Epidermal retinol dehydrogenase 2

Overview
NameEpidermal retinol dehydrogenase 2
Smed IDSMED30014429
Length (bp)1090
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Epidermal retinol dehydrogenase 2 (SMED30014429) t-SNE clustered cells

Violin plots show distribution of expression levels for Epidermal retinol dehydrogenase 2 (SMED30014429) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Epidermal retinol dehydrogenase 2 (SMED30014429) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Epidermal retinol dehydrogenase 2 (SMED30014429) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014429

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30014429SMESG000018759.1 dd_Smed_v4_9785_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014429SMESG000018759.1 dd_Smed_v4_9785_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Human
Match: SDR16C5 (short chain dehydrogenase/reductase family 16C member 5 [Source:HGNC Symbol;Acc:HGNC:30311])

HSP 1 Score: 160.999 bits (406), Expect = 3.870e-46
Identity = 108/284 (38.03%), Postives = 158/284 (55.63%), Query Frame = 1
Query:   64 IGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECK--KYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVL 906
            +G  +F+ +  +    +PK    K+V  ++VLITGAG+GLG  LA++FA+    LVLW+ + +  +   + CK  +      V     D S +  +   AD VK +VG V I+INNAG+       +  +  + K+ +VN  + +W  ++FL  M + + GH+V ISS  GL GV  LADYC SKFA  GF ES+  E +  K+ G+    V PF +KT MF+     CP +L  LE +Y   KI EAIL     LY+PKLL+F++ LK  LP K  L + + L
Sbjct:   15 LGKSLFSLLEAMIFALLPK--PRKNVAGEIVLITGAGSGLGRLLALQFARLGSVLVLWDINKEGNE---ETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVSILINNAGIVTGKKFLDCPDELMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKTGMFEGCTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYL 293          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Human
Match: SDR16C5 (short chain dehydrogenase/reductase family 16C member 5 [Source:HGNC Symbol;Acc:HGNC:30311])

HSP 1 Score: 155.221 bits (391), Expect = 9.136e-44
Identity = 103/269 (38.29%), Postives = 151/269 (56.13%), Query Frame = 1
Query:   64 IGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECK--KYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILK 861
            +G  +F+ +  +    +PK    K+V  ++VLITGAG+GLG  LA++FA+    LVLW+ + +  +   + CK  +      V     D S +  +   AD VK +VG V I+INNAG+       +  +  + K+ +VN  + +W  ++FL  M + + GH+V ISS  GL GV  LADYC SKFA  GF ES+  E +  K+ G+    V PF +KT MF+     CP +L  LE +Y   KI EAIL     LY+PKLL+F++ LK
Sbjct:   15 LGKSLFSLLEAMIFALLPK--PRKNVAGEIVLITGAGSGLGRLLALQFARLGSVLVLWDINKEGNE---ETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVSILINNAGIVTGKKFLDCPDELMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKTGMFEGCTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLK 278          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Human
Match: HSD17B11 (hydroxysteroid 17-beta dehydrogenase 11 [Source:HGNC Symbol;Acc:HGNC:22960])

HSP 1 Score: 151.369 bits (381), Expect = 1.539e-42
Identity = 97/271 (35.79%), Postives = 154/271 (56.83%), Query Frame = 1
Query:   85 SIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLL 897
            S+ +  K FIPK+   KSV  ++VLITGAG+G+G   A +FAK + +LVLW+ +   L+    +CK   + +      VD SNR  I ++A  VK ++G V I++NNAGV +TS +   ++  I KT  VN L+  W  ++FL  M   N GH+V+++S  G V V  L  YC SKFA  GF ++L  E+ + + +G+    + P  + T   +N      +  +LE E V +++   ILT   ++++P  + FL  L+ +LP + FL +L
Sbjct:   18 SLESFVKLFIPKR--RKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTF--VVDCSNREDIYSSAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMTKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNP--STSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPER-FLAVL 281          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Human
Match: HSD17B13 (hydroxysteroid 17-beta dehydrogenase 13 [Source:HGNC Symbol;Acc:HGNC:18685])

