Zinc finger MYM-type protein 1

Overview
NameZinc finger MYM-type protein 1
Smed IDSMED30014442
Length (bp)1967
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger MYM-type protein 1 (SMED30014442) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger MYM-type protein 1 (SMED30014442) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger MYM-type protein 1 (SMED30014442) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger MYM-type protein 1 (SMED30014442) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 71.633 bits (174), Expect = 8.519e-15
Identity = 36/77 (46.75%), Postives = 48/77 (62.34%), Query Frame = 3
Query:  222 ITNDGLNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTF 452
            + ++GL+L N RG GYD  ANMSG  K  Q+RI + N+ A++  C AH LNLV V +A      +TFF  V+KL  F
Sbjct:  459 LQDNGLDLKNIRGQGYDGAANMSGMYKGLQSRIRAHNEKALYVHCQAHCLNLVLVESAKSSIHFVTFFSLVEKLYVF 535          

HSP 2 Score: 28.8758 bits (63), Expect = 8.519e-15
Identity = 16/42 (38.10%), Postives = 27/42 (64.29%), Query Frame = 2
Query:    5 VGQKVKNEIISRI*EPEYNSILFDCTPDMSCKEQMTETIRNV 130
            +G  ++++I + I E +  SIL D T D+S KEQ++  +R V
Sbjct:  387 LGTFIRSKIQNEIKEAQIFSILLDETTDVSHKEQVSFVVRYV 428          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000043220.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:36411169:36451375:1 gene:ENSXETG00000018966.1 transcript:ENSXETT00000043220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.4774 bits (171), Expect = 5.990e-12
Identity = 35/85 (41.18%), Postives = 53/85 (62.35%), Query Frame = 3
Query:  237 LNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSAFPGRCHKLM 491
            +++ + RG  YDN +NMSG     QARI  +N LA++ PC+AH+LNLV  +AA+     ++FF  +++L  F FSA   R   L+
Sbjct:  308 IDILDCRGQSYDNASNMSGPYSGLQARIKQVNPLAVYIPCSAHSLNLVGTSAAESCREAVSFFCILQQLYHF-FSASSTRWEMLI 391          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: tbx18 (T-box 18 [Source:Xenbase;Acc:XB-GENE-489907])

HSP 1 Score: 54.299 bits (129), Expect = 5.993e-7
Identity = 34/81 (41.98%), Postives = 44/81 (54.32%), Query Frame = 3
Query:  234 GLNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSAFPGR 476
            GLN++   G GYD  + M+GK    QA+I      AIF  CA+H LNLV VN  + +P I    G VK ++ F F   P R
Sbjct:  212 GLNIDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVHCASHKLNLV-VNNLNAVPEIRNAIGSVKAIIKF-FRESPKR 290          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Match: slc10a6 (solute carrier family 10 (sodium/bile acid cotransporter), member 6 [Source:Xenbase;Acc:XB-GENE-988401])

HSP 1 Score: 50.0618 bits (118), Expect = 9.878e-6
Identity = 33/81 (40.74%), Postives = 42/81 (51.85%), Query Frame = 3
Query:  234 GLNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSAFPGR 476
            GLN++   G GYD  + M+GK    QA+I      AIF  CA+H LNLV VN    +P I    G  K ++ F F   P R
Sbjct:  262 GLNMDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVYCASHKLNLV-VNDLKAVPDIRNAIGSGKAIIKF-FRESPKR 340          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: J9KCM8 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 3.152e-31
Identity = 57/116 (49.14%), Postives = 75/116 (64.66%), Query Frame = 3
Query:  186 THEKTRLGFARKITN----DGLNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSAFPGRCHKLMEVLTVSLKGH 521
            +HEKT  G A +I++    DGLN+ +YRG G+DNGANM+      QA I S N LA+F PCAAH+LNL+ V+AA   P  ITF G ++KL T+ FS    R  K+  VL ++LK H
Sbjct:  337 SHEKTGSGLADEISSKLKEDGLNIMDYRGQGFDNGANMAVVHNGVQAHIISKNDLAMFVPCAAHSLNLIGVHAAQTSPTFITFIGVIQKLFTY-FSGSTSRWKKIKNVLKITLKSH 451          

