Luc7-like protein 3

Overview
NameLuc7-like protein 3
Smed IDSMED30014439
Length (bp)1807
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Luc7-like protein 3 (SMED30014439) t-SNE clustered cells

Violin plots show distribution of expression levels for Luc7-like protein 3 (SMED30014439) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Luc7-like protein 3 (SMED30014439) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Luc7-like protein 3 (SMED30014439) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014439

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014439h1SMcG0011551 SmedASXL_014003SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014439h1SMcG0011551 SmedASXL_014003SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30014439h1SMcG0011551 dd_Smed_v4_5427_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014439h1SMcG0011551 dd_Smed_v4_5427_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30014439h1SMcG0011551 dd_Smed_v4_5427_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014439h1SMcG0011551 dd_Smed_v4_5427_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014439h1SMcG0011551 dd_Smed_v4_5427_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Luc7-like protein 3 vs. Ensembl Human
Match: LUC7L3 (LUC7 like 3 pre-mRNA splicing factor [Source:HGNC Symbol;Acc:HGNC:24309])

HSP 1 Score: 135.576 bits (340), Expect = 2.252e-42
Identity = 73/166 (43.98%), Postives = 105/166 (63.25%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL------NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNF 569
            DELMG++RN   D  +    WD + VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K+G+E D  R L  L+++VERRI +G  RL L      +G +   G +EE   K++ +T+KI+ L+ + E+LG+ GKV E Q ++   E+LK E+  
Sbjct:    9 DELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEE---KIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEEREL 171          

HSP 2 Score: 58.151 bits (139), Expect = 2.252e-42
Identity = 26/61 (42.62%), Postives = 38/61 (62.30%), Query Frame = 2
Query:  590 VKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
             +  ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R R+    RD
Sbjct:  184 AQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRD 244          
BLAST of Luc7-like protein 3 vs. Ensembl Human
Match: LUC7L3 (LUC7 like 3 pre-mRNA splicing factor [Source:HGNC Symbol;Acc:HGNC:24309])

HSP 1 Score: 135.576 bits (340), Expect = 2.252e-42
Identity = 73/166 (43.98%), Postives = 105/166 (63.25%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL------NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNF 569
            DELMG++RN   D  +    WD + VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K+G+E D  R L  L+++VERRI +G  RL L      +G +   G +EE   K++ +T+KI+ L+ + E+LG+ GKV E Q ++   E+LK E+  
Sbjct:    9 DELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEE---KIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEEREL 171          

HSP 2 Score: 58.151 bits (139), Expect = 2.252e-42
Identity = 26/61 (42.62%), Postives = 38/61 (62.30%), Query Frame = 2
Query:  590 VKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
             +  ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R R+    RD
Sbjct:  184 AQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRD 244          
BLAST of Luc7-like protein 3 vs. Ensembl Human
Match: LUC7L3 (LUC7 like 3 pre-mRNA splicing factor [Source:HGNC Symbol;Acc:HGNC:24309])

HSP 1 Score: 135.961 bits (341), Expect = 2.286e-42
Identity = 73/166 (43.98%), Postives = 105/166 (63.25%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL------NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNF 569
            DELMG++RN   D  +    WD + VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K+G+E D  R L  L+++VERRI +G  RL L      +G +   G +EE   K++ +T+KI+ L+ + E+LG+ GKV E Q ++   E+LK E+  
Sbjct:    9 DELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEE---KIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEEREL 171          

HSP 2 Score: 57.7658 bits (138), Expect = 2.286e-42
Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
            ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R R+    RD
Sbjct:  188 QMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRD 244          
BLAST of Luc7-like protein 3 vs. Ensembl Human
Match: LUC7L3 (LUC7 like 3 pre-mRNA splicing factor [Source:HGNC Symbol;Acc:HGNC:24309])

HSP 1 Score: 94.3597 bits (233), Expect = 9.408e-22
Identity = 42/77 (54.55%), Postives = 55/77 (71.43%), Query Frame = 3
Query:  165 VCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLN 395
            VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K+G+E D  R L  L+++VERRI +G  RL L+
Sbjct:   83 VCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALS 159          
BLAST of Luc7-like protein 3 vs. Ensembl Human
Match: LUC7L2 (LUC7 like 2, pre-mRNA splicing factor [Source:HGNC Symbol;Acc:HGNC:21608])

HSP 1 Score: 77.7962 bits (190), Expect = 9.111e-20
Identity = 45/154 (29.22%), Postives = 81/154 (52.60%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELK 554
            D+LMG +R+  +   +   + DD VC   L   CPH +   T+ DLG+C K+H+  L  +Y  +S+ +   FE D    L   ++D +RR    ++RL      ++     + +R + E+  +I +L++K E+LG  G V E Q ++ + E+ +
Sbjct:   12 DQLMGTSRDG-DTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVAKKRLAETQEEISAEVAAKAER-VHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEVEKAR 163          

HSP 2 Score: 40.0466 bits (92), Expect = 9.111e-20
Identity = 17/48 (35.42%), Postives = 30/48 (62.50%), Query Frame = 2
Query:  587 NVKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNM 730
            + +  KL VC VC A+    D  +R+ +H  GK+H+G+ ++RE L+ +
Sbjct:  181 SFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEEL 228          
BLAST of Luc7-like protein 3 vs. Ensembl Celegans
Match: C50D2.8 (pep chromosome:WBcel235:II:96127:98027:-1 gene:WBGene00016811.1 transcript:C50D2.8a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C50D2.8)

HSP 1 Score: 119.783 bits (299), Expect = 4.652e-38
Identity = 65/182 (35.71%), Postives = 105/182 (57.69%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEE-----------VTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNFYQKEIEMLSQQN 605
            DELMG  RN     + +  +DD D+C YFL G CPH +FINTKADLG C+ +H++ L + Y +S  Y ++GFE  L R L QL  D +RRI K +++L         G  +  +RKLEE           + + +  +I  AE+ G+ G V +CQ+I+ ++E ++ E+   ++++  +++ N
Sbjct:   12 DELMGPKRNVELGKDTKVTFDDPDICPYFLVGFCPHDMFINTKADLGACQLVHDDNLRRLYPESPEYGQLGFERRLMRFLVQLDEDNQRRIRKNKDKL--------SGMDDSGKRKLEEEKRQVQLEINSIDDVLKNMIRDAEQAGSEGNVTKCQEIVARSEMVEAEKRGLEEKLSQMNEPN 185          

HSP 2 Score: 58.151 bits (139), Expect = 4.652e-38
Identity = 25/52 (48.08%), Postives = 37/52 (71.15%), Query Frame = 2
Query:  590 VKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTR 745
            +KP  +EVC VCG+  I +DA QR+EEHL+GKMH G+ K+R  ++ +  K +
Sbjct:  198 IKP--MEVCEVCGSMLIVNDAQQRIEEHLTGKMHTGFQKIRTMIQQLKEKLK 247          
BLAST of Luc7-like protein 3 vs. Ensembl Celegans
Match: C50D2.8 (pep chromosome:WBcel235:II:96127:97944:-1 gene:WBGene00016811.1 transcript:C50D2.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C50D2.8)

HSP 1 Score: 119.783 bits (299), Expect = 4.652e-38
Identity = 65/182 (35.71%), Postives = 105/182 (57.69%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEE-----------VTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNFYQKEIEMLSQQN 605
            DELMG  RN     + +  +DD D+C YFL G CPH +FINTKADLG C+ +H++ L + Y +S  Y ++GFE  L R L QL  D +RRI K +++L         G  +  +RKLEE           + + +  +I  AE+ G+ G V +CQ+I+ ++E ++ E+   ++++  +++ N
Sbjct:   12 DELMGPKRNVELGKDTKVTFDDPDICPYFLVGFCPHDMFINTKADLGACQLVHDDNLRRLYPESPEYGQLGFERRLMRFLVQLDEDNQRRIRKNKDKL--------SGMDDSGKRKLEEEKRQVQLEINSIDDVLKNMIRDAEQAGSEGNVTKCQEIVARSEMVEAEKRGLEEKLSQMNEPN 185          

HSP 2 Score: 58.151 bits (139), Expect = 4.652e-38
Identity = 25/52 (48.08%), Postives = 37/52 (71.15%), Query Frame = 2
Query:  590 VKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTR 745
            +KP  +EVC VCG+  I +DA QR+EEHL+GKMH G+ K+R  ++ +  K +
Sbjct:  198 IKP--MEVCEVCGSMLIVNDAQQRIEEHLTGKMHTGFQKIRTMIQQLKEKLK 247          
BLAST of Luc7-like protein 3 vs. Ensembl Celegans
Match: Y119D3B.12 (pep chromosome:WBcel235:III:1202548:1207264:1 gene:WBGene00022489.1 transcript:Y119D3B.12a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y119D3B.12)

HSP 1 Score: 84.7297 bits (208), Expect = 3.852e-27
Identity = 57/180 (31.67%), Postives = 93/180 (51.67%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCE-KIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLN---GPSLNGGFHE---ERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNFYQKEIEMLSQQNLR 611
            +ELMG  R+      +E  +DD +VC  FL G C H +F NTK DLG C+   H+E L  +Y+ S +  +MGFE+     + ++  DV R+I K ++RL +      S    F +   E +++ E++T K+ +L+ +A   G  G V   Q  + + ++ K E     +E E L  +  R
Sbjct:   10 NELMGSQRDANPGERREIRYDDPNVCTDFLVGFCTHDIFRNTKNDLGFCKYTTHDENLKNSYKNSDKKWRMGFEKRFLERIRRIHEDVRRKIQKHEDRLAVTQGESKSAEETFGQKILEIEQRREQLTKKMEDLMDEAALEGEKGNVDAAQTAVDRADKAKVEVEELTQEAEKLKSEKER 189          