HSP 1 Score: 144.436 bits (363), Expect = 8.134e-40
Identity = 90/273 (32.97%), Postives = 148/273 (54.21%), Query Frame = 1
Query:   79 FTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQ-----VDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKC 882
            ++ + ++ KFFIP++   KSV  ++VLITGAG+G+G     +FAK++  LVLW+ +   ++    EC+K       LG+      VD SNR +I  + + VK +VG V I++NNAG  + + +   ++  I KT  VN L   WI ++ L  M  RN GH+V+++S  G  G+  L  YC SKFA  GF   L  E+ +  K+G+    + P  + T   +N      +   LE + V   + + ILTN  ++++P  ++  + L+  LP + 
Sbjct:   16 YSYLESLVKFFIPQR--RKSVAGEIVLITGAGHGIGRQTTYEFAKRQSILVLWDINKRGVEETAAECRK-------LGVTAHAYVVDCSNREEIYRSLNQVKKEVGDVTIVVNNAGTVYPADLLSTKDEEITKTFEVNILGHFWITKALLPSMMERNHGHIVTVASVCGHEGIPYLIPYCSSKFAAVGFHRGLTSELQALGKTGIKTSCLCPVFVNTGFTKNP--STRLWPVLETDEVVRSLIDGILTNKKMIFVPSYINIFLRLQKFLPERA 277          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Human
Match: RDH10 (retinol dehydrogenase 10 [Source:HGNC Symbol;Acc:HGNC:19975])

HSP 1 Score: 139.813 bits (351), Expect = 1.017e-37
Identity = 91/290 (31.38%), Postives = 147/290 (50.69%), Query Frame = 1
Query:  115 PKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKY-----------------------QSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDC---PILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVL 906
            PK+   KSV  +V LITGAG+GLG   A++FA++R  LVLW+ +  S +      +                           +L V     D+  R  +   A+ V+ +VG V +++NNAGV     + E  +  I +T+ VN  +  W  ++FL  M   N GH+V+++S  GL     + DYC SKF V GF ESL HE+ +A+K G+    V P+ + T MF+  +      P L  L+ +Y   +  +AILT+  ++  P+L++ +  +K +LP +  +C+   L
Sbjct:   29 PKE---KSVAGQVCLITGAGSGLGRLFALEFARRRALLVLWDINTQSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVSVLVNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMKAILTDQPMICTPRLMYIVTFMKSILPFEAVVCMYRFL 315          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Celegans
Match: dhs-3 (pep chromosome:WBcel235:I:8212362:8218361:-1 gene:WBGene00000967.1 transcript:T02E1.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:dhs-3)

HSP 1 Score: 143.665 bits (361), Expect = 5.699e-40
Identity = 102/286 (35.66%), Postives = 154/286 (53.85%), Query Frame = 1
Query:   43 VINILKVIGLIIFTSIGNIFKFFIPKKYAM-KSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQ-----VDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTK 879
            V+  L  I L+I ++I N F    P  + + K V  + VLITG+G+GLG  +A +F K   RLVLW+ +    K  + E       L  +G++     VD+S   +I   AD+VK++VG VDI++NNAG+     + +  +  + KT++VN  +  +  ++FL  M   N GH+V+I+S  G  GV  L DYC SK    GF +SL  E+Y+ KK  +    V P ++ T MF       P +L  L  EYV   I EA+LT+   L +PK  +  + L  +LPT+
Sbjct:    8 VVVTLHAICLLIISTIRNCF----PMGWLLRKDVRGQTVLITGSGSGLGRLMAFEFGKLGARLVLWDINEQGNKETLKE-------LEAMGVEAKAYTVDLSEYKEINRTADLVKSEVGKVDILVNNAGIVTGKKLLQCPDELMVKTVSVNTNALFFTTKNFLPGMLESNKGHIVTIASMAGKCGVAGLVDYCASKHGAVGFNDSLASELYALKKD-VKTTVVCPIYINTGMFDGIATKWPTLLPILSPEYVVDCIMEAVLTDRAFLAIPKFSYIFIALAGLLPTE 281          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Celegans
Match: dhs-3 (pep chromosome:WBcel235:I:8212362:8218324:-1 gene:WBGene00000967.1 transcript:T02E1.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:dhs-3)