HSP 2 Score: 61.2326 bits (147), Expect = 3.152e-31
Identity = 29/54 (53.70%), Postives = 43/54 (79.63%), Query Frame = 2
Query:    2 LVGQKVKNEIISRI*EPEYNSILFDCTPDMSCKEQMTETIRNVLIKDGQYTIKE 163
            ++GQ+VK EI++R  + +Y SILFDCTPD+S +EQ+TE IR V I +G+ +I+E
Sbjct:  276 IMGQQVKQEILNRTNKSKYFSILFDCTPDVSHQEQLTEIIRYVHIVNGEVSIEE 329          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: J9M5K2 (BTB domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 105.531 bits (262), Expect = 2.060e-30
Identity = 57/119 (47.90%), Postives = 75/119 (63.03%), Query Frame = 3
Query:  180 FETHEKTRLGFA----RKITNDGLNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSAFPGRCHKLMEVLTVSLKGHN 524
             ++ EKT  G A    +K+  DG+ L N R  GYDNGANM+GK    QA I   N+LA F PCAAH+LN + V+AA+  P +I+FFG V+K+  F FS+   R  KL  VL V+LK H+
Sbjct:  620 IQSREKTGTGLASEILKKLEEDGIELKNCRAQGYDNGANMAGKYNGVQAVICRQNELATFIPCAAHSLNRIGVHAAETSPTMISFFGTVQKVFNF-FSSSVSRWEKLTSVLKVTLKSHS 737          

HSP 2 Score: 58.151 bits (139), Expect = 2.060e-30
Identity = 27/54 (50.00%), Postives = 41/54 (75.93%), Query Frame = 2
Query:    2 LVGQKVKNEIISRI*EPEYNSILFDCTPDMSCKEQMTETIRNVLIKDGQYTIKE 163
            L+GQ ++N+II+ I E +Y  I+FDCTPD+S KEQM++ IR V I + + +I+E
Sbjct:  561 LLGQTIRNKIITSIKEAKYYGIMFDCTPDISHKEQMSQIIRYVKIDNTEISIEE 614          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A0J7K9X2 (Zinc finger mym-type protein 1-like protein OS=Lasius niger OX=67767 GN=RF55_13800 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 2.378e-30
Identity = 59/116 (50.86%), Postives = 75/116 (64.66%), Query Frame = 3
Query:  186 THEKTRLGFA----RKITNDGLNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSAFPGRCHKLMEVLTVSLKGH 521
            +HEKT  G A    +K+  DGLN+ N RG GYDNG NMSGK    QA+I  +NK A F PCAAH+LNL  +NAA +   ++TFFG V++L TF FS    R   LM+ + +SLK H
Sbjct:  404 SHEKTGNGLANEILQKLKVDGLNIANIRGQGYDNGTNMSGKYNGVQAKIQQINKYARFVPCAAHSLNLAGINAASVTSDMVTFFGIVQRLFTF-FSGSTIRWEVLMKHINISLKCH 518          

HSP 2 Score: 55.0694 bits (131), Expect = 2.378e-30
Identity = 26/54 (48.15%), Postives = 40/54 (74.07%), Query Frame = 2
Query:    2 LVGQKVKNEIISRI*EPEYNSILFDCTPDMSCKEQMTETIRNVLIKDGQYTIKE 163
            L+G KVK +II  +   +Y SILFDCTPD+S +EQM++ +R V + +G+ +I+E
Sbjct:  343 LMGTKVKTQIIKEVKIAKYFSILFDCTPDVSHQEQMSQILRYVKVFNGKVSIEE 396          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A151JR63 (Zinc finger MYM-type protein 1 (Fragment) OS=Trachymyrmex cornetzi OX=471704 GN=ALC57_00986 PE=4 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.211e-29
Identity = 61/118 (51.69%), Postives = 77/118 (65.25%), Query Frame = 3
Query:  180 FETHEKTRLGFARKITN----DGLNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSAFPGRCHKLMEVLTVSLKGH 521
             ET +KT  G A+ I N    D L++ N R   YDNGANM+GK K  QARI  +NKLA F PC++H+LNLV V+AA + P ++TFFG V+ L  F FS+ P R   LM  +TVSLK H
Sbjct:  287 IETKQKTDEGLAQDILNKLQADNLDIQNCRAQCYDNGANMAGKYKGVQARIIEVNKLAYFIPCSSHSLNLVGVHAASVSPEMMTFFGIVQSLFVF-FSSSPDRWDILMSHVTVSLKKH 403          