HSP 2 Score: 56.6102 bits (135), Expect = 3.852e-27
Identity = 19/44 (43.18%), Postives = 35/44 (79.55%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMS 733
            +++VC +CG F +++DAPQRV++HL+GK+HI Y ++ + +K + 
Sbjct:  203 QMQVCQICGCFMLQNDAPQRVDDHLTGKLHIAYQQISDTIKTIE 246          
BLAST of Luc7-like protein 3 vs. Ensembl Celegans
Match: Y119D3B.12 (pep chromosome:WBcel235:III:1202548:1207346:1 gene:WBGene00022489.1 transcript:Y119D3B.12a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y119D3B.12)

HSP 1 Score: 84.7297 bits (208), Expect = 3.852e-27
Identity = 57/180 (31.67%), Postives = 93/180 (51.67%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCE-KIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLN---GPSLNGGFHE---ERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNFYQKEIEMLSQQNLR 611
            +ELMG  R+      +E  +DD +VC  FL G C H +F NTK DLG C+   H+E L  +Y+ S +  +MGFE+     + ++  DV R+I K ++RL +      S    F +   E +++ E++T K+ +L+ +A   G  G V   Q  + + ++ K E     +E E L  +  R
Sbjct:   10 NELMGSQRDANPGERREIRYDDPNVCTDFLVGFCTHDIFRNTKNDLGFCKYTTHDENLKNSYKNSDKKWRMGFEKRFLERIRRIHEDVRRKIQKHEDRLAVTQGESKSAEETFGQKILEIEQRREQLTKKMEDLMDEAALEGEKGNVDAAQTAVDRADKAKVEVEELTQEAEKLKSEKER 189          

HSP 2 Score: 56.6102 bits (135), Expect = 3.852e-27
Identity = 19/44 (43.18%), Postives = 35/44 (79.55%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMS 733
            +++VC +CG F +++DAPQRV++HL+GK+HI Y ++ + +K + 
Sbjct:  203 QMQVCQICGCFMLQNDAPQRVDDHLTGKLHIAYQQISDTIKTIE 246          
BLAST of Luc7-like protein 3 vs. Ensembl Celegans
Match: Y119D3B.12 (pep chromosome:WBcel235:III:1202548:1207346:1 gene:WBGene00022489.1 transcript:Y119D3B.12a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y119D3B.12)

HSP 1 Score: 84.7297 bits (208), Expect = 3.852e-27
Identity = 57/180 (31.67%), Postives = 93/180 (51.67%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCE-KIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLN---GPSLNGGFHE---ERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNFYQKEIEMLSQQNLR 611
            +ELMG  R+      +E  +DD +VC  FL G C H +F NTK DLG C+   H+E L  +Y+ S +  +MGFE+     + ++  DV R+I K ++RL +      S    F +   E +++ E++T K+ +L+ +A   G  G V   Q  + + ++ K E     +E E L  +  R
Sbjct:   10 NELMGSQRDANPGERREIRYDDPNVCTDFLVGFCTHDIFRNTKNDLGFCKYTTHDENLKNSYKNSDKKWRMGFEKRFLERIRRIHEDVRRKIQKHEDRLAVTQGESKSAEETFGQKILEIEQRREQLTKKMEDLMDEAALEGEKGNVDAAQTAVDRADKAKVEVEELTQEAEKLKSEKER 189          

HSP 2 Score: 56.6102 bits (135), Expect = 3.852e-27
Identity = 19/44 (43.18%), Postives = 35/44 (79.55%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMS 733
            +++VC +CG F +++DAPQRV++HL+GK+HI Y ++ + +K + 
Sbjct:  203 QMQVCQICGCFMLQNDAPQRVDDHLTGKLHIAYQQISDTIKTIE 246          
BLAST of Luc7-like protein 3 vs. Ensembl Fly
Match: CG3198 (gene:FBgn0029887 transcript:FBtr0070991)

HSP 1 Score: 108.997 bits (271), Expect = 3.810e-25
Identity = 59/154 (38.31%), Postives = 97/154 (62.99%), Query Frame = 3
Query:   93 DELMGKNRN-NVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEK---LIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL---NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDIL 533
            DELMG+NRN + ++   + +W+D + C ++    CPH LFINT+ADLG C +IH+E+   L ++ R S R  K  +E++  R  N ++ DV+R+I KG++RL L   + P++        Q +L  +T +IN+L+S+AE+ G  G V + QD++
Sbjct:   10 DELMGRNRNLHPSEAGAKVNWEDPEFCQFYNVKFCPHDLFINTRADLGPCARIHDEEARHLYEDARPSQR--KRQYEDEFLRFCNVMLHDVDRKIQKGKQRLLLMQRDQPNVPAPL-SRHQEQLANLTARINKLLSEAEEAGIRGDVDQAQDLM 160          

HSP 2 Score: 53.1434 bits (126), Expect = 4.584e-7
Identity = 21/37 (56.76%), Postives = 30/37 (81.08%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVR 712
            +++VC +CGAF I  DA QR+E+HL GK H+GY+K+R
Sbjct:  277 QMKVCEICGAFLIVGDAQQRIEDHLMGKQHLGYSKLR 313          
BLAST of Luc7-like protein 3 vs. Ensembl Fly
Match: CG7564 (gene:FBgn0036734 transcript:FBtr0344941)

HSP 1 Score: 75.8702 bits (185), Expect = 1.518e-19
Identity = 41/154 (26.62%), Postives = 79/154 (51.30%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELK 554
            D+LMG  RN      ++  + D  VC  FL   CPH +  +T+ DLG+C K+H+     +Y  +++ +   ++ +    L   ++D +RR    ++RL+     L      E+   +  +  +I + ++KAE LG  G+V +  +++ + EEL+
Sbjct:   19 DQLMGTTRNGDE---RQLKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYESAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEELTAEV-AEKANAVHGLAEEIGKKLAKAEALGEAGEVEDSMELMKEIEELR 168          

HSP 2 Score: 40.0466 bits (92), Expect = 1.518e-19
Identity = 20/56 (35.71%), Postives = 29/56 (51.79%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRR 769
            KL VC VC A+    D   R+ +H  GK+H+G+  +RE L  +      R   L+R
Sbjct:  191 KLRVCEVCSAYLGIHDNDIRLADHFGGKLHLGFLTIREKLIELEKTAAPRKAELKR 246          
BLAST of Luc7-like protein 3 vs. Ensembl Fly
Match: CG7564 (gene:FBgn0036734 transcript:FBtr0345387)

HSP 1 Score: 75.8702 bits (185), Expect = 1.518e-19
Identity = 41/154 (26.62%), Postives = 79/154 (51.30%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELK 554
            D+LMG  RN      ++  + D  VC  FL   CPH +  +T+ DLG+C K+H+     +Y  +++ +   ++ +    L   ++D +RR    ++RL+     L      E+   +  +  +I + ++KAE LG  G+V +  +++ + EEL+
Sbjct:   19 DQLMGTTRNGDE---RQLKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYESAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEELTAEV-AEKANAVHGLAEEIGKKLAKAEALGEAGEVEDSMELMKEIEELR 168          

HSP 2 Score: 40.0466 bits (92), Expect = 1.518e-19
Identity = 20/56 (35.71%), Postives = 29/56 (51.79%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRR 769
            KL VC VC A+    D   R+ +H  GK+H+G+  +RE L  +      R   L+R
Sbjct:  191 KLRVCEVCSAYLGIHDNDIRLADHFGGKLHLGFLTIREKLIELEKTAAPRKAELKR 246          
BLAST of Luc7-like protein 3 vs. Ensembl Fly
Match: CG7564 (gene:FBgn0036734 transcript:FBtr0075175)

HSP 1 Score: 75.8702 bits (185), Expect = 1.518e-19
Identity = 41/154 (26.62%), Postives = 79/154 (51.30%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELK 554
            D+LMG  RN      ++  + D  VC  FL   CPH +  +T+ DLG+C K+H+     +Y  +++ +   ++ +    L   ++D +RR    ++RL+     L      E+   +  +  +I + ++KAE LG  G+V +  +++ + EEL+
Sbjct:   19 DQLMGTTRNGDE---RQLKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYESAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEELTAEV-AEKANAVHGLAEEIGKKLAKAEALGEAGEVEDSMELMKEIEELR 168          

HSP 2 Score: 40.0466 bits (92), Expect = 1.518e-19
Identity = 20/56 (35.71%), Postives = 29/56 (51.79%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRR 769
            KL VC VC A+    D   R+ +H  GK+H+G+  +RE L  +      R   L+R
Sbjct:  191 KLRVCEVCSAYLGIHDNDIRLADHFGGKLHLGFLTIREKLIELEKTAAPRKAELKR 246          
BLAST of Luc7-like protein 3 vs. Ensembl Fly
Match: CG7564 (gene:FBgn0036734 transcript:FBtr0331842)

HSP 1 Score: 75.8702 bits (185), Expect = 1.518e-19
Identity = 41/154 (26.62%), Postives = 79/154 (51.30%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELK 554
            D+LMG  RN      ++  + D  VC  FL   CPH +  +T+ DLG+C K+H+     +Y  +++ +   ++ +    L   ++D +RR    ++RL+     L      E+   +  +  +I + ++KAE LG  G+V +  +++ + EEL+
Sbjct:   19 DQLMGTTRNGDE---RQLKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYESAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEELTAEV-AEKANAVHGLAEEIGKKLAKAEALGEAGEVEDSMELMKEIEELR 168          

HSP 2 Score: 40.0466 bits (92), Expect = 1.518e-19
Identity = 20/56 (35.71%), Postives = 29/56 (51.79%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRR 769
            KL VC VC A+    D   R+ +H  GK+H+G+  +RE L  +      R   L+R
Sbjct:  191 KLRVCEVCSAYLGIHDNDIRLADHFGGKLHLGFLTIREKLIELEKTAAPRKAELKR 246          
BLAST of Luc7-like protein 3 vs. Ensembl Zebrafish
Match: luc7l3 (LUC7-like 3 pre-mRNA splicing factor [Source:ZFIN;Acc:ZDB-GENE-060616-375])