HSP 1 Score: 143.665 bits (361), Expect = 5.699e-40
Identity = 102/286 (35.66%), Postives = 154/286 (53.85%), Query Frame = 1
Query:   43 VINILKVIGLIIFTSIGNIFKFFIPKKYAM-KSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQ-----VDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTK 879
            V+  L  I L+I ++I N F    P  + + K V  + VLITG+G+GLG  +A +F K   RLVLW+ +    K  + E       L  +G++     VD+S   +I   AD+VK++VG VDI++NNAG+     + +  +  + KT++VN  +  +  ++FL  M   N GH+V+I+S  G  GV  L DYC SK    GF +SL  E+Y+ KK  +    V P ++ T MF       P +L  L  EYV   I EA+LT+   L +PK  +  + L  +LPT+
Sbjct:    8 VVVTLHAICLLIISTIRNCF----PMGWLLRKDVRGQTVLITGSGSGLGRLMAFEFGKLGARLVLWDINEQGNKETLKE-------LEAMGVEAKAYTVDLSEYKEINRTADLVKSEVGKVDILVNNAGIVTGKKLLQCPDELMVKTVSVNTNALFFTTKNFLPGMLESNKGHIVTIASMAGKCGVAGLVDYCASKHGAVGFNDSLASELYALKKD-VKTTVVCPIYINTGMFDGIATKWPTLLPILSPEYVVDCIMEAVLTDRAFLAIPKFSYIFIALAGLLPTE 281          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Celegans
Match: dhs-19 (DeHydrogenases, Short chain [Source:UniProtKB/TrEMBL;Acc:Q22392])

HSP 1 Score: 139.043 bits (349), Expect = 3.010e-38
Identity = 97/275 (35.27%), Postives = 147/275 (53.45%), Query Frame = 1
Query:   61 VIGLIIFTSIGNIFKFFIPKK-YAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKY--QSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPIL-KSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLP 873
            V+G + F  + N FK F+P      KSV  K VLITG+G+G+G  +A++FAK    +V+W+ + D  +   ++  K   ++  FV    VD+S    I   A   K  VG +DI+INNAG+     + +  +  + KT+ VN  +  +  ++FL  M  +++GH+V+I+S  G  G   L DYC SK    G  +S+  EI + KK G++   V PF + T MF      CP L   LE  Y    I EAILTN  +L +PK  + ++ L  +LP
Sbjct:   11 VVGTLFFIVL-NFFKNFLPNGVLPRKSVEGKKVLITGSGSGIGRLMALEFAKLGAEVVIWDVNKDGAEETKNQVVKAGGKASTFV----VDLSQYKDIHKVAKETKEAVGDIDILINNAGIVTGKKLFDCPDELMEKTMAVNTNALFYTAKNFLPSMLEKDNGHLVTIASMAGKTGCVGLVDYCASKHGAIGCHDSIAMEILAQKKYGVNTTLVCPFFIDTGMFHGVTTKCPALFPILEANYAVECIVEAILTNRPLLCMPKASYLILALIGLLP 280          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Celegans
Match: dhs-3 (pep chromosome:WBcel235:I:8212367:8218287:-1 gene:WBGene00000967.1 transcript:T02E1.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:dhs-3)

HSP 1 Score: 137.117 bits (344), Expect = 2.243e-37
Identity = 92/253 (36.36%), Postives = 139/253 (54.94%), Query Frame = 1
Query:  139 VNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQ-----VDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTK 879
            V+ + VLITG+G+GLG  +A +F K   RLVLW+ +    K  + E       L  +G++     VD+S   +I   AD+VK++VG VDI++NNAG+     + +  +  + KT++VN  +  +  ++FL  M   N GH+V+I+S  G  GV  L DYC SK    GF +SL  E+Y+ KK  +    V P ++ T MF       P +L  L  EYV   I EA+LT+   L +PK  +  + L  +LPT+
Sbjct:   39 VSGQTVLITGSGSGLGRLMAFEFGKLGARLVLWDINEQGNKETLKE-------LEAMGVEAKAYTVDLSEYKEINRTADLVKSEVGKVDILVNNAGIVTGKKLLQCPDELMVKTVSVNTNALFFTTKNFLPGMLESNKGHIVTIASMAGKCGVAGLVDYCASKHGAVGFNDSLASELYALKKD-VKTTVVCPIYINTGMFDGIATKWPTLLPILSPEYVVDCIMEAVLTDRAFLAIPKFSYIFIALAGLLPTE 283          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Celegans
Match: dhs-4 (DeHydrogenases, Short chain [Source:UniProtKB/TrEMBL;Acc:O18030])