HSP 2 Score: 47.3654 bits (111), Expect = 2.211e-29
Identity = 24/43 (55.81%), Postives = 30/43 (69.77%), Query Frame = 2
Query:    2 LVGQKVKNEIISRI*EPEYNSILFDCTPDMSCKEQMTETIRNV 130
            L+  +VK  IIS I + +Y SI FDCTPD + KEQMT+ IR V
Sbjct:  227 LLAHEVKKIIISEIHKAKYFSISFDCTPDTAHKEQMTQIIRYV 269          
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Match: A0A2S2QTP2 (Zinc finger MYM-type protein 1 OS=Sipha flava OX=143950 GN=ZMYM1_1 PE=4 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 5.662e-29
Identity = 51/116 (43.97%), Postives = 77/116 (66.38%), Query Frame = 3
Query:  186 THEKTRLGFARKITN----DGLNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSAFPGRCHKLMEVLTVSLKGH 521
            T EKT  G   +I +    DGL++ + RG G+DNG+NM+G     QA+I+ +N+ A F PCAAH+LNL+ ++A++    ++TFFG V+++ T+ FS   GR  KLM  L ++LKGH
Sbjct:  404 TKEKTGQGLTNEIIDKLKSDGLDIKDCRGQGFDNGSNMAGCYNGVQAKISQINEWARFVPCAAHSLNLIGLHASETSISMVTFFGTVQRMFTY-FSGSTGRWDKLMTALKITLKGH 518          

HSP 2 Score: 58.5362 bits (140), Expect = 5.662e-29
Identity = 29/54 (53.70%), Postives = 41/54 (75.93%), Query Frame = 2
Query:    2 LVGQKVKNEIISRI*EPEYNSILFDCTPDMSCKEQMTETIRNVLIKDGQYTIKE 163
            L+G+KV+  II+ I + +Y SILFDCTPD S KEQM++ IR + IK+G+  I+E
Sbjct:  343 LMGEKVRKNIIADITKTKYFSILFDCTPDTSHKEQMSQIIRYIEIKNGKCFIRE 396          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000036272.1 (pep primary_assembly:Astyanax_mexicanus-2.0:20:11935414:11938921:1 gene:ENSAMXG00000041670.1 transcript:ENSAMXT00000036272.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 3.185e-20
Identity = 48/120 (40.00%), Postives = 65/120 (54.17%), Query Frame = 3
Query:  204 LGFARKITNDGLNLNNY---------------RGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSAFPGRCHKLMEVLTVSLKG 518
            LG+   +   GLNL+N                RG  YDNGANM GK +  QAR+  LN  A F PCAAHT+NLV  +AA      I++FG +++L  F FSA   R   L++ + ++LK 
Sbjct:  369 LGYMNVVETTGLNLSNVVLEKLRALGIPFEDCRGQAYDNGANMKGKRQGVQARLLQLNPRAAFVPCAAHTMNLVISDAAKSSTDAISYFGYLQRLFCF-FSAATQRWDILLKHVKLTLKS 487          

HSP 2 Score: 40.4318 bits (93), Expect = 3.185e-20
Identity = 21/54 (38.89%), Postives = 33/54 (61.11%), Query Frame = 2
Query:    5 VGQKVKNEII------------SRI*EPEYNSILFDCTPDMSCKEQMTETIRNV 130
            +GQ+ +NEII            ++I + +Y +I+ DCTPD+S KEQM+  +R V
Sbjct:  303 LGQQTQNEIIEIICSQTIQTIVAKIKQAKYYAIILDCTPDISHKEQMSLVVRIV 356          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000042715.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:11855083:11857132:-1 gene:ENSAMXG00000035113.1 transcript:ENSAMXT00000042715.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 2.679e-19
Identity = 43/102 (42.16%), Postives = 55/102 (53.92%), Query Frame = 3
Query:  165 ILFKVFETHEKTRLG--FARKITNDGLNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSA 464
            + F+  E H    L       + N GL+L+N RG  YDN +NMSGK    QA +   N L  + PCAAH+LNLV VNA D  P    FF  V+ + TF  S+
Sbjct:  253 LAFEPIENHSGDSLAECVVAMVENLGLDLSNCRGQSYDNASNMSGKYNGIQAHLKQRNPLICYVPCAAHSLNLVGVNAVDSSPEAGRFFDFVQAMYTFCASS 354          