HSP 1 Score: 135.191 bits (339), Expect = 4.513e-42
Identity = 72/161 (44.72%), Postives = 101/161 (62.73%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNK-ETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGF---HEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQ 563
            DELMG++RN   D  +    WDD+ VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K G+E D  R L  L+++VERRI +G  RL L+    N G      + + K + +T KI EL+ + E+LG+ G+V E Q ++   E+LK E+
Sbjct:    9 DELMGRDRNLAPDEKRCNVRWDDESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKLYEKSSRFMKEGYERDFLRYLQSLLAEVERRIRRGHARLALSQAQQNSGTPGPSGKNEEKAQVLTEKIEELVVQIEELGSEGRVEEAQGMMKLVEQLKEER 169          

HSP 2 Score: 56.9954 bits (136), Expect = 4.513e-42
Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRS 754
            ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R RS
Sbjct:  188 QMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKLRRRS 238          
BLAST of Luc7-like protein 3 vs. Ensembl Zebrafish
Match: zgc:158803 (zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15])

HSP 1 Score: 80.4925 bits (197), Expect = 2.203e-21
Identity = 53/180 (29.44%), Postives = 92/180 (51.11%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEEL----KYEQNFYQKEIEMLS--QQNLRF 614
            D+LMG  R+  +   +   + D+ VC   L   CPH +   T+ DLG+C KIH+  L  +Y  +S+ ++  FE D    L   ++D +RR    ++RL      ++     + +R + E+  +I +L+++AE+LG  G V E Q +L + E+     K  ++ Y+  +   S  QQ LR 
Sbjct:   12 DQLMGTGRDG-DTMRQRIKFTDERVCKSHLLESCPHDILSGTRMDLGECVKIHDLALRADYEIASKQQEFFFELDAAEHLQSFIADCDRRTELAKKRLAETQEEISAEVAAKAER-VHELNEEIGKLLARAEQLGGEGNVDEAQQVLEKVEKTRTLKKEAEDIYRNSMPASSFQQQKLRV 189          

HSP 2 Score: 42.3578 bits (98), Expect = 2.203e-21
Identity = 19/60 (31.67%), Postives = 33/60 (55.00%), Query Frame = 2
Query:  587 NVKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLR 766
            + +  KL VC VC A+    D  +R+ +H  GK+HIG+ ++RE L+ +      +   +R
Sbjct:  181 SFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHIGFIEIREKLEKLRKAVTEKQERMR 240          
BLAST of Luc7-like protein 3 vs. Ensembl Zebrafish
Match: luc7l (LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040625-111])

HSP 1 Score: 85.1149 bits (209), Expect = 2.362e-17
Identity = 54/196 (27.55%), Postives = 104/196 (53.06%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNFYQKEIEMLSQQNLRFAVFAERFE*RTMPLKELKNIYL 680
            D+LMG +R+  ++  +   + D+ VC   L   CPH +   T+ DLG+C KIH+  L  +Y  +S+ + + FE D    L   ++D +RR    ++RL      ++     ++  K+ E+  +I +L++KAE+LG  G V E Q++L + E+++  +   ++E         R ++ A  F+ + + + E+ + YL
Sbjct:   12 DQLMGTSRDG-DESRQRVKFTDERVCKSHLLNCCPHDILSGTRMDLGECSKIHDLALRADYEIASKERDLFFELDAVDHLESFIADCDRRTELAKKRLAETQEEISAEV-AQKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQEVLQEVEKVRSRKKDAEEEY--------RNSMPASSFQQQKLRVCEVCSAYL 197          
BLAST of Luc7-like protein 3 vs. Ensembl Zebrafish
Match: luc7l (LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040625-111])

HSP 1 Score: 78.9518 bits (193), Expect = 1.776e-15
Identity = 49/177 (27.68%), Postives = 93/177 (52.54%), Query Frame = 3
Query:  150 WDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNFYQKEIEMLSQQNLRFAVFAERFE*RTMPLKELKNIYL 680
            + D+ VC   L   CPH +   T+ DLG+C KIH+  L  +Y  +S+ + + FE D    L   ++D +RR    ++RL      ++     ++  K+ E+  +I +L++KAE+LG  G V E Q++L + E+++  +   ++E         R ++ A  F+ + + + E+ + YL
Sbjct:   16 FTDERVCKSHLLNCCPHDILSGTRMDLGECSKIHDLALRADYEIASKERDLFFELDAVDHLESFIADCDRRTELAKKRLAETQEEISAEV-AQKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQEVLQEVEKVRSRKKDAEEE--------YRNSMPASSFQQQKLRVCEVCSAYL 183          
BLAST of Luc7-like protein 3 vs. Ensembl Xenopus
Match: luc7l3 (LUC7-like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:549058])

HSP 1 Score: 135.191 bits (339), Expect = 7.471e-42
Identity = 74/166 (44.58%), Postives = 104/166 (62.65%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL------NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNF 569
            DELMG++RN   D  +   HWD + VC Y+L   CP  LF NT++DLG CEKIH+E L + Y KSSRY K G+E+D  R L  L+++VERRI +G  RL L      +G     G +EE   K++ +T+KI+ L+ + E+LG+ GKV E Q ++   E+LK E+  
Sbjct:    9 DELMGRDRNLAPDEKRTNVHWDHESVCKYYLCEFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRYMKCGYEKDFLRYLQSLLAEVERRIRRGHARLALSQSQQASGSVGPAGKNEE---KIQVLTDKIDGLLQQIEELGSEGKVEEAQGMMKLVEQLKEEREL 171          

HSP 2 Score: 56.9954 bits (136), Expect = 7.471e-42
Identity = 25/61 (40.98%), Postives = 39/61 (63.93%), Query Frame = 2
Query:  590 VKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
             +  ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R +S+   R+
Sbjct:  184 AQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKLRKKSSDPDRE 244          
BLAST of Luc7-like protein 3 vs. Ensembl Xenopus
Match: luc7l3 (LUC7-like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:549058])

HSP 1 Score: 134.42 bits (337), Expect = 1.065e-41
Identity = 74/166 (44.58%), Postives = 104/166 (62.65%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL------NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNF 569
            DELMG++RN   D  +   HWD + VC Y+L   CP  LF NT++DLG CEKIH+E L + Y KSSRY K G+E+D  R L  L+++VERRI +G  RL L      +G     G +EE   K++ +T+KI+ L+ + E+LG+ GKV E Q ++   E+LK E+  
Sbjct:    9 DELMGRDRNLAPDEKRTNVHWDHESVCKYYLCEFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRYMKCGYEKDFLRYLQSLLAEVERRIRRGHARLALSQSQQASGSVGPAGKNEE---KIQVLTDKIDGLLQQIEELGSEGKVEEAQGMMKLVEQLKEEREL 171          

HSP 2 Score: 56.9954 bits (136), Expect = 1.065e-41
Identity = 25/61 (40.98%), Postives = 39/61 (63.93%), Query Frame = 2
Query:  590 VKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
             +  ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R +S+   R+
Sbjct:  184 AQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKLRKKSSDPDRE 244          
BLAST of Luc7-like protein 3 vs. Ensembl Xenopus
Match: luc7l3 (LUC7-like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:549058])

HSP 1 Score: 134.42 bits (337), Expect = 1.326e-41
Identity = 74/166 (44.58%), Postives = 104/166 (62.65%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL------NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNF 569
            DELMG++RN   D  +   HWD + VC Y+L   CP  LF NT++DLG CEKIH+E L + Y KSSRY K G+E+D  R L  L+++VERRI +G  RL L      +G     G +EE   K++ +T+KI+ L+ + E+LG+ GKV E Q ++   E+LK E+  
Sbjct:    9 DELMGRDRNLAPDEKRTNVHWDHESVCKYYLCEFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRYMKCGYEKDFLRYLQSLLAEVERRIRRGHARLALSQSQQASGSVGPAGKNEE---KIQVLTDKIDGLLQQIEELGSEGKVEEAQGMMKLVEQLKEEREL 171          

HSP 2 Score: 56.9954 bits (136), Expect = 1.326e-41
Identity = 25/57 (43.86%), Postives = 38/57 (66.67%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
            ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R +S+   R+
Sbjct:  188 QMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKLRKKSSDPDRE 244          
BLAST of Luc7-like protein 3 vs. Ensembl Xenopus
Match: cyp3a4.2 (cytochrome P450 family 3 subfamily A member 4, gene 2 [Source:Xenbase;Acc:XB-GENE-984218])

HSP 1 Score: 83.9593 bits (206), Expect = 2.887e-21
Identity = 49/154 (31.82%), Postives = 83/154 (53.90%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELK 554
            D+LMG  R+  ++  +   + DD VC   L   CPH +   T+ DLG+C KIH+  L  +Y  +S+ + + FE D    L   +++ +RR    ++RL      ++      +  K+ E+  +I +L++KAE+LG  G V E Q IL + E++K
Sbjct:   12 DQLMGTARDG-DETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEV-SAKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQKILMEMEKVK 163          

HSP 2 Score: 38.891 bits (89), Expect = 2.887e-21
Identity = 17/48 (35.42%), Postives = 29/48 (60.42%), Query Frame = 2
Query:  587 NVKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNM 730
            + +  KL VC VC A+    D  +R+ +H  GK+H+G+  +RE L+ +
Sbjct:  181 SFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFILIREKLEML 228          
BLAST of Luc7-like protein 3 vs. Ensembl Xenopus
Match: cyp3a4.2 (cytochrome P450 family 3 subfamily A member 4, gene 2 [Source:Xenbase;Acc:XB-GENE-984218])