HSP 1 Score: 132.494 bits (332), Expect = 9.664e-36
Identity = 90/256 (35.16%), Postives = 139/256 (54.30%), Query Frame = 1
Query:  133 KSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQ------NYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKC 882
            K +  K VLITGAGNGLG  LA KFA +   L+LW+ ++ S+  + +E +  Q +      +V++ +  +I      V   +G VDI++NNAG+A    I +  EN I ++ +VN  +  + VQ FL  M   N+GH+V+I+S  G +G   LADY  +K A  GF +SL+ EI  ++K+G+    V P+++ T MF        + +  PI   L+ +YV  KI EAI T    L  P+  + +     +LP K 
Sbjct:   36 KDLYRKKVLITGAGNGLGKLLAQKFAARGATLILWDINLQSVDELKNEIRGNQGEAH--SYEVNLCDPGKIAQVGQQVINDIGKVDILVNNAGIATAKMILDSSENEINRSFDVNVKAHFYTVQQFLPAMLKDNNGHIVTIASAAGKMGSSGLADYSSTKHAAVGFHDSLVAEIMESEKNGVKTTLVCPYYVHTSMFDATGAATRFPWIFPI---LDTDYVVQKIFEAIETEQEFLVTPRAFYLVFAGIQILPYKA 286          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Fly
Match: CG15629 (gene:FBgn0031630 transcript:FBtr0077383)

HSP 1 Score: 162.925 bits (411), Expect = 5.921e-47
Identity = 95/281 (33.81%), Postives = 161/281 (57.30%), Query Frame = 1
Query:   76 IFTSIGNIFKFFIPKKYA-MKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTK-CFLCLLNVLLG 912
            ++  + +I+   +P+++  +K ++ +VVLITG G G+G  +A+ FA+ + R+V+W+ + +++K  +D   K+  D    G  VDIS+R QI   A  V  +VG VDI+INNAG+       E+ +  I+ T N+N +S  W V++FL  M   N GH+V++ S TG++G    +DY  +K+A  GF ESLL ++ +     + +  + P+++ T MF   +    ++  LE +YVA +IE A+  N     LP  +  L  LK +LP K C+  +  V+ G
Sbjct:   32 VYYVLESIYYSLLPQRFRKLKDISGQVVLITGGGGGVGRLIALNFARLQARIVIWDINQEAIKTTVDLLAKHGYD-NCKGYVVDISDREQIYQRASQVTEEVGPVDILINNAGIVCCKPFWELHDRVIQNTYNINIISHYWTVKAFLPHMMRNNRGHIVTVGSVTGMLGTYGCSDYAATKYACIGFHESLLTDLKAHGYDQIQMSLICPYYINTGMFSGVRPR--MMPMLEPQYVADRIENAVRCNEVWCVLPNSIRLLTPLKCLLPAKMCWELMSRVIRG 309          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Fly
Match: CG9265 (gene:FBgn0032910 transcript:FBtr0331378)

HSP 1 Score: 131.724 bits (330), Expect = 1.691e-34
Identity = 91/288 (31.60%), Postives = 148/288 (51.39%), Query Frame = 1
Query:   64 IGLIIFTSIGNIFK--FFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETD---IDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMK-TKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLL 909
            +   I   IG I +  ++I   Y  K +N  + LITG GNGLG  LA +  K   ++V+W+ +   I     I++E   Y       G  VDIS + ++  AAD+++ +VG + ++INNAGV     + +  ++ I ++ NVN ++  W  ++FL  M   + GH+ +I+S  G VG+ KL DYC SKFA  GF E+L  E+     + +    + PF ++ T MF +   +   + +L    VA ++  AI  N  +  +P  L  L+  K+  P  C   LL  L+
Sbjct:   57 VAWFIICCIGYILQDLYYIAFGYPEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEEAGGY-----CKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATGMFDD--VNARWVPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLLSFKWTFPWGCVGGLLKRLV 337          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Fly
Match: CG9265 (gene:FBgn0032910 transcript:FBtr0331377)

HSP 1 Score: 131.724 bits (330), Expect = 1.691e-34
Identity = 91/288 (31.60%), Postives = 148/288 (51.39%), Query Frame = 1
Query:   64 IGLIIFTSIGNIFK--FFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETD---IDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMK-TKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLL 909
            +   I   IG I +  ++I   Y  K +N  + LITG GNGLG  LA +  K   ++V+W+ +   I     I++E   Y       G  VDIS + ++  AAD+++ +VG + ++INNAGV     + +  ++ I ++ NVN ++  W  ++FL  M   + GH+ +I+S  G VG+ KL DYC SKFA  GF E+L  E+     + +    + PF ++ T MF +   +   + +L    VA ++  AI  N  +  +P  L  L+  K+  P  C   LL  L+
Sbjct:   57 VAWFIICCIGYILQDLYYIAFGYPEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEEAGGY-----CKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATGMFDD--VNARWVPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLLSFKWTFPWGCVGGLLKRLV 337          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Fly
Match: CG9265 (gene:FBgn0032910 transcript:FBtr0081507)