HSP 2 Score: 38.1206 bits (87), Expect = 2.679e-19
Identity = 17/43 (39.53%), Postives = 28/43 (65.12%), Query Frame = 2
Query:    2 LVGQKVKNEIISRI*EPEYNSILFDCTPDMSCKEQMTETIRNV 130
            L+GQ+ K  I++ I E +Y S++ D TPD++  +Q+T   R V
Sbjct:  200 LMGQRTKQAIVNEIKESKYFSVIVDSTPDLAHVDQLTFIFRFV 242          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000033195.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:11277158:11279506:-1 gene:ENSAMXG00000030798.1 transcript:ENSAMXT00000033195.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 2.757e-19
Identity = 59/120 (49.17%), Postives = 70/120 (58.33%), Query Frame = 3
Query:  165 ILFKVFETHEKTRLGFARKI----TNDGLNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSAFPGRCHKLMEVLTVSL 512
            I FK F  H+KT    +  I     ++G+ L   RG GYDNGANMSGK K  QA+I   N LA F PCA HTLNLV V+AA+  P + TFFG V +L   +FSA P R   L E    SL
Sbjct:  326 IEFKDF--HKKTGQEISEMIIEALQSNGIPLQECRGQGYDNGANMSGKVKGVQAQILKANPLATFSPCATHTLNLVGVHAAESCPEVATFFGSVNRLYN-LFSASPERWAILKEKTGCSL 442          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000035531.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6285841:6288423:1 gene:ENSAMXG00000041958.1 transcript:ENSAMXT00000035531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 4.287e-19
Identity = 43/102 (42.16%), Postives = 55/102 (53.92%), Query Frame = 3
Query:  165 ILFKVFETHEKTRLG--FARKITNDGLNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSA 464
            + F+  E H    L       + N GL+L+N RG  YDN +NMSGK    QA +   N L  + PCAAH+LNLV VNA D  P    FF  V+ + TF  S+
Sbjct:  412 LAFEPIENHSGDSLAECVVAMVENLGLDLSNCRGQSYDNASNMSGKYNGVQAHLKQRNSLICYVPCAAHSLNLVGVNAVDSSPEAGRFFDFVQAMFTFCASS 513          

HSP 2 Score: 36.1946 bits (82), Expect = 4.287e-19
Identity = 17/43 (39.53%), Postives = 28/43 (65.12%), Query Frame = 2
Query:    2 LVGQKVKNEIISRI*EPEYNSILFDCTPDMSCKEQMTETIRNV 130
            L+GQ+ K  I+++I E +Y S++ D TPD++  +Q T   R V
Sbjct:  359 LMGQRTKQAIVNKIKESKYFSVIVDSTPDLAHVDQPTFIFRFV 401          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000044961.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:419978:423709:1 gene:ENSAMXG00000036481.1 transcript:ENSAMXT00000044961.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.3958 bits (163), Expect = 3.605e-18
Identity = 33/76 (43.42%), Postives = 49/76 (64.47%), Query Frame = 3
Query:  237 LNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSA 464
            L++++ RG  YDNG+NM G+ +  QARI  LN  A+  PC++HTLNLV  +AA    L  +FFG +++L     S+
Sbjct:  369 LSISDCRGQSYDNGSNMMGQKQGVQARILQLNNKALCIPCSSHTLNLVVADAAKSSVLSTSFFGVLQRLYNLFSSS 444          

HSP 2 Score: 44.669 bits (104), Expect = 3.605e-18
Identity = 20/43 (46.51%), Postives = 29/43 (67.44%), Query Frame = 2
Query:    2 LVGQKVKNEIISRI*EPEYNSILFDCTPDMSCKEQMTETIRNV 130
            L+G KV  EI+ R    +Y S++ DCTPD+S KEQ++  +R V
Sbjct:  288 LIGNKVLEEIVRRAQRAKYYSVIMDCTPDISHKEQLSVVLRLV 330          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000028133.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948955])

