK--VHMAIVFIGDDKVYARVKNFTISTGLLTQCVTIRNATNRDDRRRKVVADKSVMQMFAKLGYDPWGVELKMVPTMVVGLDTFHSKTGKRSIQASVFSISHKFSQYLSFVNSSKGKNEYHDNLVQNFTSAIKTFKDKFNTLPQRFIIYRDGVGDSQLYFTKKYETDEVLKLMEKLYE--NMRLPQIIYIIVKKRISVKFFKDGNNPNPGTIVDEMVVKPNFYEFYLVSQRTTKGTATPTNYNVLMDTQLTNNAGVKAPIPPGQLQHITYALTHLYFNWMGTIRVPVPTHYAHRLAELVGTVHRGTNPPVISDRIRERLFYL 801          
BLAST of SMEDWI-2 vs. TrEMBL
Match: tr|D2Z0D8|D2Z0D8_DUGJA (DjPiwiA OS=Dugesia japonica GN=DjpiwiA PE=2 SV=1)

HSP 1 Score: 905.59 bits (2339), Expect = 0.000e+0
Identity = 442/813 (54.37%), Postives = 593/813 (72.94%), Query Frame = 1
Query:   94 RGGLRRTFRIVEPNLQPADITEKTGNIGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQENKLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEYYQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFKVLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLIGRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQGDQPFVLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLNIPGELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAATGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQFDIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGPNDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTTRNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHNKSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFKKRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQIIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGTATPTNYNVLEDTRLLTKK-GTMDPMAPNELQKITYALTHLYFNWMGTIRVPVPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL 2529
            RGGL+R F I+EP LQP  I +K G  GR V L+SN+  FS+     F MYD V     +  K++L       + +  P  FCFDGRRLFT+ KW+   D+++F+ +  ++++RL++T L  +EEYYQMIN++ NN+Q+ +GQE+IG+ +FL  N     +    GP+FF+  +FK+LGG+ TT+ RGT   G  +TLLY+ERINRVLN+NSV+  Y R  IDQLIGRDIITKYNNKTYRIS+IKEM+ +++ ++ G  +SY+ YFK+RYNI L    QPFV++R+K+      K+K E   E  KE ++          +L+IPGELC+LCGFSD E+SN++LQK+LG VLKREPRERL+DI  +C W     +   M N W + I+ +P+ I GRELPP D+ S   KIN K+ DDWKFG V+FD+ +   H   V++VDRN   + NF++DV++E+  +RI+  +  +++C  N+VE  L++  R       +ALVF+PDD++YAKVK+FTMSTGLLTQCVT RNG+NR+D+RRK V+ K+VMQ+F+K GYDPW + +K+ PTMIVG+DT+H+K+ K+S+QASVFSI+S F+QY+SFVNS KG+ EFHE LGKNF  A+  F++++  +P R +++RDGVGD+QL FTK FE +A+  +IE IY+     +PQIIYV+VKKR+  K F  G NPNPGTVVD++IVKPNFYEF+LVSQRTTKGTA+PTNYNVL DT+   KK   + PMAP+ LQ+IT++LTHLYFNWMGTIRVPVP HYAHRLAELVGKVH+G+ P  INERIR RLFYL