HSP 1 Score: 131.724 bits (330), Expect = 1.691e-34
Identity = 91/288 (31.60%), Postives = 148/288 (51.39%), Query Frame = 1
Query:   64 IGLIIFTSIGNIFK--FFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETD---IDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMK-TKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLL 909
            +   I   IG I +  ++I   Y  K +N  + LITG GNGLG  LA +  K   ++V+W+ +   I     I++E   Y       G  VDIS + ++  AAD+++ +VG + ++INNAGV     + +  ++ I ++ NVN ++  W  ++FL  M   + GH+ +I+S  G VG+ KL DYC SKFA  GF E+L  E+     + +    + PF ++ T MF +   +   + +L    VA ++  AI  N  +  +P  L  L+  K+  P  C   LL  L+
Sbjct:   57 VAWFIICCIGYILQDLYYIAFGYPEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEEAGGY-----CKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATGMFDD--VNARWVPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLLSFKWTFPWGCVGGLLKRLV 337          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Fly
Match: CG9265 (gene:FBgn0032910 transcript:FBtr0331376)

HSP 1 Score: 131.724 bits (330), Expect = 1.691e-34
Identity = 91/288 (31.60%), Postives = 148/288 (51.39%), Query Frame = 1
Query:   64 IGLIIFTSIGNIFK--FFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETD---IDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMK-TKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLL 909
            +   I   IG I +  ++I   Y  K +N  + LITG GNGLG  LA +  K   ++V+W+ +   I     I++E   Y       G  VDIS + ++  AAD+++ +VG + ++INNAGV     + +  ++ I ++ NVN ++  W  ++FL  M   + GH+ +I+S  G VG+ KL DYC SKFA  GF E+L  E+     + +    + PF ++ T MF +   +   + +L    VA ++  AI  N  +  +P  L  L+  K+  P  C   LL  L+
Sbjct:   57 VAWFIICCIGYILQDLYYIAFGYPEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAETVQIVEEAGGY-----CKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLIERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLELEVLGHTNIRTTCICPFFIQATGMFDD--VNARWVPTLNPNDVADRVIAAIRKNEKLAVIPGFLKVLLSFKWTFPWGCVGGLLKRLV 337          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Zebrafish
Match: sdr16c5a (short chain dehydrogenase/reductase family 16C, member 5a [Source:ZFIN;Acc:ZDB-GENE-040426-2049])

HSP 1 Score: 187.193 bits (474), Expect = 1.943e-56
Identity = 112/280 (40.00%), Postives = 168/280 (60.00%), Query Frame = 1
Query:   43 VINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKS-LEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTK 879
            ++  L++I L ++ ++    KFFIP +   K V+ ++VLITG+G+G+G  +A++FA     LVLW+ ++D LK   ++ K+  +   V   Q D S+R  +   AD VK+++G V I+INNAG+       +  +  I KTL VN +S  W  ++FL  M  +N GH+VS++S  GL+GV  LADYC SKFA  GF ES+  E+ SA K G+    V PF + T +F       P+L   LE +YVA +I  AILT+   + LP+ L+FL+ LK V+P K
Sbjct:    4 LLETLRLIFLTVYYNLEAFLKFFIPLR--KKDVSGEIVLITGSGSGIGRLMALEFASLDVSLVLWDINVDGLKETAEQVKEKGASR-VHYYQCDCSDREAVYRVADQVKSEIGDVTILINNAGIVSGKKFMDTPDALIEKTLRVNAMSHFWTYKAFLPAMMDKNHGHLVSVASSAGLIGVNGLADYCASKFAAVGFAESVALELLSAGKDGIKTTIVCPFLINTGLFDGCGTKWPLLMPMLEPDYVAKRIVSAILTDQVFVLLPRSLYFLMALKGVIPYK 280          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Zebrafish
Match: sdr16c5a (short chain dehydrogenase/reductase family 16C, member 5a [Source:ZFIN;Acc:ZDB-GENE-040426-2049])