HSP 1 Score: 79.337 bits (194), Expect = 2.111e-18
Identity = 50/133 (37.59%), Postives = 69/133 (51.88%), Query Frame = 3
Query:  141 MVNTQSKKILFKVFETHEKTRLGFARKITND----GLNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSAFPGRCHKLMEVLTVSLKGHNK 527
            M   Q ++      E  E T    A  I N     G++  + RG  YDNGANM GK K  QAR+   N  A+F PC AHTLNLV  +AA      +++FG ++KL T +FSA   R   L   ++++LK   +
Sbjct:  391 MEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYT-LFSASAQRWAILKSQVSITLKSWTE 522          

HSP 2 Score: 33.113 bits (74), Expect = 2.111e-18
Identity = 17/43 (39.53%), Postives = 27/43 (62.79%), Query Frame = 2
Query:    2 LVGQKVKNEIISRI*EPEYNSILFDCTPDMSCKEQMTETIRNV 130
            L+  K+ + I+  I + +Y SI+ DCT D+S  EQ++  IR V
Sbjct:  346 LLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVV 388          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000042294.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:110016639])

HSP 1 Score: 79.337 bits (194), Expect = 2.111e-18
Identity = 50/133 (37.59%), Postives = 69/133 (51.88%), Query Frame = 3
Query:  141 MVNTQSKKILFKVFETHEKTRLGFARKITND----GLNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSAFPGRCHKLMEVLTVSLKGHNK 527
            M   Q ++      E  E T    A  I N     G++  + RG  YDNGANM GK K  QAR+   N  A+F PC AHTLNLV  +AA      +++FG ++KL T +FSA   R   L   ++++LK   +
Sbjct:  391 MEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYT-LFSASAQRWAILKSQVSITLKSWTE 522          

HSP 2 Score: 33.113 bits (74), Expect = 2.111e-18
Identity = 17/43 (39.53%), Postives = 27/43 (62.79%), Query Frame = 2
Query:    2 LVGQKVKNEIISRI*EPEYNSILFDCTPDMSCKEQMTETIRNV 130
            L+  K+ + I+  I + +Y SI+ DCT D+S  EQ++  IR V
Sbjct:  346 LLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVV 388          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000045044.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948193])

HSP 1 Score: 79.337 bits (194), Expect = 2.111e-18
Identity = 50/133 (37.59%), Postives = 69/133 (51.88%), Query Frame = 3
Query:  141 MVNTQSKKILFKVFETHEKTRLGFARKITND----GLNLNNYRGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSAFPGRCHKLMEVLTVSLKGHNK 527
            M   Q ++      E  E T    A  I N     G++  + RG  YDNGANM GK K  QAR+   N  A+F PC AHTLNLV  +AA      +++FG ++KL T +FSA   R   L   ++++LK   +
Sbjct:  391 MEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCRGQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYT-LFSASAQRWAILKSQVSITLKSWTE 522          

HSP 2 Score: 33.113 bits (74), Expect = 2.111e-18
Identity = 17/43 (39.53%), Postives = 27/43 (62.79%), Query Frame = 2
Query:    2 LVGQKVKNEIISRI*EPEYNSILFDCTPDMSCKEQMTETIRNV 130
            L+  K+ + I+  I + +Y SI+ DCT D+S  EQ++  IR V
Sbjct:  346 LLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVV 388          
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Match: ENSORLT00000027735.1 (pep primary_assembly:ASM223467v1:9:30712608:30715295:1 gene:ENSORLG00000030268.1 transcript:ENSORLT00000027735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 2.716e-11
Identity = 31/79 (39.24%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  234 GLNLNNY-RGHGYDNGANMSGK*KDFQARINSLNKLAIFFPCAAHTLNLVRVNAADILPLIITFFG*VKKLLTFIFSAF 467
            GL+  N+  G  YD  + MSGK    QARI S   LA +  C AH LNLV V++   +P    FF  ++KL  F+  ++
Sbjct:  371 GLDYKNHLVGQAYDGASVMSGKNTGVQARIKSEAPLAFYVHCNAHCLNLVLVDSVKFIPEANCFFSLLQKLYVFVSGSY 449          