Sbjct:   16 RGGLQRRFAIIEPALQPETIIDKVGKDGRVVNLKSNYANFSIKVEGPFYMYDVVMEPKSIRSKLELLLAYGKTKGDGQP--FCFDGRRLFTTTKWNRTDDVEKFTVNNVEISIRLLTTFLKNSEEYYQMINIVFNNIQLFMGQEKIGRQFFLGSNCESGGI--REGPSFFKMENFKILGGYSTTITRGTNDDGTASTLLYLERINRVLNENSVLAVYRRDQIDQLIGRDIITKYNNKTYRISDIKEMDFNDEIDLNGSKISYSNYFKQRYNINLKTDKQPFVISRIKRSAAHNPKEKSENEPEGPKEMDQ----------SLSIPGELCYLCGFSDSERSNLNLQKSLGGVLKREPRERLNDIKDFCKWTGGGKSKNFMTN-WNMSIEEQPITIRGRELPPVDIASNDVKINAKIPDDWKFGEVKFDVPKGIAHRFGVLVVDRNPNHFNNFIDDVKREIGRLRINYTIDNISSCRGNEVEEALSEFVRVNK--VHLALVFIPDDKIYAKVKNFTMSTGLLTQCVTQRNGSNRDDRRRKTVADKSVMQMFSKLGYDPWGINLKMAPTMIVGLDTFHSKTGKRSVQASVFSISSKFSQYISFVNSSKGKNEFHENLGKNFLTAITTFQQKFGTMPHRFIIYRDGVGDSQLAFTKKFETEAVMKMIEKIYENQN--LPQIIYVVVKKRISVKFFKDGANPNPGTVVDEKIVKPNFYEFYLVSQRTTKGTASPTNYNVLMDTKYNNKKTNEISPMAPSVLQQITFSLTHLYFNWMGTIRVPVPTHYAHRLAELVGKVHRGATPPTINERIRERLFYL 809          
The following BLAST results are available for this feature:
BLAST of SMEDWI-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
PIWIL15.755e-7125.86piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
PIWIL15.755e-7125.86piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
PIWIL19.813e-6024.97piwi like RNA-mediated gene silencing 1 [Source:HG... [more]
PIWIL47.203e-5424.06piwi like RNA-mediated gene silencing 4 [Source:HG... [more]
PIWIL33.126e-5328.57piwi like RNA-mediated gene silencing 3 [Source:HG... [more]
back to top
BLAST of SMEDWI-2 vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
prg-28.699e-5527.54Piwi-like protein [Source:RefSeq peptide;Acc:NP_5... [more]
prg-12.885e-5126.58Piwi-like protein [Source:RefSeq peptide;Acc:NP_4... [more]
alg-13.105e-2725.19pep:known chromosome:WBcel235:X:13951262:13956256:... [more]
alg-13.490e-2725.19pep:known chromosome:WBcel235:X:13949142:13956256:... [more]
alg-29.056e-2724.61pep:known chromosome:WBcel235:II:874160:878954:1 g... [more]
back to top
BLAST of SMEDWI-2 vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
piwi3.947e-7226.17piwi [Source:FlyBase gene name;Acc:FBgn0004872][more]
piwi3.947e-7226.17piwi [Source:FlyBase gene name;Acc:FBgn0004872][more]
AGO32.063e-6926.23Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250... [more]
AGO32.063e-6926.23Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250... [more]
AGO32.063e-6926.23Argonaute 3 [Source:FlyBase gene name;Acc:FBgn0250... [more]
back to top
BLAST of SMEDWI-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
piwil11.439e-7628.17piwi-like RNA-mediated gene silencing 1 [Source:ZF... [more]
piwil11.439e-7628.17piwi-like RNA-mediated gene silencing 1 [Source:ZF... [more]
piwil23.457e-5322.49piwi-like RNA-mediated gene silencing 2 [Source:ZF... [more]
piwil23.457e-5322.49piwi-like RNA-mediated gene silencing 2 [Source:ZF... [more]
piwil21.051e-4230.90piwi-like RNA-mediated gene silencing 2 [Source:ZF... [more]
back to top
BLAST of SMEDWI-2 vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
piwil21.321e-5825.87piwi-like RNA-mediated gene silencing 2 [Source:Xe... [more]