HSP 1 Score: 187.578 bits (475), Expect = 2.060e-56
Identity = 112/280 (40.00%), Postives = 168/280 (60.00%), Query Frame = 1
Query:   43 VINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKS-LEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTK 879
            ++  L++I L ++ ++    KFFIP +   K V+ ++VLITG+G+G+G  +A++FA     LVLW+ ++D LK   ++ K+  +   V   Q D S+R  +   AD VK+++G V I+INNAG+       +  +  I KTL VN +S  W  ++FL  M  +N GH+VS++S  GL+GV  LADYC SKFA  GF ES+  E+ SA K G+    V PF + T +F       P+L   LE +YVA +I  AILT+   + LP+ L+FL+ LK V+P K
Sbjct:   15 LLETLRLIFLTVYYNLEAFLKFFIPLR--KKDVSGEIVLITGSGSGIGRLMALEFASLDVSLVLWDINVDGLKETAEQVKEKGASR-VHYYQCDCSDREAVYRVADQVKSEIGDVTILINNAGIVSGKKFMDTPDALIEKTLRVNAMSHFWTYKAFLPAMMDKNHGHLVSVASSAGLIGVNGLADYCASKFAAVGFAESVALELLSAGKDGIKTTIVCPFLINTGLFDGCGTKWPLLMPMLEPDYVAKRIVSAILTDQVFVLLPRSLYFLMALKGVIPYK 291          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Zebrafish
Match: sdr16c5b (short chain dehydrogenase/reductase family 16C, member 5b [Source:ZFIN;Acc:ZDB-GENE-040426-2861])

HSP 1 Score: 162.54 bits (410), Expect = 7.823e-47
Identity = 105/293 (35.84%), Postives = 165/293 (56.31%), Query Frame = 1
Query:   40 FVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECK-KYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLLG 912
            F++  L+V+ L +   +    + FIP +   K+V+ ++VL+TGAG+G+G  +A++FA+   RLVLW+ + D  K      K KY +         D S+R ++   A+ VK +VG V I+INNAG+       +  ++ I K++ VN L+  W  ++FL  M + N GH+VSI+S  GL+GV  LADYC SKFA  GF ES+  E+ +    G+    V PF + T MF       P ++  L+ +Y   KI +AI      LY+P+ ++ ++ L+ +LPTK     + VLLG
Sbjct:    3 FLLETLRVLFLSLVLGLEAFVRLFIPPR--RKNVSGELVLLTGAGSGIGRLMALEFARLDARLVLWDINEDGNKETARLIKEKYGARAHTY--TCDCSDREEVYRVANQVKREVGDVTILINNAGIVTGKKFMDSPDSLIEKSMEVNSLAHFWTYKAFLPAMIAGNHGHLVSIASSAGLIGVNGLADYCASKFAAVGFAESMGLELLATGCDGVKTTIVCPFFINTGMFDGANTKWPRLMPILDPDYACRKIVDAIRREQVYLYMPRSIYIIIGLRNLLPTK-----VGVLLG 286          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Zebrafish
Match: rdh10b (retinol dehydrogenase 10b [Source:NCBI gene;Acc:378722])

HSP 1 Score: 144.436 bits (363), Expect = 9.363e-40
Identity = 95/286 (33.22%), Postives = 156/286 (54.55%), Query Frame = 1
Query:  103 KFFI-PKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKK-YQS------------DLFVLGIQV-----DISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFD---CPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCL 894
            K+FI P++   KSV  +V +ITGAG+GLG   A++FA++R  LVLW+ +  S +   +  ++ Y+             +L +L  +V     D+S R  +   A+ V+++VG +D++INNAGV     + +  +  I +T+ VN  +  W  ++FL  M   N GH+V+++S  GL     + DYC SKF   GF ESL HE+ +A K G+ +  V PF + T MF+  K      P    L+ EY   +   AILT+  ++  P++++ +  +K VLP    +C+
Sbjct:   24 KWFIRPRE---KSVEGQVCVITGAGSGLGRLFALEFARRRATLVLWDINRQSNEETAEMAREIYRQLKPSTGSSDSVQELPLLQPKVYTYMCDVSKRESVYLTAEKVRSEVGDIDLLINNAGVVSGRHLLDCPDELIERTMMVNCHAHFWTTKAFLPKMLELNHGHIVTVASSLGLFTTAGVEDYCASKFGAIGFHESLSHELKAADKDGIKMTLVCPFLVDTGMFEGCKIRKEMAPFFPPLKPEYCVKQAMRAILTDQPMICTPRVMYMVTFMKTVLPFDAIVCM 306          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Zebrafish
Match: rdh10a (retinol dehydrogenase 10a [Source:NCBI gene;Acc:562840])