HSP 2 Score: 32.3426 bits (72), Expect = 2.716e-11
Identity = 18/40 (45.00%), Postives = 24/40 (60.00%), Query Frame = 2
Query:    5 VGQKVKNEIISRI*EPEYNSILFDCTPDMSCKEQMTETIR 124
            + + V++ I   + E E  SIL D T DMS KEQM+  IR
Sbjct:  295 LAEMVRSSITGEVAESEAFSILVDETKDMSKKEQMSFVIR 334          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000033476.1 (SMESG000033476.1)

HSP 1 Score: 489.574 bits (1259), Expect = 6.268e-167
Identity = 234/243 (96.30%), Postives = 240/243 (98.77%), Query Frame = 1
Query:  862 KFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYHDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRCLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFRNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSNMEILDPLYGSHFGMYTYKLVIEKPIVASLTVGAVLSEIRSKIYPYVLNAE 1590
            +FHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYHD+LPFMDTENPG FFK+PTK +CPIVTQSDVFR LQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEF+NTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSNMEILDPLYGSHFGMYTYKLVIEKPIVASLTVGAVLSEIRSKIYPYVLNA+
Sbjct:  164 EFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYHDKLPFMDTENPGKFFKKPTKFDCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSNMEILDPLYGSHFGMYTYKLVIEKPIVASLTVGAVLSEIRSKIYPYVLNAD 406          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000033476.1 (SMESG000033476.1)

HSP 1 Score: 489.574 bits (1259), Expect = 9.015e-167
Identity = 234/243 (96.30%), Postives = 240/243 (98.77%), Query Frame = 1
Query:  862 KFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYHDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRCLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFRNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSNMEILDPLYGSHFGMYTYKLVIEKPIVASLTVGAVLSEIRSKIYPYVLNAE 1590
            +FHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYHD+LPFMDTENPG FFK+PTK +CPIVTQSDVFR LQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEF+NTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSNMEILDPLYGSHFGMYTYKLVIEKPIVASLTVGAVLSEIRSKIYPYVLNA+
Sbjct:  177 EFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYHDKLPFMDTENPGKFFKKPTKFDCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSNMEILDPLYGSHFGMYTYKLVIEKPIVASLTVGAVLSEIRSKIYPYVLNAD 419          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000033479.1 (SMESG000033479.1)

HSP 1 Score: 450.669 bits (1158), Expect = 5.925e-152
Identity = 218/243 (89.71%), Postives = 227/243 (93.42%), Query Frame = 1
Query:  862 KFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYHDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRCLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFRNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSNMEILDPLYGSHFGMYTYKLVIEKPIVASLTVGAVLSEIRSKIYPYVLNAE 1590
            +FHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIY DELPFMDTENPGNFFKRPTKLNCPIVTQSDVFR LQFSTHEEIIILSILKGNDNTHNYS+NLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEF+NTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLS MEI D LY SHFG Y+    IEKPI A  T+  V+SEIRS+IYPYVL+A+
Sbjct:  146 EFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSKNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHAD 388          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000033479.1 (SMESG000033479.1)

HSP 1 Score: 451.44 bits (1160), Expect = 3.015e-151
Identity = 218/243 (89.71%), Postives = 227/243 (93.42%), Query Frame = 1
Query:  862 KFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYHDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRCLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFRNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSNMEILDPLYGSHFGMYTYKLVIEKPIVASLTVGAVLSEIRSKIYPYVLNAE 1590
            +FHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIY DELPFMDTENPGNFFKRPTKLNCPIVTQSDVFR LQFSTHEEIIILSILKGNDNTHNYS+NLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEF+NTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLS MEI D LY SHFG Y+    IEKPI A  T+  V+SEIRS+IYPYVL+A+
Sbjct:  146 EFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSKNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHAD 388          
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Match: SMESG000033479.1 (SMESG000033479.1)