piwil33.184e-5725.18piwi-like RNA-mediated gene silencing 3 [Source:Xe... [more]
piwil45.017e-5223.21piwi-like RNA-mediated gene silencing 4 [Source:Xe... [more]
ago32.725e-2725.33argonaute RISC catalytic component 3 [Source:Xenba... [more]
ago22.043e-2527.96argonaute RISC catalytic component 2 [Source:Xenba... [more]
back to top
BLAST of SMEDWI-2 vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Piwil11.028e-7025.60piwi-like RNA-mediated gene silencing 1 [Source:MG... [more]
Piwil41.582e-6125.49piwi-like RNA-mediated gene silencing 4 [Source:MG... [more]
Piwil12.434e-5924.43piwi-like RNA-mediated gene silencing 1 [Source:MG... [more]
Piwil41.402e-4332.93piwi-like RNA-mediated gene silencing 4 [Source:MG... [more]
Piwil22.101e-4226.69piwi-like RNA-mediated gene silencing 2 [Source:MG... [more]
back to top
BLAST of SMEDWI-2 vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2Q5Y8|PIWI2_SCHMD0.000e+098.57Piwi-like protein 2 OS=Schmidtea mediterranea GN=w... [more]
sp|Q2PC95|PIWIL_DUGJA0.000e+074.75Piwi-like protein OS=Dugesia japonica GN=iwi PE=2 ... [more]
sp|Q2Q5Y9|PIWI1_SCHMD0.000e+054.12Piwi-like protein 1 OS=Schmidtea mediterranea GN=w... [more]
sp|Q8UVX0|PIWL1_DANRE1.259e-7528.17Piwi-like protein 1 OS=Danio rerio GN=piwil1 PE=1 ... [more]
sp|A6N7Y9|PIWL1_CHICK2.794e-7226.71Piwi-like protein 1 OS=Gallus gallus GN=PIWIL1 PE=... [more]
back to top
BLAST of SMEDWI-2 vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|D2Z0D9|D2Z0D9_DUGJA0.000e+093.61DjPiwiB OS=Dugesia japonica GN=DjpiwiB PE=2 SV=1[more]
tr|G9B7C2|G9B7C2_9PLAT0.000e+065.78Piwi B (Fragment) OS=Seidlia auriculata GN=piwiB P... [more]
tr|G9B7B6|G9B7B6_9PLAT0.000e+065.61Piwi B (Fragment) OS=Phagocata kawakatsui GN=piwiB... [more]
tr|T1E104|T1E104_9PLAT0.000e+053.78PIWI-1 OS=Dendrocoelum lacteum PE=2 SV=1[more]
tr|D2Z0D8|D2Z0D8_DUGJA0.000e+054.37DjPiwiA OS=Dugesia japonica GN=DjpiwiA PE=2 SV=1[more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableCOILSCoilCoilcoord: 841..841
NoneNo IPR availableCOILSCoilCoilcoord: 321..341
NoneNo IPR availableGENE3DG3DSA:2.170.260.10coord: 251..316
e-value: 5.8E-8
score: 32.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 422..589
e-value: 5.4E-15
score: 55.2
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 4..26
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 41..58
NoneNo IPR availableTMHMMTMhelixcoord: 10..29
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 2..21
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
NoneNo IPR availableTMHMMTMhelixcoord: 59..81
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
NoneNo IPR availableTMHMMTMhelixcoord: 20..37
NoneNo IPR availableTMHMMTMhelixcoord: 15..34