HSP 1 Score: 83.9593 bits (206), Expect = 3.060e-21
Identity = 49/154 (31.82%), Postives = 83/154 (53.90%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELK 554
            D+LMG  R+  ++  +   + DD VC   L   CPH +   T+ DLG+C KIH+  L  +Y  +S+ + + FE D    L   +++ +RR    ++RL      ++      +  K+ E+  +I +L++KAE+LG  G V E Q IL + E++K
Sbjct:   12 DQLMGTARDG-DETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEV-SAKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQKILMEMEKVK 163          

HSP 2 Score: 38.891 bits (89), Expect = 3.060e-21
Identity = 17/48 (35.42%), Postives = 29/48 (60.42%), Query Frame = 2
Query:  587 NVKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNM 730
            + +  KL VC VC A+    D  +R+ +H  GK+H+G+  +RE L+ +
Sbjct:  181 SFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFILIREKLEML 228          
BLAST of Luc7-like protein 3 vs. Ensembl Mouse
Match: Luc7l3 (LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914934])

HSP 1 Score: 135.961 bits (341), Expect = 1.426e-42
Identity = 73/166 (43.98%), Postives = 105/166 (63.25%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL------NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNF 569
            DELMG++RN   D  +    WD + VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K+G+E D  R L  L+++VERRI +G  RL L      +G +   G +EE   K++ +T+KI+ L+ + E+LG+ GKV E Q ++   E+LK E+  
Sbjct:    9 DELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEE---KIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEEREL 171          

HSP 2 Score: 58.151 bits (139), Expect = 1.426e-42
Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
            ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R R+    RD
Sbjct:  188 QMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRD 244          
BLAST of Luc7-like protein 3 vs. Ensembl Mouse
Match: Luc7l3 (LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914934])

HSP 1 Score: 135.961 bits (341), Expect = 1.427e-42
Identity = 73/166 (43.98%), Postives = 105/166 (63.25%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL------NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNF 569
            DELMG++RN   D  +    WD + VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K+G+E D  R L  L+++VERRI +G  RL L      +G +   G +EE   K++ +T+KI+ L+ + E+LG+ GKV E Q ++   E+LK E+  
Sbjct:    9 DELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEE---KIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEEREL 171          

HSP 2 Score: 58.151 bits (139), Expect = 1.427e-42
Identity = 26/61 (42.62%), Postives = 38/61 (62.30%), Query Frame = 2
Query:  590 VKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
             +  ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R R+    RD
Sbjct:  184 AQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRD 244          
BLAST of Luc7-like protein 3 vs. Ensembl Mouse
Match: Luc7l3 (LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914934])

HSP 1 Score: 135.191 bits (339), Expect = 2.215e-42
Identity = 73/166 (43.98%), Postives = 105/166 (63.25%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL------NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNF 569
            DELMG++RN   D  +    WD + VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K+G+E D  R L  L+++VERRI +G  RL L      +G +   G +EE   K++ +T+KI+ L+ + E+LG+ GKV E Q ++   E+LK E+  
Sbjct:    9 DELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEE---KIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEEREL 171          

HSP 2 Score: 58.151 bits (139), Expect = 2.215e-42
Identity = 26/61 (42.62%), Postives = 38/61 (62.30%), Query Frame = 2
Query:  590 VKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
             +  ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R R+    RD
Sbjct:  184 AQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRD 244          
BLAST of Luc7-like protein 3 vs. Ensembl Mouse
Match: Luc7l3 (LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914934])

HSP 1 Score: 135.191 bits (339), Expect = 2.215e-42
Identity = 73/166 (43.98%), Postives = 105/166 (63.25%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL------NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNF 569
            DELMG++RN   D  +    WD + VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K+G+E D  R L  L+++VERRI +G  RL L      +G +   G +EE   K++ +T+KI+ L+ + E+LG+ GKV E Q ++   E+LK E+  
Sbjct:    9 DELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEE---KIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEEREL 171          

HSP 2 Score: 58.151 bits (139), Expect = 2.215e-42
Identity = 26/61 (42.62%), Postives = 38/61 (62.30%), Query Frame = 2
Query:  590 VKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
             +  ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R R+    RD
Sbjct:  184 AQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRD 244          
BLAST of Luc7-like protein 3 vs. Ensembl Mouse
Match: Luc7l2 (LUC7-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:2183260])

HSP 1 Score: 77.7962 bits (190), Expect = 6.005e-20
Identity = 45/154 (29.22%), Postives = 81/154 (52.60%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELK 554
            D+LMG +R+  +   +   + DD VC   L   CPH +   T+ DLG+C K+H+  L  +Y  +S+ +   FE D    L   ++D +RR    ++RL      ++     + +R + E+  +I +L++K E+LG  G V E Q ++ + E+ +
Sbjct:   12 DQLMGTSRDG-DTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVSKKRLAETQEEISAEVAAKAER-VHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEVEKAR 163          

HSP 2 Score: 40.0466 bits (92), Expect = 6.005e-20
Identity = 17/48 (35.42%), Postives = 30/48 (62.50%), Query Frame = 2
Query:  587 NVKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNM 730
            + +  KL VC VC A+    D  +R+ +H  GK+H+G+ ++RE L+ +
Sbjct:  181 SFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEEL 228          
BLAST of Luc7-like protein 3 vs. UniProt/SwissProt
Match: sp|Q5R8W6|LC7L3_PONAB (Luc7-like protein 3 OS=Pongo abelii OX=9601 GN=LUC7L3 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 9.871e-42
Identity = 73/166 (43.98%), Postives = 105/166 (63.25%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL------NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNF 569
            DELMG++RN   D  +    WD + VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K+G+E D  R L  L+++VERRI +G  RL L      +G +   G +EE   K++ +T+KI+ L+ + E+LG+ GKV E Q ++   E+LK E+  
Sbjct:    9 DELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEE---KIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEEREL 171          

HSP 2 Score: 58.151 bits (139), Expect = 9.871e-42
Identity = 26/61 (42.62%), Postives = 38/61 (62.30%), Query Frame = 2
Query:  590 VKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
             +  ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R R+    RD
Sbjct:  184 AQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRD 244          
BLAST of Luc7-like protein 3 vs. UniProt/SwissProt
Match: sp|O95232|LC7L3_HUMAN (Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC7L3 PE=1 SV=2)

HSP 1 Score: 135.576 bits (340), Expect = 9.871e-42
Identity = 73/166 (43.98%), Postives = 105/166 (63.25%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL------NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNF 569
            DELMG++RN   D  +    WD + VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K+G+E D  R L  L+++VERRI +G  RL L      +G +   G +EE   K++ +T+KI+ L+ + E+LG+ GKV E Q ++   E+LK E+  
Sbjct:    9 DELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEE---KIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEEREL 171          

HSP 2 Score: 58.151 bits (139), Expect = 9.871e-42
Identity = 26/61 (42.62%), Postives = 38/61 (62.30%), Query Frame = 2
Query:  590 VKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
             +  ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R R+    RD
Sbjct:  184 AQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRD 244          
BLAST of Luc7-like protein 3 vs. UniProt/SwissProt
Match: sp|Q3SX41|LC7L3_BOVIN (Luc7-like protein 3 OS=Bos taurus OX=9913 GN=LUC7L3 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.214e-41
Identity = 73/166 (43.98%), Postives = 105/166 (63.25%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL------NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNF 569
            DELMG++RN   D  +    WD + VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K+G+E D  R L  L+++VERRI +G  RL L      +G +   G +EE   K++ +T+KI+ L+ + E+LG+ GKV E Q ++   E+LK E+  
Sbjct:    9 DELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEE---KIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEEREL 171          

HSP 2 Score: 58.151 bits (139), Expect = 1.214e-41
Identity = 26/61 (42.62%), Postives = 38/61 (62.30%), Query Frame = 2
Query:  590 VKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
             +  ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R R+    RD
Sbjct:  184 AQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRD 244          
BLAST of Luc7-like protein 3 vs. UniProt/SwissProt
Match: sp|Q5SUF2|LC7L3_MOUSE (Luc7-like protein 3 OS=Mus musculus OX=10090 GN=Luc7l3 PE=1 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.340e-41
Identity = 73/166 (43.98%), Postives = 105/166 (63.25%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL------NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNF 569
            DELMG++RN   D  +    WD + VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K+G+E D  R L  L+++VERRI +G  RL L      +G +   G +EE   K++ +T+KI+ L+ + E+LG+ GKV E Q ++   E+LK E+  
Sbjct:    9 DELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEE---KIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEEREL 171          

HSP 2 Score: 58.151 bits (139), Expect = 1.340e-41
Identity = 26/61 (42.62%), Postives = 38/61 (62.30%), Query Frame = 2
Query:  590 VKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
             +  ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R R+    RD
Sbjct:  184 AQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEELKEKLRKRTEEPDRD 244          
BLAST of Luc7-like protein 3 vs. UniProt/SwissProt
Match: sp|Q54XQ8|LUC7L_DICDI (Luc7-like protein OS=Dictyostelium discoideum OX=44689 GN=crop PE=3 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 3.125e-21
Identity = 65/201 (32.34%), Postives = 107/201 (53.23%), Query Frame = 3
Query:   93 DELMGKNRNNV--NDFNKETHWDDDDVCCYFLAGLCPHSLFINTKA-DLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFH----------------------EERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNFYQKEIEMLSQQNLRFAV 620
            DE +GK+RN +  +    E  ++D D+C +FL GLCPH LF N    DLG C K+H+E  ++ Y+ +    K  +E +  R++  L+SD +++I + +ERL L  P+ +   H                      +E+  K+ E+  KI EL+ KAE+LG  G++ E Q ++ + +ELK  Q    ++IE    +N R +V
Sbjct:    9 DEFLGKDRNLLPKDRIKVENDFNDPDICKFFLCGLCPHELFTNANIRDLGPCSKLHDENCVKQYQNNKDKDKYDYEREWVRVIEGLISDNDKKIKRNKERL-LQNPNGDANHHGGPIQQQSISQLDDEEGGLLPDKEQNSKITELDLKIQELLKKAEELGEEGQITEAQALMTEADELK-NQKVELEKIEQEKNENKRMSV 207          
BLAST of Luc7-like protein 3 vs. TrEMBL
Match: A0A430Q813 (Uncharacterized protein OS=Schistosoma bovis OX=6184 GN=DC041_0011509 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 3.256e-54
Identity = 79/163 (48.47%), Postives = 112/163 (68.71%), Query Frame = 3
Query:   93 DELMGKNRNNVN-DFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLR----LNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQN 566
            DELMGKNRN  N + +   HW DDDVC ++L G CPH LF+NTK DLGQC K H+E++ ++Y+KSSR+ KMG+E+D    L QL+ DVE+RI +G ERL     +N P   G    E++ K+  +T +IN+L+ +AE+LG  GKV + Q +L   E+LK+E++
Sbjct:   22 DELMGKNRNACNGESSGGPHWSDDDVCKFYLCGFCPHDLFVNTKTDLGQCPKSHDERMRESYKKSSRFGKMGYEQDFVHYLTQLLEDVEKRIRRGHERLAVNKCVNNPDPIGA--SEKKEKIAALTKRINDLVKQAEELGTEGKVDQAQGVLKLCEQLKFERS 182          