HSP 1 Score: 451.055 bits (1159), Expect = 3.815e-151
Identity = 218/243 (89.71%), Postives = 227/243 (93.42%), Query Frame = 1
Query:  862 KFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYHDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRCLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFRNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSNMEILDPLYGSHFGMYTYKLVIEKPIVASLTVGAVLSEIRSKIYPYVLNAE 1590
            +FHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIY DELPFMDTENPGNFFKRPTKLNCPIVTQSDVFR LQFSTHEEIIILSILKGNDNTHNYS+NLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEF+NTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLS MEI D LY SHFG Y+    IEKPI A  T+  V+SEIRS+IYPYVL+A+
Sbjct:  146 EFHRRQSYAIFSNDTDFLVFKDCRVIFPRILRDIYQDELPFMDTENPGNFFKRPTKLNCPIVTQSDVFRPLQFSTHEEIIILSILKGNDNTHNYSKNLLYALGIAESLDRWPHISRVAKYIKSNHVNRNNLFDLDGMSTFLNENPEFKNTVNFCFDFYTLRHFERASGKTLINFDPGSADGSLTSFLQRKLSKMEISDSLYISHFGRYSCVFWIEKPIDAFATITTVMSEIRSRIYPYVLHAD 388          
The following BLAST results are available for this feature:
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CR762475.18.519e-1546.75pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000043220.15.990e-1241.18pep primary_assembly:Xenopus_tropicalis_v9.1:7:364... [more]
tbx185.993e-741.98T-box 18 [Source:Xenbase;Acc:XB-GENE-489907][more]
slc10a69.878e-640.74solute carrier family 10 (sodium/bile acid cotrans... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J9KCM83.152e-3149.14Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
J9M5K22.060e-3047.90BTB domain-containing protein OS=Acyrthosiphon pis... [more]
A0A0J7K9X22.378e-3050.86Zinc finger mym-type protein 1-like protein OS=Las... [more]
A0A151JR632.211e-2951.69Zinc finger MYM-type protein 1 (Fragment) OS=Trach... [more]
A0A2S2QTP25.662e-2943.97Zinc finger MYM-type protein 1 OS=Sipha flava OX=1... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000036272.13.185e-2040.00pep primary_assembly:Astyanax_mexicanus-2.0:20:119... [more]
ENSAMXT00000042715.12.679e-1942.16pep primary_assembly:Astyanax_mexicanus-2.0:16:118... [more]
ENSAMXT00000033195.12.757e-1949.17pep primary_assembly:Astyanax_mexicanus-2.0:16:112... [more]
ENSAMXT00000035531.14.287e-1942.16pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000044961.13.605e-1843.42pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000028133.12.111e-1837.59zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000042294.12.111e-1837.59zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000045044.12.111e-1837.59zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000027735.12.716e-1139.24pep primary_assembly:ASM223467v1:9:30712608:307152... [more]
back to top
BLAST of Zinc finger MYM-type protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033476.16.268e-16796.30SMESG000033476.1[more]
SMESG000033476.19.015e-16796.30SMESG000033476.1[more]