NoneNo IPR availableTMHMMTMhelixcoord: 12..29
NoneNo IPR availableTMHMMTMhelixcoord: 7..26
NoneNo IPR availableCOILSCoilCoilcoord: 44..47
NoneNo IPR availableCOILSCoilCoilcoord: 22..29
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
IPR003165Piwi domainSMARTSM00950Piwi_a_2coord: 525..822
e-value: 5.5E-80
score: 281.7
IPR003165Piwi domainPFAMPF02171Piwicoord: 533..821
e-value: 3.4E-64
score: 216.7
IPR003165Piwi domainPROSITEPS50822PIWIcoord: 524..823
score: 34.199
IPR003100PAZ domainSMARTSM00949PAZ_2_a_3coord: 225..382
e-value: 1.3E-16
score: 71.1
IPR003100PAZ domainPFAMPF02170PAZcoord: 246..373
e-value: 6.1E-16
score: 58.3
IPR003100PAZ domainPROSITEPS50821PAZcoord: 259..314
score: 14.836
IPR003100PAZ domainSUPERFAMILYSSF101690PAZ domaincoord: 350..362
coord: 228..318
IPR012337Ribonuclease H-like domainGENE3DG3DSA:3.30.420.10coord: 592..841
e-value: 4.2E-54
score: 182.6
IPR012337Ribonuclease H-like domainSUPERFAMILYSSF53098Ribonuclease H-likecoord: 517..841
coord: 313..457

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR003165Piwi
IPR003100PAZ_dom
IPR012337RNaseH-like_dom
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0031047gene silencing by RNA
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000002Stage 2
PLANA:0000007Stage 7
PLANA:0000003Stage 3
PLANA:0000005Stage 5
PLANA:0000006Stage 6
PLANA:0000008Stage 8
PLANA:0000004Stage 4
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast compartment
PLANA:0004517blastomere
PLANA:0000212blastomere compartment
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014446 ID=SMED30014446|Name=SMEDWI-2|organism=Schmidtea mediterranea sexual|type=transcript|length=4773bp
ATTTAATTTTCGAAAAAAAATATGGAGGAAATACCAGTAAAAGTAGCTAA
ACTTGAAGCGAATGGAAGTGAAACAAGAGGTAAAATGGGAAATCGTGGTG
GCCTGAGAAGAACATTTAGAATTGTTGAACCTAACTTGCAACCTGCTGAT
ATCACTGAAAAAACAGGAAACATAGGAAGAACAGTTAAATTACAATCAAA
TTTTACCAAATTCTCTGTTTTGCGTTCAGAAAAGTTCATGATGTATGATT
CCGTGTTTTCTCAAGTTGGTTTGTCACCCAAAGTAAAATTACAGTTTATT
GTTCGAGTCTGCCAAGAAAATAAATTGCCAGGGGCTTTTTGTTTTGATGG
AAGACGTCTATTTACTAGTGAAAAATGGCATGGAGAATCGGACATTCAAG
AATTTAGTCATGATGAAAAAAAAATGACACTAAGATTGGTATCAACTATC
CTTCCTGAAACTGAAGAATATTACCAAATGATCAATGTATTACTCAATAA
TTTACAAGTAATGTTAGGTCAAGAAAGAATTGGTAAAGGTTATTTTTTAA
GCCCAAATATTACAAAAGATGAAGTTCCCCGTAATTCTGGACCGACATTT
TTTGAAACCAATAGTTTTAAAGTTCTTGGGGGCTTTGGTACAACTTTACA
AAGAGGCACAAAACCAACTGGTGAATTAACCACTCTTTTATATATTGAGC
GTATTAACAGAGTATTAAACGATAACTCTGTTATGAAGGCATACAACAGA
AGAAGTATCGATCAGTTGATAGGCAGAGATATCATAACAAAATATAATAA
CAAAACTTATAGGATAAGTGAAATAAAAGAAATGAACGTAGATGAGAAAT
TTGAAATGGGTGGTAGAACTTTATCGTATGCCGAATATTTTAAGGAACGA
TATAATATTCGATTAACTCAAGGCGATCAACCATTTGTTCTAACGCGAGT
GAAGAAACCAATGCGTCGAGAAAGAAAGAAAAAAGACGAAGAAGGAGTGG