HSP 2 Score: 82.0333 bits (201), Expect = 3.256e-54
Identity = 38/58 (65.52%), Postives = 47/58 (81.03%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSL-RRD 772
            +LEVC +CGAFRIKDDAPQRVEEHLSGKMH+GY K+R++L+  S K  + S+   RRD
Sbjct:  197 ELEVCEICGAFRIKDDAPQRVEEHLSGKMHLGYAKIRDYLRQYSEKHSNSSSRYGRRD 254          
BLAST of Luc7-like protein 3 vs. TrEMBL
Match: A0A183N435 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS23060 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 3.480e-54
Identity = 79/163 (48.47%), Postives = 112/163 (68.71%), Query Frame = 3
Query:   93 DELMGKNRNNVN-DFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLR----LNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQN 566
            DELMGKNRN  N + +   HW DDDVC ++L G CPH LF+NTK DLGQC K H+E++ ++Y+KSSR+ KMG+E+D    L QL+ DVE+RI +G ERL     +N P   G    E++ K+  +T +IN+L+ +AE+LG  GKV + Q +L   E+LK+E++
Sbjct:   11 DELMGKNRNACNGESSGGPHWSDDDVCKFYLCGFCPHDLFVNTKTDLGQCPKSHDERMRESYKKSSRFGKMGYEQDFVHYLTQLLEDVEKRIRRGHERLAVNKCVNNPDPIGA--SEKKEKIAALTKRINDLVKQAEELGTEGKVDQAQGVLKLCEQLKFERS 171          

HSP 2 Score: 82.0333 bits (201), Expect = 3.480e-54
Identity = 38/58 (65.52%), Postives = 47/58 (81.03%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSL-RRD 772
            +LEVC +CGAFRIKDDAPQRVEEHLSGKMH+GY K+R++L+  S K  + S+   RRD
Sbjct:  186 ELEVCEICGAFRIKDDAPQRVEEHLSGKMHLGYAKIRDYLRQYSEKHSNSSSRYGRRD 243          
BLAST of Luc7-like protein 3 vs. TrEMBL
Match: A0A183KDV3 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS13196 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 3.568e-54
Identity = 79/163 (48.47%), Postives = 112/163 (68.71%), Query Frame = 3
Query:   93 DELMGKNRNNVN-DFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLR----LNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQN 566
            DELMGKNRN  N + +   HW DDDVC ++L G CPH LF+NTK DLGQC K H+E++ ++Y+KSSR+ KMG+E+D    L QL+ DVE+RI +G ERL     +N P   G    E++ K+  +T +IN+L+ +AE+LG  GKV + Q +L   E+LK+E++
Sbjct:   11 DELMGKNRNACNGESSGGPHWSDDDVCKFYLCGFCPHDLFVNTKTDLGQCPKSHDERMRESYKKSSRFGKMGYEQDFVHYLTQLLEDVEKRIRRGHERLAVNKCVNNPDPIGA--SEKKEKIAALTKRINDLVKQAEELGTEGKVDQAQGVLKLCEQLKFERS 171          

HSP 2 Score: 82.0333 bits (201), Expect = 3.568e-54
Identity = 38/58 (65.52%), Postives = 47/58 (81.03%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSL-RRD 772
            +LEVC +CGAFRIKDDAPQRVEEHLSGKMH+GY K+R++L+  S K  + S+   RRD
Sbjct:  186 ELEVCEICGAFRIKDDAPQRVEEHLSGKMHLGYAKIRDYLRQYSEKHSNSSSRYGRRD 243          
BLAST of Luc7-like protein 3 vs. TrEMBL
Match: A0A183PFM3 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS13158 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 3.568e-54
Identity = 79/163 (48.47%), Postives = 112/163 (68.71%), Query Frame = 3
Query:   93 DELMGKNRNNVN-DFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLR----LNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQN 566
            DELMGKNRN  N + +   HW DDDVC ++L G CPH LF+NTK DLGQC K H+E++ ++Y+KSSR+ KMG+E+D    L QL+ DVE+RI +G ERL     +N P   G    E++ K+  +T +IN+L+ +AE+LG  GKV + Q +L   E+LK+E++
Sbjct:   11 DELMGKNRNACNGESSGGPHWSDDDVCKFYLCGFCPHDLFVNTKTDLGQCPKSHDERMRESYKKSSRFGKMGYEQDFVHYLTQLLEDVEKRIRRGHERLAVNKCVNNPDPIGA--SEKKEKIAALTKRINDLVKQAEELGTEGKVDQAQGVLKLCEQLKFERS 171          

HSP 2 Score: 82.0333 bits (201), Expect = 3.568e-54
Identity = 38/58 (65.52%), Postives = 47/58 (81.03%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSL-RRD 772
            +LEVC +CGAFRIKDDAPQRVEEHLSGKMH+GY K+R++L+  S K  + S+   RRD
Sbjct:  186 ELEVCEICGAFRIKDDAPQRVEEHLSGKMHLGYAKIRDYLRQYSEKHSNSSSRYGRRD 243          
BLAST of Luc7-like protein 3 vs. TrEMBL
Match: C4Q5Y3 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_031920.5 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 3.627e-54
Identity = 79/163 (48.47%), Postives = 112/163 (68.71%), Query Frame = 3
Query:   93 DELMGKNRNNVN-DFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLR----LNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQN 566
            DELMGKNRN  N + +   HW DDDVC ++L G CPH LF+NTK DLGQC K H+E++ ++Y+KSSR+ KMG+E+D    L QL+ DVE+RI +G ERL     +N P   G    E++ K+  +T +IN+L+ +AE+LG  GKV + Q +L   E+LK+E++
Sbjct:   11 DELMGKNRNACNGESSGGPHWSDDDVCKFYLCGFCPHDLFVNTKTDLGQCPKSHDERMRESYKKSSRFGKMGYEQDFVHYLTQLLEDVEKRIRRGHERLAVNKCVNNPDPIGA--SEKKEKIAALTKRINDLVKQAEELGTEGKVDQAQGVLKLCEQLKFERS 171          

HSP 2 Score: 82.0333 bits (201), Expect = 3.627e-54
Identity = 38/58 (65.52%), Postives = 47/58 (81.03%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSL-RRD 772
            +LEVC +CGAFRIKDDAPQRVEEHLSGKMH+GY K+R++L+  S K  + S+   RRD
Sbjct:  186 ELEVCEICGAFRIKDDAPQRVEEHLSGKMHLGYAKIRDYLRQYSEKHSNSSSRYGRRD 243          
BLAST of Luc7-like protein 3 vs. Ensembl Cavefish
Match: luc7l3 (LUC7 like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:103043258])

HSP 1 Score: 132.109 bits (331), Expect = 9.349e-42
Identity = 73/165 (44.24%), Postives = 101/165 (61.21%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNK-ETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLN-------GPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQ 563
            DELMG++RN   D  +    WD + VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K G+E D  R L  L+++VERRI +G  RL L+       GP  +G   E    K + +T KI EL+ + E+LG+ G+V E Q ++   E+LK E+
Sbjct:    9 DELMGRDRNLAPDEKRCNVRWDHETVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKLYEKSSRFMKEGYERDFLRYLQSLLAEVERRIRRGHARLALSQAQQNSGGPGPSGKNEE----KAQVLTEKIEELVIQIEELGSEGRVEEAQGMMKLVEQLKEER 169          

HSP 2 Score: 58.9214 bits (141), Expect = 9.349e-42
Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
            ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R RS    +D
Sbjct:  188 QMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKLRRRSEDPEKD 244          
BLAST of Luc7-like protein 3 vs. Ensembl Cavefish
Match: luc7l3 (LUC7 like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:103043258])

HSP 1 Score: 132.109 bits (331), Expect = 1.979e-40
Identity = 73/165 (44.24%), Postives = 101/165 (61.21%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNK-ETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLN-------GPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQ 563
            DELMG++RN   D  +    WD + VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR+ K G+E D  R L  L+++VERRI +G  RL L+       GP  +G   E    K + +T KI EL+ + E+LG+ G+V E Q ++   E+LK E+
Sbjct:    9 DELMGRDRNLAPDEKRCNVRWDHETVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKLYEKSSRFMKEGYERDFLRYLQSLLAEVERRIRRGHARLALSQAQQNSGGPGPSGKNEE----KAQVLTEKIEELVIQIEELGSEGRVEEAQGMMKLVEQLKEER 169          

HSP 2 Score: 54.299 bits (129), Expect = 1.979e-40
Identity = 26/57 (45.61%), Postives = 37/57 (64.91%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
            ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R RS    +D
Sbjct:  188 QMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEEL-KKLRRRSEDPEKD 243          
BLAST of Luc7-like protein 3 vs. Ensembl Cavefish
Match: luc7l (LUC7 like [Source:NCBI gene;Acc:103037252])