HSP 1 Score: 144.05 bits (362), Expect = 1.704e-39
Identity = 99/317 (31.23%), Postives = 164/317 (51.74%), Query Frame = 1
Query:   31 YLIFVINILKVIGLIIFTSIGNIFKFFI-PKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDS--------LKIIIDECKKYQSDLFVLGIQ-------------VDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDC---PILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVL 906
            ++ F + +LKV   I+       FK+ I PK+   KSV  +V +ITGAG GLG   A +FA++R  LVLW+ +  S         +I  ++      +  V G++             +D+  R  + + A+ V+ +VG VD++INNAGV     + E  +  I +T+ VN  +  W  ++FL  M   N GH+V+++S  GL     + DYC SKF   GF ESL HEI +++K G+ +  V P+ + T MF+  +      P L  L  E+   +   AILT+  ++  P++++ +  +K +LP +  +C+   L
Sbjct:    4 FVEFFLVMLKVCWAIVMAG----FKWLIRPKE---KSVAGQVCVITGAGGGLGRLFAKEFARRRATLVLWDINSHSNEETAEMVRQIYREQDNPMSKEGAVGGVEEVPPFQPQVYTYVLDVGKRESVYSTAEKVRREVGEVDLLINNAGVVSGHHLLECPDELIERTMVVNCHAHFWTTKAFLPKMLEMNHGHIVTVASSLGLFSTAGVEDYCASKFGAIGFHESLSHEIQASEKDGIKMTLVCPYLVDTGMFRGCRIRKEIEPFLPPLRPEFCVKQAMRAILTDQPMICTPRIVYMVNFMKSILPFEAIVCMYRFL 313          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Xenopus
Match: capn8.1 (calpain 8 gene 1 [Source:Xenbase;Acc:XB-GENE-920785])

HSP 1 Score: 162.925 bits (411), Expect = 6.602e-47
Identity = 108/292 (36.99%), Postives = 165/292 (56.51%), Query Frame = 1
Query:   46 INILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECK--KYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLLG 912
            +  LKV+ L I+ ++ +   +FIP +   K+V  ++VLITGAG+G+G  +A++FA     LVLW+ + +  K   + C+  K    + V     D S R ++   AD VK +VG V I+INNAG+       +  +  + KT+ VN ++  W  ++FL  M + N GH+VSI+S  GL+GV  LADYC SKFA  GF ES+  E+ +  K+G+    V P+ + T MF       P +L  LE EY + KI +AIL +   L +P+ L+ +  LK ++ TK     L V+LG
Sbjct:    5 LETLKVLFLTIYLNLESFVLWFIPSR--KKNVAGEIVLITGAGSGIGRLMALEFAHLGATLVLWDINEEGNK---ETCRLAKKNGAVRVHAYLCDCSKRQEVYKVADQVKKEVGDVSILINNAGIVTGKKFIDSPDALVEKTMQVNCMAHFWTYKAFLPAMMASNHGHLVSIASSAGLIGVNGLADYCASKFAAVGFAESVGLEMLALGKTGIKTTIVCPYFINTGMFDGCSTKWPRLLPILEAEYASKKIVDAILKDQVYLVMPRSLYIMFALKNIMSTK-----LGVVLG 286          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Xenopus
Match: cbx7 (chromobox 7 [Source:Xenbase;Acc:XB-GENE-942584])

HSP 1 Score: 155.992 bits (393), Expect = 3.055e-44
Identity = 96/271 (35.42%), Postives = 152/271 (56.09%), Query Frame = 1
Query:   70 LIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDC-PILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTK 879
            + +++ + +  K F+P     KSV   +VLITG+G+G+G   A++FAK    LVLW+ +   ++   DEC+K  +  +     VD S R+ I   A+ VK  +G VDI+INNAGV F +   +++++ I KT +VN L+  W  +SFL  M  ++ GH+V+++S  G +GV  L DYC SKF + GF ESL  E+    K G+    + P  + T   QN      P+LK+   E V   + E ILTN  ++ +P  + + +I+   LP +
Sbjct:   13 IAVYSYMESFVKLFLP--VNRKSVAGNIVLITGSGHGIGRRTALEFAKHESILVLWDINQKGVEETADECRKLGATAYAF--VVDCSTRNDIYRCAEKVKQDIGDVDILINNAGVVFGTEFLKLQDHQIEKTFSVNILAHFWTTKSFLSAMMKKDRGHIVTVASIAGQLGVPYLVDYCASKFGLVGFHESLTSELKLLGKDGVKTTCLCPVFVNTGFVQNPSTRVWPVLKT---EDVVKCLMEGILTNKKMIIVPSSVKYSLIMNQFLPER 276          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Xenopus
Match: hsd17b11 (hydroxysteroid (17-beta) dehydrogenase 11 [Source:NCBI gene;Acc:496757])