AAAAAGAGAAAGAAAAAGAACGCGAAAAAGAGGCTCCAGAAGAGAAGGAC
ATGACTCTCAATATTCCTGGAGAGTTGTGTTTCTTATGTGGGTTTTCAGA
TCAAGAGAAATCGAATATGGATCTGCAGAAGAATTTAGGGTGCGTTTTAA
AAAGAGAGCCACGTGAAAGATTGGATGATATACCAGCTTATTGTAACTGG
ATTAAAAATAGTGATGCGGCAACTGGAATGTGCAATAAATGGCAGCTGAA
AATAGATAACAAACCATTAGAAATCGAAGGTAGAGAATTACCTCCATGCG
ATGTAATAAGTGGTGGCAGCAAAATTAATGAAAAAATGGGAGATGATTGG
AAATTTGGTCGAGTTCAATTTGATATTAAGCGTGATCGTAAGCATGAAAT
CGATGTGGTCATCGTTGATCGAAATGACTTTCAGTATAAAAATTTTATGA
ATGATGTGGAACAAGAATTAAGAAACATGAGAATTGATGCTCGAGTTGGA
AAGGTTAATACTTGTGGTCCAAATGATGTTGAAAGATGTTTGAATGATGC
CGCTAGAAGTGGAAGTGGGTGTGCTAAAATGGCGCTGGTATTCGTCCCAG
ATGATAGAGTATATGCCAAGGTGAAATCATTTACCATGAGTACTGGTCTT
TTAACCCAATGTGTAACAACACGTAATGGTACTAATAGAAACGATAAACG
AAGAAAGGTGGTTTCAAGTAAAACCGTGATGCAAATATTTGCAAAATTCG
GATATGATCCATGGACAGTTGAAATTAAATTGAGACCAACTATGATTGTC
GGTATGGATACCTATCATAACAAGTCCAGCAAGAAATCAATTCAAGCATC
TGTATTTTCGATCAACAGCACATTTACACAATATATGAGCTTTGTTAATT
CTCCTAAAGGACGTCAGGAATTCCACGAAACTTTAGGCAAAAATTTCAAT
TTAGCGTTAGAAGATTTCAAGAAACGTTATGACATATTGCCCCAGCGAAT
TTTAGTCTTTAGAGATGGTGTTGGAGATAACCAACTTCAATTTACTAAAA
ATTTTGAAGTTGATGCAATGAAACCGCTTATTGAAAATATATACAAAGGC
AACGGATTCCCTGTTCCACAAATCATTTATGTCATCGTAAAGAAAAGAGT
CGGCACTAAGCTTTTCAACAGAGGAAATAATCCAAATCCTGGAACTGTTG
TGGATAAAGAAATTGTCAAACCGAATTTCTATGAATTTTTCCTAGTTTCA
CAAAGAACAACGAAAGGAACTGCAACTCCAACTAATTATAATGTTTTAGA
AGATACTCGATTGCTAACGAAAAAAGGTACTATGGATCCTATGGCACCGA
ATGAGCTGCAAAAGATTACCTATGCTCTAACTCATTTATATTTCAATTGG
ATGGGAACTATCCGAGTTCCGGTTCCAGTGCATTATGCGCATAGATTGGC
TGAATTAGTTGGAAAGGTGCATAAGGGCTCTAATCCCGTTGCCATTAATG
AAAGAATAAGAAATAGGCTCTTCTATTTATAAAAAGATCAAAACTTACAT
TTTTCTGTGTTGATTACTATCCCAATTGTGGATTTAATTGTTTCTGAAAG
CTGTTCATTCAAATTCTTCTGAAATCCATATTGATTCGTAAGCAGCCTGT
ATTTGAATACTAAAATTGATAAAGTAGTTATAAGTATTGTAAAAGTATTA
AATATTTGTTTATGTTATTCGTAATACACTTGGGTTATTGCAATGTTTTA
GTTGTTTTTCAATGATAATAAAGCTTAGCTGTATAAATTCTTTTAGGTTT
TTTAGAAGGTTTATTTATATCGTGTAATTGATTGTCGTGTTAATATTAAT
TAAATAAAAGTTTGATGTAATTGCTTTGTGTTACGCATAATAAATCTTAC
GAAATTTCTGAATACAACTGCTGGTGATCGGGATATTGAATGCCGGGTCG
TTTGAATTAATAATACAAATGCTTTCGATTATTGTCATTAATATTTTCTC
CAGTGCGTAATGGGCCAGAGTTCCGGTGCCATGATTAATGGTTCCTAAAT
TTTAGAAATAACATTTTGAATGACATGTTAAATGTGTATATAATAAATTT
TCTAGTTTTTTTGCTAAGATTTTGAGAAATTTTAGTTACCTGTTTTTGTT
AATTGCTTTGATAATTTCAATGCTGACACGTGCAGAATTTCACACATCTC
CAGCAGTCGACTGAATTCTTGGATTTTGTTTGATACAATTATGCTTGCAG
ATGTTATGGCGCATAGATCCAAGAAGGCTGTGAATCTTGGGTCTTGTTTT
GTAAAGGAAGCTTTGTAAAATATGATGGGACAGTTGCACATAAATTCTAG
GAATCCAGATTTTAGGCAAGATTGAAGTAATGTTGAATGGTTCTATTATA
GAATAATCAGTTGCACTTTTAGATAACCAATATACCACAAAGAGCCATCC
GCAAATTTTGAAAGCCCAAAGCATTGAATCGTTGTCTATGTTACTCAGTA
TAGACAGCAGTAAAATGGCGCTTTTTTGATATTGTAAACCGAAATGATTA
CTAGAATTCATTGTTTCGTCAAGAGATTTCGCGAAACTCTGAATATTATC
TGATTGATTTGATACTATTCCTTGGAGTTTACAAATTGATTTCAGTTCCA