HSP 1 Score: 83.5741 bits (205), Expect = 6.734e-22
Identity = 48/154 (31.17%), Postives = 83/154 (53.90%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELK 554
            D+LMG  R+  ++  +   + D+ VC   L   CPH +   T+ DLG+C KIH+  L  +Y  +S+ + + FE D    L   ++D +RR    ++RL      ++      +  K+ E+  +I +L++KAE+LG  G V E Q IL + E+++
Sbjct:   12 DQLMGTARDG-DESRQRVKFTDERVCKSHLLNCCPHDILSGTRMDLGECSKIHDLALRADYEIASKERDLFFELDAVDHLESFIADCDRRTELAKKRLAETQEEISAEV-AAKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQKILQEVEKVR 163          

HSP 2 Score: 40.4318 bits (93), Expect = 6.734e-22
Identity = 17/47 (36.17%), Postives = 29/47 (61.70%), Query Frame = 2
Query:  587 NVKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKN 727
            + +  KL VC VC A+    D  +R+ +H  GK+H+G+ ++RE L+ 
Sbjct:  181 SFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLEQ 227          
BLAST of Luc7-like protein 3 vs. Ensembl Cavefish
Match: zgc:158803 (zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15])

HSP 1 Score: 80.1073 bits (196), Expect = 1.383e-21
Identity = 52/180 (28.89%), Postives = 93/180 (51.67%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEEL----KYEQNFYQKEIEMLS--QQNLRF 614
            D+LMG  R++     +   + D+ VC   L   CPH +   T+ DLG+C K+H+  L  +Y  +S++++  FE D    L   ++D +RR    ++RL      ++     + +R + E+  +I +L+++AE+LG  G V E Q +L + E+     K  ++ Y+  +   S  QQ LR 
Sbjct:   12 DQLMGTGRDD--SMRQRIKFTDERVCKSHLLESCPHDILSGTRMDLGECLKVHDLALRADYEIASKHQEYFFELDAAEHLQSFIADCDRRTELAKKRLAETQEEISAEVAAKAER-VHELNEEIGKLLARAEQLGGEGNVDEAQQVLEKVEKTRTLKKEAEDIYRNSMPASSFQQQKLRV 188          

HSP 2 Score: 43.1282 bits (100), Expect = 1.383e-21
Identity = 18/48 (37.50%), Postives = 31/48 (64.58%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTR 745
            KL VC VC A+    D  +R+ +H  GK+H+G+ ++RE L  + +++R
Sbjct:  185 KLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLDKLRSRSR 232          
BLAST of Luc7-like protein 3 vs. Ensembl Cavefish
Match: zgc:158803 (zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15])

HSP 1 Score: 80.8777 bits (198), Expect = 3.285e-21
Identity = 52/180 (28.89%), Postives = 93/180 (51.67%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEEL----KYEQNFYQKEIEMLS--QQNLRF 614
            D+LMG  R+  +   +   + D+ VC   L   CPH +   T+ DLG+C K+H+  L  +Y  +S++++  FE D    L   ++D +RR    ++RL      ++     + +R + E+  +I +L+++AE+LG  G V E Q +L + E+     K  ++ Y+  +   S  QQ LR 
Sbjct:   12 DQLMGTGRDG-DSMRQRIKFTDERVCKSHLLESCPHDILSGTRMDLGECLKVHDLALRADYEIASKHQEYFFELDAAEHLQSFIADCDRRTELAKKRLAETQEEISAEVAAKAER-VHELNEEIGKLLARAEQLGGEGNVDEAQQVLEKVEKTRTLKKEAEDIYRNSMPASSFQQQKLRV 189          

HSP 2 Score: 41.2022 bits (95), Expect = 3.285e-21
Identity = 18/47 (38.30%), Postives = 29/47 (61.70%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKT 742
            KL VC VC A+    D  +R+ +H  GK+H+G+ ++RE L  +  +T
Sbjct:  186 KLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLDKLRVRT 232          
BLAST of Luc7-like protein 3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001648.1 (pep scaffold:Pmarinus_7.0:GL476581:121672:135516:-1 gene:ENSPMAG00000001483.1 transcript:ENSPMAT00000001648.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 136.346 bits (342), Expect = 2.384e-42
Identity = 69/162 (42.59%), Postives = 104/162 (64.20%), Query Frame = 3
Query:   93 DELMGKNRN-NVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRL---NGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQN 566
            DELMG++RN   N+   + HWDD+ VC ++L   CP  LF+NT+ADLG C+KIH+E L + Y KSSR+ +MG+E+D  R L  +++DVERRI +G  RL L    GP   G    +   K++ +T +I EL+   E++G  G+V E Q ++   E++K E++
Sbjct:    9 DELMGRDRNLAPNEKRCDVHWDDERVCKHYLVEYCPAELFVNTRADLGPCDKIHDENLKKLYEKSSRFMRMGYEQDFLRYLQSIMADVERRIRRGHARLALAQTGGPMPGGASMTKNDEKIKVLTERIEELLDDIEQMGCEGRVEEAQGMMKLVEQIKDERD 170          

HSP 2 Score: 54.299 bits (129), Expect = 2.384e-42
Identity = 24/67 (35.82%), Postives = 39/67 (58.21%), Query Frame = 2
Query:  539 NRRTEIRAKFLSKRN*NVKPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNK 739
            + R ++RA   +      +  ++EVC VCGAF I  D   R+++HL GK H+GY K++  ++ M  K
Sbjct:  167 DERDQLRATASTIETFAAQEKQMEVCEVCGAFLIVGDPQSRIDDHLMGKQHMGYAKIKSTIEEMREK 233          
BLAST of Luc7-like protein 3 vs. Ensembl Sea Lamprey
Match: luc7l (LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040625-111])

HSP 1 Score: 77.0258 bits (188), Expect = 1.647e-20
Identity = 45/157 (28.66%), Postives = 77/157 (49.04%), Query Frame = 3
Query:   99 LMGKNRNNVNDFNKETH-----WDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELK 554
            L GKNR   +  +++       + DD VC   L   CPH     T+ DLG C K H+  L  +Y  +S+ K   FE D  + L   ++D +RR    ++RL      ++      +   +  +  +I +L++KAE LG  G V E Q+++ + E+++
Sbjct:    7 LQGKNRKASHSPSRDVSRQRIKFTDDVVCKSHLLDCCPHDTLAGTRMDLGDCPKTHDLALRADYEIASKKKDYFFEVDAMKHLQSFIADCDRRTEVAKKRLAETQEEISAEV-SAKAENVHAINEEIGKLLAKAEALGAAGNVEESQNVMDEVEKVR 162          

HSP 2 Score: 40.4318 bits (93), Expect = 1.647e-20
Identity = 17/43 (39.53%), Postives = 28/43 (65.12%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNM 730
            KL VC VC A+    D  +R+ +H  GK+H+G+ ++RE L+ +
Sbjct:  185 KLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLQEL 227          
BLAST of Luc7-like protein 3 vs. Ensembl Sea Lamprey
Match: luc7l (LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040625-111])

HSP 1 Score: 56.225 bits (134), Expect = 7.211e-9
Identity = 28/79 (35.44%), Postives = 40/79 (50.63%), Query Frame = 3
Query:  150 WDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERL 386
            + DD VC   L   CPH     T+ DLG C K H+  L  +Y  +S+ K   FE D  + L   ++D +RR    ++RL
Sbjct:   10 FTDDVVCKSHLLDCCPHDTLAGTRMDLGDCPKTHDLALRADYEIASKKKDYFFEVDAMKHLQSFIADCDRRTEVAKKRL 88          
BLAST of Luc7-like protein 3 vs. Ensembl Yeast
Match: LUC7 (Essential protein associated with the U1 snRNP complex; splicing factor involved in recognition of 5' splice site; contains two zinc finger motifs; N-terminal zinc finger binds pre-mRNA; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002245])

HSP 1 Score: 46.595 bits (109), Expect = 4.538e-6
Identity = 19/38 (50.00%), Postives = 28/38 (73.68%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVRE 715
            KL+VC VCGA+  + D  +R+ +H  GK+H+GY K+RE
Sbjct:  197 KLQVCEVCGAYLSRLDTDRRLADHFLGKIHLGYVKMRE 234          
BLAST of Luc7-like protein 3 vs. Ensembl Nematostella
Match: EDO31275 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYE8])

HSP 1 Score: 134.806 bits (338), Expect = 3.474e-41
Identity = 71/158 (44.94%), Postives = 100/158 (63.29%), Query Frame = 3
Query:   93 DELMGKNRNNVNDF-NKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQ 563
            DELMG +R+   D   K  HW D +VC +FL G CP  LF+NT++DLG CEK+H+EK+   Y +SSR  +MG+EE+  R L  ++SDVERRI +G +R       L+G  ++    K + +T KIN LI + E+LG  GKV E Q ++   E+LK E+
Sbjct:   11 DELMGSDRDLAPDQKGKRAHWSDSEVCKHFLCGFCPSELFVNTRSDLGPCEKLHDEKMKTAYEQSSRCGRMGYEEEFLRYLQNIMSDVERRIRRGHQR-------LDGAQNKPDNEKEKMLTEKINSLIDQVEQLGCEGKVEEAQGVMKLIEQLKEER 161          

HSP 2 Score: 52.373 bits (124), Expect = 3.474e-41
Identity = 23/43 (53.49%), Postives = 31/43 (72.09%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNM 730
            ++EVC VCGAF I  DA  RV++HL GK H+GY K++  L+ M
Sbjct:  181 QMEVCEVCGAFLIVGDAQTRVDDHLMGKQHMGYAKIKNTLEEM 223          
BLAST of Luc7-like protein 3 vs. Ensembl Nematostella
Match: EDO34740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNI9])