SMESG000033479.15.925e-15289.71SMESG000033479.1[more]
SMESG000033479.13.015e-15189.71SMESG000033479.1[more]
SMESG000033479.13.815e-15189.71SMESG000033479.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014442 ID=SMED30014442|Name=Zinc finger MYM-type protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1967bp
ACTGGTTGGACAAAAGGTAAAAAACGAAATTATTTCAAGAATTTAGGAAC
CCGAATATAATTCCATTCTTTTTGACTGCACGCCTGACATGTCATGTAAA
GAACAGATGACCGAAACAATACGTAATGTTCTAATTAAAGATGGTCAATA
CACAATCAAAGAAAATTTTATTCAAAGTTTTTGAAACTCATGAAAAAACT
CGTCTGGGTTTCGCAAGGAAAATAACAAATGATGGTTTGAACTTGAATAA
TTATAGAGGCCACGGATACGATAATGGTGCAAACATGTCTGGAAAATAAA
AAGACTTTCAAGCCAGAATCAATAGTTTGAATAAGTTAGCAATATTTTTT
CCTTGTGCAGCCCATACACTCAATCTGGTGAGAGTAAATGCAGCCGATAT
TTTACCTCTAATAATTACCTTTTTTGGCTGAGTTAAAAAACTTTTAACTT
TTATCTTTTCAGCCTTTCCGGGAAGATGCCATAAGCTAATGGAAGTACTG
ACCGTTTCCTTGAAAGGACACAATAAATTCAATAATCAAATACAAAATTA
AATATTTTATTCAGAAAATATAAACTTTCGTCATTCAATTTGAATGATAC
CAACTTGTTATCTAGCAACTAAATAATTTACCGATTCAGAGACATCTTTG
ATGTATTACAGAAAGAAATACTCAGTTGGTGGTTTACAGTACTTAGTAAT
TGTTGTACAGTACTTGGTGTATGGTGCACAGTACCTAGTCATTGTTTTAC
AATGCATAGTAAATGGTGTATAATCATTGTTATTCAATGTGTAATCAGTG
GTCTATTCAGTGTGAAGAGGTTATTGGTATTCAACGGTTAATACCAAGCC
TCAGGCGCAGAAAATTTCACCGTCGACAATCCTATGCAATTTTCAGTAAT
GATACTGATTTTCTGGTGTTCAAAGATTGCAGAGTTATATTTCCAAGAAT
TTTAAGAGATATTTATCACGATGAATTACCATTCATGGACACTGAAAACC
CTGGAAACTTTTTCAAAAGACCAACGAAATTAAACTGTCCAATAGTAACG
CAAAGTGATGTATTCAGATGCTTGCAGTTTTCTACTCACGAGGAAATCAT
AATCTTGAGCATCTTAAAGGGCAACGACAATACTCATAATTATTCTCAGA
ATTTATTATACGCGCTTGGCATAGCAGAGTCATTGGACAGATGGCCTCAT
ATAAGCCGTGTCGCAAAATATATCAAATCAAATCACGTTAATCGAAATAA
TCTCTTTGATCTTGATGGAATGAGCACATTTTTGAATGAAAATCCAGAAT
TTAGAAATACTGTTAATTTTTGTTTTGATTTTTATACTTTGAGACACTTT
GAAAGGGCTTCTGGAAAAACTTTAATAAATTTTGACCCAGGTTCTGCCGA
TGGCTCGCTAACAAGCTTCCTACAAAGAAAATTGTCTAACATGGAAATTT
TGGATCCATTATACGGATCGCATTTTGGAATGTACACTTATAAACTTGTG
ATAGAAAAACCTATCGTGGCTTCATTGACAGTAGGTGCAGTATTGAGTGA
GATTCGTTCAAAAATTTATCCGTATGTTTTAAATGCAGAAAAATAAAGTT
ACCGCTCCAACTGGCTCACCGAATCGGTTTTCGTCATATTCAACTAACCA
GCCATTTTTGACCAGCTGCTCGATGACCTTAAGTGCCTGGCCTGCCATGG
GTTTCTTTGGAACTAACTTGGATTATCGATCTGACATTATTACTGGGGCT
TATGTGTTCTAATTCGATGATACCATCCATTCATTGTTGAACTTTGCTTC
GAACTGTCAAACATTTCAATTCTCATTCGAATCTTGTCACACCTACTAGT
GCTATAATGGTGTTCATGTCTAATATGACTACCACAGGTACTACTTATAC
AAATAATACATTAGCAAATGAACTGCACAAAGAATATCGCAACAATAAAA
AATATTTAAAAGTTAAA
back to top

protein sequence of SMED30014442-orf-1

>SMED30014442-orf-1 ID=SMED30014442-orf-1|Name=SMED30014442-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=278bp
MVYNHCYSMCNQWSIQCEEVIGIQRLIPSLRRRKFHRRQSYAIFSNDTDF
LVFKDCRVIFPRILRDIYHDELPFMDTENPGNFFKRPTKLNCPIVTQSDV
FRCLQFSTHEEIIILSILKGNDNTHNYSQNLLYALGIAESLDRWPHISRV
AKYIKSNHVNRNNLFDLDGMSTFLNENPEFRNTVNFCFDFYTLRHFERAS
GKTLINFDPGSADGSLTSFLQRKLSNMEILDPLYGSHFGMYTYKLVIEKP
IVASLTVGAVLSEIRSKIYPYVLNAEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046983protein dimerization activity