AATTCATACTATTGTGTTCTGCTGATTTGCTACTATTGGAGCTCTATAAG
GAATTATTAGAATCAATTTTGGTTTGATAGTGGGTTTTGCAATCATTGGC
TTATTGTGGGTTGTGTAACCATGGAAGTAATTGTGAATAGTTATAGTGCT
CGCTCTGCATAAAATAATATTTAATCAGTGCTTTAAAGTAGATTTTTAAC
GATTATTATGAAAGATTTCTCTTATATATTAATGTTTTTGTATCCTTCAA
AAGTTTACTAAAAATAATGCACATTTGAAATTTACGCGTTACCATAAAAT
GTCTGAAGTGGTCCAAAGCAATAAAAGCTTAAAAAGAAAGTTCTTGTTTT
TAAATGTATTGGGATATACTCCCACTAACCTTCCGTACTCCGCTGCCTCC
CTTCCCATCACATACAATATTTGCTAGTTCTACTTACAGAGTTGAAAATC
GAAAAATTTTCCCAGTCAATGTCCATGATTATGCTGAATAAATTTTGTCC
GAACATAATAGAGATTGCCTCAGCCAGTATTTCTTTCGTTGTTGAGTTTT
GATGAATGACATGTGAGACTAAATTTATGGACAACCATTGATTTTGGTTT
TGCTGAAGTTGAGACTTCTTACGGTAAAGATAAACACGAAATAATGATAA
ACTCTAATCAAAAGATATTACAAACAAATATTATGATATCAAAACCTTCT
GTCGAACCAAGGCACTTGTGTGAGATAATAAATGAAGAATGAATTCGAAA
AAGAAGTCATAATTCGAACATCGCTCCAGAATGCTGTCACTGACTTTGAC
TTCAATCACATTTTCCAATATTGAAATCAGACCGGCGATCACATGGACCC
TTGATGATTCAGACTGACCACTGATTACGGGTTGATCGGTTAAATTATCT
AGAGATTAAAATAATAGTCGGTAAAGGAAATTATCCATATAAACGGGAAA
CAGAAAAGTTTTAACCATGGTTTCAAAAGCTTTTGGGACTACCCCCAGCT
TTGCAAAACAATTTTTTAACGCTCTTGTTATGACTTGAATCAACATTGTA
CAATTGTTACAATAGACTTGATGATTTACTTATTTACACCCCATCTAAAT
TGTTTCTTAACCCTTTGCCACCC
back to top

protein sequence of SMED30014446-orf-1

>SMED30014446-orf-1 ID=SMED30014446-orf-1|Name=SMED30014446-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=156bp
MNLELKSICKLQGIVSNQSDNIQSFAKSLDETMNSSNHFGLQYQKSAILL
LSILSNIDNDSMLWAFKICGWLFVVYWLSKSATDYSIIEPFNITSILPKI
WIPRIYVQLSHHILQSFLYKTRPKIHSLLGSMRHNICKHNCIKQNPRIQS
TAGDV*
back to top

protein sequence of SMED30014446-orf-2

>SMED30014446-orf-2 ID=SMED30014446-orf-2|Name=SMED30014446-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=837bp
MEEIPVKVAKLEANGSETRGKMGNRGGLRRTFRIVEPNLQPADITEKTGN
IGRTVKLQSNFTKFSVLRSEKFMMYDSVFSQVGLSPKVKLQFIVRVCQEN
KLPGAFCFDGRRLFTSEKWHGESDIQEFSHDEKKMTLRLVSTILPETEEY
YQMINVLLNNLQVMLGQERIGKGYFLSPNITKDEVPRNSGPTFFETNSFK
VLGGFGTTLQRGTKPTGELTTLLYIERINRVLNDNSVMKAYNRRSIDQLI
GRDIITKYNNKTYRISEIKEMNVDEKFEMGGRTLSYAEYFKERYNIRLTQ
GDQPFVLTRVKKPMRRERKKKDEEGVEKEKEKEREKEAPEEKDMTLNIPG
ELCFLCGFSDQEKSNMDLQKNLGCVLKREPRERLDDIPAYCNWIKNSDAA
TGMCNKWQLKIDNKPLEIEGRELPPCDVISGGSKINEKMGDDWKFGRVQF
DIKRDRKHEIDVVIVDRNDFQYKNFMNDVEQELRNMRIDARVGKVNTCGP
NDVERCLNDAARSGSGCAKMALVFVPDDRVYAKVKSFTMSTGLLTQCVTT
RNGTNRNDKRRKVVSSKTVMQIFAKFGYDPWTVEIKLRPTMIVGMDTYHN
KSSKKSIQASVFSINSTFTQYMSFVNSPKGRQEFHETLGKNFNLALEDFK
KRYDILPQRILVFRDGVGDNQLQFTKNFEVDAMKPLIENIYKGNGFPVPQ
IIYVIVKKRVGTKLFNRGNNPNPGTVVDKEIVKPNFYEFFLVSQRTTKGT
ATPTNYNVLEDTRLLTKKGTMDPMAPNELQKITYALTHLYFNWMGTIRVP
VPVHYAHRLAELVGKVHKGSNPVAINERIRNRLFYL*
back to top
Aliases
The feature 'SMEDWI-2' has the following synonyms
Synonym
piwi-2
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014446
GenBankQ2Q5Y8