HSP 1 Score: 70.8626 bits (172), Expect = 3.305e-15
Identity = 32/79 (40.51%), Postives = 47/79 (59.49%), Query Frame = 3
Query:  150 WDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERL 386
            +  D VC  +L GLCPH LF NTK DLG C+KIHN  L  ++  +S+ +  G+  D    L   ++D +R+I   ++RL
Sbjct:    3 FTSDRVCKSYLMGLCPHQLFNNTKMDLGSCQKIHNPALKADFEAASKTRDYGYNMDQMEHLQSFINDCDRKIAIAKKRL 81          
BLAST of Luc7-like protein 3 vs. Ensembl Medaka
Match: luc7l3 (LUC7 like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:101172245])

HSP 1 Score: 140.198 bits (352), Expect = 1.220e-43
Identity = 78/187 (41.71%), Postives = 110/187 (58.82%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKE-THWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLN-------GPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQ---NFYQKEIEMLSQQNLRFAV 620
            DELMG++RN   D  +    WDD+ VC Y+L G CP  LF NT++DLG CEKIH+E L + Y KSSR++K G+E D  R L  L+++VERRI +G  RL L+       GP   G   E    K++ +T KI +L+ + E+LG+ G+V E Q ++   E+LK E+   N     IE  + Q  +  V
Sbjct:    9 DELMGRDRNLAPDEKRANVRWDDESVCRYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKTYEKSSRFQKEGYERDFLRYLQSLLAEVERRIRRGHARLALSQAQQNSGGPGPTGKNEE----KIQVLTEKIEDLVVQIEELGSEGRVEEAQGMMKLVEQLKDEREMLNSTPSTIESFAAQEKQMEV 191          

HSP 2 Score: 56.9954 bits (136), Expect = 1.220e-43
Identity = 25/51 (49.02%), Postives = 35/51 (68.63%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRS 754
            ++EVC VCGAF I  DA  RV++HL GK H+GY K++  ++ +  K R RS
Sbjct:  188 QMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKLRRRS 238          
BLAST of Luc7-like protein 3 vs. Ensembl Medaka
Match: ENSORLT00000005146.2 (putative RNA-binding protein Luc7-like 1 [Source:NCBI gene;Acc:101163228])

HSP 1 Score: 80.8777 bits (198), Expect = 1.937e-21
Identity = 53/180 (29.44%), Postives = 92/180 (51.11%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEEL----KYEQNFYQKEIEMLS--QQNLRF 614
            D+LMG  R+  +   +   + D+ VC   L   CPH +   T+ DLG+C K+H+  L  +Y  +S+ ++  FE D    L   ++D +RR    ++RL      ++     + +R + E+  +I +L++KAE+LG  G V E Q +L + E+     K  ++ Y+  +   S  QQ LR 
Sbjct:   12 DQLMGTGRDG-DSMRQRIKFTDERVCKSHLLNSCPHDILSGTRMDLGECAKVHDLALRADYEIASKEQEYFFELDATEHLQSFIADCDRRTELAKKRLAETQDEISAEVAAKAER-VHELNEEIGKLLAKAEQLGGEGNVDEAQQLLEKVEKTRALKKEAEDVYRNSMPASSFQQQKLRV 189          

HSP 2 Score: 41.5874 bits (96), Expect = 1.937e-21
Identity = 18/43 (41.86%), Postives = 28/43 (65.12%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNM 730
            KL VC VC A+    D  +R+ +H  GK+HIG+ ++RE L+ +
Sbjct:  186 KLRVCEVCSAYLGLHDNDRRLADHFGGKLHIGFIEIREKLEKL 228          
BLAST of Luc7-like protein 3 vs. Ensembl Medaka
Match: luc7l (LUC7 like [Source:NCBI gene;Acc:101168406])

HSP 1 Score: 83.1889 bits (204), Expect = 7.990e-17
Identity = 54/196 (27.55%), Postives = 102/196 (52.04%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNFYQKEIEMLSQQNLRFAVFAERFE*RTMPLKELKNIYL 680
            D+LMG  R+  ++  +   + D+ VC   L   CPH +   T+ DLG+C KIH+  L  +Y  +S+ + + FE D    L   ++D +RR    ++RL      ++      +  K+ E+  +I +L++KAE+LG  G V E Q +L + E+++ ++   ++E         R ++ A  F+ + + + E+ + YL
Sbjct:   12 DQLMGTARDG-DETRQRVKFTDERVCKSHLLNCCPHDILSGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAVDHLESFIADCDRRTELAKKRLAETQEEISAEV-AAKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQKVLQEVEKVRTKKKDAEEEY--------RNSMPASSFQQQKLRVCEVCSAYL 197          
BLAST of Luc7-like protein 3 vs. Planmine SMEST
Match: SMESG000063148.1 (SMESG000063148.1)

HSP 1 Score: 306.99 bits (785), Expect = 5.058e-113
Identity = 154/176 (87.50%), Postives = 156/176 (88.64%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNFYQKEIEMLSQQNLRFAV 620
            DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEER+RKLEEVTNKINELISKAEKL                EELKYEQNFYQKEIEMLSQQ+    V
Sbjct:   11 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERKRKLEEVTNKINELISKAEKL----------------EELKYEQNFYQKEIEMLSQQSKELEV 170          

HSP 2 Score: 121.709 bits (304), Expect = 5.058e-113
Identity = 56/60 (93.33%), Postives = 58/60 (96.67%), Query Frame = 2
Query:  593 KPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 772
            +  +LEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD
Sbjct:  164 QSKELEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRRD 223          
BLAST of Luc7-like protein 3 vs. Planmine SMEST
Match: SMESG000063148.1 (SMESG000063148.1)

HSP 1 Score: 309.686 bits (792), Expect = 5.094e-113
Identity = 154/176 (87.50%), Postives = 156/176 (88.64%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNFYQKEIEMLSQQNLRFAV 620
            DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEER+RKLEEVTNKINELISKAEKL                EELKYEQNFYQKEIEMLSQQ+    V
Sbjct:   11 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERKRKLEEVTNKINELISKAEKL----------------EELKYEQNFYQKEIEMLSQQSKELEV 170          

HSP 2 Score: 119.013 bits (297), Expect = 5.094e-113
Identity = 55/59 (93.22%), Postives = 57/59 (96.61%), Query Frame = 2
Query:  593 KPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRR 769
            +  +LEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRR
Sbjct:  164 QSKELEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRR 222          
BLAST of Luc7-like protein 3 vs. Planmine SMEST
Match: SMESG000063148.1 (SMESG000063148.1)

HSP 1 Score: 305.449 bits (781), Expect = 6.108e-101
Identity = 154/176 (87.50%), Postives = 156/176 (88.64%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNFYQKEIEMLSQQNLRFAV 620
            DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEER+RKLEEVTNKINELISKAEKL                EELKYEQNFYQKEIEMLSQQ+    V
Sbjct:   11 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERKRKLEEVTNKINELISKAEKL----------------EELKYEQNFYQKEIEMLSQQSKELEV 170          

HSP 2 Score: 78.5666 bits (192), Expect = 2.239e-16
Identity = 34/39 (87.18%), Postives = 37/39 (94.87%), Query Frame = 2
Query:  593 KPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKV 709
            +  +LEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTK+
Sbjct:  164 QSKELEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKI 202          
BLAST of Luc7-like protein 3 vs. Planmine SMEST
Match: SMESG000063148.1 (SMESG000063148.1)

HSP 1 Score: 161.384 bits (407), Expect = 7.853e-69
Identity = 85/107 (79.44%), Postives = 87/107 (81.31%), Query Frame = 3
Query:  300 MGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNFYQKEIEMLSQQNLRFAV 620
            MGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEER+RKLEEVTNKINELISKAEKL                EELKYEQNFYQKEIEMLSQQ+    V
Sbjct:    1 MGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERKRKLEEVTNKINELISKAEKL----------------EELKYEQNFYQKEIEMLSQQSKELEV 91          

HSP 2 Score: 119.783 bits (299), Expect = 7.853e-69
Identity = 55/59 (93.22%), Postives = 57/59 (96.61%), Query Frame = 2
Query:  593 KPAKLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRR 769
            +  +LEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRR
Sbjct:   85 QSKELEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTRHRSTSLRR 143          
BLAST of Luc7-like protein 3 vs. Planmine SMEST
Match: SMESG000041410.1 (SMESG000041410.1)

HSP 1 Score: 171.785 bits (434), Expect = 1.079e-52
Identity = 84/168 (50.00%), Postives = 120/168 (71.43%), Query Frame = 3
Query:   93 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKVIECQDILHQTEELKYEQNFYQKEIEMLS 596
            DELMG+NRN+      + HWD D++C  +LAG CP+ LFINTKAD+G CE IH++KL   YRKSS +KK+ +E DL R L ++V D +RRI   + RL+ NG ++ GG   ER+R++EE+T KI++LI   EKLGN GK++ECQ  + + EEL+ E+ F++ +IE+ S
Sbjct:   11 DELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVIGGIIIERRRQIEELTIKIDKLIEDIEKLGNEGKIMECQLKMTECEELQREKKFFENDIELHS 178          

HSP 2 Score: 55.4546 bits (132), Expect = 1.079e-52
Identity = 24/48 (50.00%), Postives = 34/48 (70.83%), Query Frame = 2
Query:  602 KLEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNMSNKTR 745
            ++EVC +CGA ++K+D   RV+EH +G+MH GY  VREFL+ M    R
Sbjct:  183 EMEVCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEMIKSDR 230          
The following BLAST results are available for this feature:
BLAST of Luc7-like protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LUC7L32.252e-4243.98LUC7 like 3 pre-mRNA splicing factor [Source:HGNC ... [more]
LUC7L32.252e-4243.98LUC7 like 3 pre-mRNA splicing factor [Source:HGNC ... [more]
LUC7L32.286e-4243.98LUC7 like 3 pre-mRNA splicing factor [Source:HGNC ... [more]
LUC7L39.408e-2254.55LUC7 like 3 pre-mRNA splicing factor [Source:HGNC ... [more]
LUC7L29.111e-2029.22LUC7 like 2, pre-mRNA splicing factor [Source:HGNC... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C50D2.84.652e-3835.71pep chromosome:WBcel235:II:96127:98027:-1 gene:WBG... [more]
C50D2.84.652e-3835.71pep chromosome:WBcel235:II:96127:97944:-1 gene:WBG... [more]
Y119D3B.123.852e-2731.67pep chromosome:WBcel235:III:1202548:1207264:1 gene... [more]
Y119D3B.123.852e-2731.67pep chromosome:WBcel235:III:1202548:1207346:1 gene... [more]
Y119D3B.123.852e-2731.67pep chromosome:WBcel235:III:1202548:1207346:1 gene... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG31983.810e-2538.31gene:FBgn0029887 transcript:FBtr0070991[more]
CG75641.518e-1926.62gene:FBgn0036734 transcript:FBtr0344941[more]
CG75641.518e-1926.62gene:FBgn0036734 transcript:FBtr0345387[more]
CG75641.518e-1926.62gene:FBgn0036734 transcript:FBtr0075175[more]
CG75641.518e-1926.62gene:FBgn0036734 transcript:FBtr0331842[more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
luc7l34.513e-4244.72LUC7-like 3 pre-mRNA splicing factor [Source:ZFIN;... [more]
zgc:1588032.203e-2129.44zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15][more]
luc7l2.362e-1727.55LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GEN... [more]
luc7l1.776e-1527.68LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
luc7l37.471e-4244.58LUC7-like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
luc7l31.065e-4144.58LUC7-like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
luc7l31.326e-4144.58LUC7-like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
cyp3a4.22.887e-2131.82cytochrome P450 family 3 subfamily A member 4, gen... [more]
cyp3a4.23.060e-2131.82cytochrome P450 family 3 subfamily A member 4, gen... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Luc7l31.426e-4243.98LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Luc7l31.427e-4243.98LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Luc7l32.215e-4243.98LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Luc7l32.215e-4243.98LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Luc7l26.005e-2029.22LUC7-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Luc7-like protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R8W6|LC7L3_PONAB9.871e-4243.98Luc7-like protein 3 OS=Pongo abelii OX=9601 GN=LUC... [more]
sp|O95232|LC7L3_HUMAN9.871e-4243.98Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC... [more]
sp|Q3SX41|LC7L3_BOVIN1.214e-4143.98Luc7-like protein 3 OS=Bos taurus OX=9913 GN=LUC7L... [more]
sp|Q5SUF2|LC7L3_MOUSE1.340e-4143.98Luc7-like protein 3 OS=Mus musculus OX=10090 GN=Lu... [more]
sp|Q54XQ8|LUC7L_DICDI3.125e-2132.34Luc7-like protein OS=Dictyostelium discoideum OX=4... [more]
back to top
BLAST of Luc7-like protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430Q8133.256e-5448.47Uncharacterized protein OS=Schistosoma bovis OX=61... [more]
A0A183N4353.480e-5448.47Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A183KDV33.568e-5448.47Uncharacterized protein OS=Schistosoma curassoni O... [more]
A0A183PFM33.568e-5448.47Uncharacterized protein OS=Schistosoma mattheei OX... [more]
C4Q5Y33.627e-5448.47Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
luc7l39.349e-4244.24LUC7 like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
luc7l31.979e-4044.24LUC7 like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
luc7l6.734e-2231.17LUC7 like [Source:NCBI gene;Acc:103037252][more]
zgc:1588031.383e-2128.89zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15][more]
zgc:1588033.285e-2128.89zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15][more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000001648.12.384e-4242.59pep scaffold:Pmarinus_7.0:GL476581:121672:135516:-... [more]
luc7l1.647e-2028.66LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GEN... [more]
luc7l7.211e-935.44LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LUC74.538e-650.00Essential protein associated with the U1 snRNP com... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO312753.474e-4144.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347403.305e-1540.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Luc7-like protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
luc7l31.220e-4341.71LUC7 like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
ENSORLT00000005146.21.937e-2129.44putative RNA-binding protein Luc7-like 1 [Source:N... [more]
luc7l7.990e-1727.55LUC7 like [Source:NCBI gene;Acc:101168406][more]
back to top
BLAST of Luc7-like protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063148.15.058e-11387.50SMESG000063148.1[more]
SMESG000063148.15.094e-11387.50SMESG000063148.1[more]
SMESG000063148.16.108e-10187.50SMESG000063148.1[more]
SMESG000063148.17.853e-6979.44SMESG000063148.1[more]
SMESG000041410.11.079e-5250.00SMESG000041410.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014439 ID=SMED30014439|Name=Luc7-like protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1807bp
CTTCCGATCTAAAATATTTAATTTATTTCTACCATATTTATTAATAAATA
GTAATTTTAGCAATGGCTTTGGCTGCCCAAGCAGCATTGTTAGACGAATT
AATGGGTAAAAATCGAAACAATGTTAATGATTTTAATAAAGAAACTCATT
GGGATGACGATGATGTATGTTGCTATTTTTTAGCCGGACTTTGTCCACAT
AGTCTATTTATTAATACCAAAGCAGATTTAGGCCAATGTGAAAAAATTCA
CAATGAAAAGTTAATTCAGAATTATAGAAAATCTAGTAGATATAAAAAAA
TGGGATTTGAAGAAGATTTGTATCGGCTTTTAAATCAACTGGTGTCAGAC
GTAGAACGTAGAATATGGAAAGGACAGGAACGCTTGAGATTAAATGGACC
TTCGCTTAATGGTGGTTTTCACGAAGAAAGACAACGGAAACTGGAAGAAG
TGACCAATAAAATCAATGAATTAATATCTAAAGCGGAAAAATTAGGTAAT
ATTGGCAAGGTGATTGAGTGTCAAGATATTTTACATCAAACAGAAGAACT
GAAATACGAGCAAAATTTTTATCAAAAAGAAATTGAAATGTTAAGCCAGC
AAAACTTGAGGTTTGCTGTGTTTGCGGAGCGTTTCGAATAAAGGACGATG
CCCCTCAAAGAGTTGAAGAACATTTATCTGGTAAAATGCATATAGGTTAC
ACTAAGGTGCGTGAATTTTTAAAAAATATGTCAAATAAAACAAGGCACAG
ATCTACTTCATTGAGAAGAGATTGAAAATTCTGTTAGTTCAATTTGAAAG
TTAACAAGTAAATTCCTTTTTAAATTGGATATTTCTTTTTGAAAGTAAAA
TACTTGGAAAGATTCTCATATAGTGGACTGCATATTTGGAGTTTTAGATG
ATTATTAACCGTCACAGTGGAATCAGATATAAGGTTTTATTATTTAATCT
CATCAGTTTTCATAGAAAATGGATTGATTTGTTTTTTTGACAATTTTATA
AGGAAACCGAATTTTCGATTTAATATTAATAGTTTGTAATATTCAGAAGT
CGTTCAAAAAGTGATCATCGTAGTTATCGAGATCACAGGCATGATCGGAG
TATCCGGAGGCATCATAGACATAAAAGTCGGTCTCAAAGAACTCGTCGGC
ATTAATTCGGTTTTCAATGACTTTTAACGAGTCATTATATCTATTGAATT
GAATTGATCAAATTAGTTTAACAGTGATGTTGTAAATAACGATTTATTAT
ACTTTCGGTATTTTGGGAAATTAAAACTAATCTCTAGCGAGATAGTGTAA
AAGGTTTCTCCAATGTAACTGTACTGGTTCAAAGAAGCTTGAATTGATCG
TTAAATGAAGTTATTAGAAAAGTTTAATTTCTTATTGCGATTGGGTGTGA
TGAGTGAGTGGATGAAATTTTAAAATTTAGTAGACTCTTTAAAAATTAGG
TTCGTTGTGAAACGCGCTTAACAATTTCTGTACTAATGTTGCATTTATGC
AAAATGTAACTGGGCCGAGACGTTTTAAAAAGAGTTATATGTAAACAAAT
CGATACCTTGTCGATTAAAGTACAATATACAGAAATGTAGTATAAAAGCT
GAATTCCAAGCATGTGACCTTACACTCGGATCAATTCGTTAAATACTGCT
ATACTAAAATGAAAAAACCAATAGTGTTATAATATACGGGCAAACATACG
TAATTGTTTTTGCTTGTAATTTATTCAACTGAATAAAAACTTGTATTATA
GGAAGGAAGGAATTTGATGGAAAAATTTTTAAGCATAAACACATAATACA
TAGTAAA
back to top

protein sequence of SMED30014439-orf-1

>SMED30014439-orf-1 ID=SMED30014439-orf-1|Name=SMED30014439-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=193bp
MALAAQAALLDELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFI
NTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERR
IWKGQERLRLNGPSLNGGFHEERQRKLEEVTNKINELISKAEKLGNIGKV
IECQDILHQTEELKYEQNFYQKEIEMLSQQNLRFAVFAERFE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR004882Luc7-rel
Vocabulary: biological process
TermDefinition
GO:0006376mRNA splice site selection
Vocabulary: molecular function
TermDefinition
GO:0003729mRNA binding
Vocabulary: cellular component
TermDefinition
GO:0005685U1 snRNP
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 120..147
NoneNo IPR availablePANTHERPTHR12375:SF18LUC7-LIKE PROTEIN 3coord: 3..174
IPR004882Luc7-relatedPFAMPF03194LUC7coord: 5..177
e-value: 5.7E-51
score: 173.6
IPR004882Luc7-relatedPANTHERPTHR12375RNA-BINDING PROTEIN LUC7-RELATEDcoord: 3..174