HSP 1 Score: 144.821 bits (364), Expect = 4.011e-40
Identity = 91/273 (33.33%), Postives = 152/273 (55.68%), Query Frame = 1
Query:   70 LIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFD-CPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCF 885
            +I+++ + +  K FIP K   KSV  +VVLITGAG+G+G   A  F +    LVLW+ +   ++   ++C+K  + ++     VD S R +I  AA+ VK +VG V I+INNAG+ F + +  +++  I K   VN L+  W  ++FL  M   N GH+V+++S  G VGV+ + DYC +KFA  G+ ++L  E+ +  KSG+    + P  + T   +N      P+L+    E VA  + + IL N  ++ +P  +  + +L + LP +  
Sbjct:   13 VIVYSYLESFVKLFIPLK--RKSVKGEVVLITGAGHGIGKITAQIFGELESVLVLWDINKQGVEETAEKCRKGGAKVYTY--VVDCSKREEINTAANKVKQEVGDVTILINNAGIIFCADVLTLQDQQIEKIFEVNILAHFWTTRAFLPSMLRNNHGHIVTVASSAGFVGVQFMVDYCSTKFAALGYHKALTAELLALGKSGIKTSCLCPVFVDTGFVKNPSLRLAPVLQP---EEVAQTLVDGILINKKMICVPSSVSLVPVLAFFLPERAL 278          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Xenopus
Match: rdh10 (retinol dehydrogenase 10 [Source:NCBI gene;Acc:496504])

HSP 1 Score: 142.124 bits (357), Expect = 1.058e-38
Identity = 92/284 (32.39%), Postives = 147/284 (51.76%), Query Frame = 1
Query:  133 KSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDS-------LKIIIDECKKYQS----------------DLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDC---PILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVL 906
            KSV  +V LITGAG+GLG   A++FA++R +LVLW+ +  S       ++ I  E +   S                +  V     D+  R  + + A+ V+ +VG V +++NNAGV     + E  +  I +T+ VN  +  W  ++FL  M   N GH+VS++S  GL     + DYC SKF V GF ESL HE+ +A K G+    V P+ + T MF+  +      P L  L+ +Y   +   AILT+  ++  P+L++ +  +K +LP +  +C+   L
Sbjct:   32 KSVAGQVCLITGAGSGLGRLFALEFARRRAQLVLWDINSQSNEETAEMVRSIYRELEAEDSARRAGNATEEEVQPCCNFQVYTYTCDVGKRESVYSTAERVRREVGDVYLLLNNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMMEMNHGHIVSVASSLGLFSTAGVEDYCASKFGVVGFHESLSHELKAADKDGIKTTLVCPYLVDTGMFRGCRIRKEIEPFLPPLKPDYCVKQAMRAILTDQPMICTPRLMYIVTCMKSILPFEAVVCMYRFL 315          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Xenopus
Match: ENSXETT00000032652.1 (IgGFc-binding protein-like [Source:Xenbase;Acc:XB-GENE-5897454])

HSP 1 Score: 135.576 bits (340), Expect = 1.941e-36
Identity = 79/254 (31.10%), Postives = 134/254 (52.76%), Query Frame = 1
Query:  121 KYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFD---CPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLP 873
            K   KS+ + + LITG+G G+G   A++FAK+   LVLW++D +  +    E ++  +  F      D  +R Q+   A+ V+ +VG V I++N+       S+   ++  +   L  N L+  W V++FL  M   N GHV++++S+ GL     + DYC + FA  GF E+L HE+ + + SG+    + P+    +M+ ++K       +   L  EY A +    ILT+  ++ +PKLL+    LK VLP
Sbjct:   37 KPEEKSIMDDICLITGSGGGIGKHFALEFAKKGAILVLWDSDPECNEETAKEVRRLGARAFTY--TCDTGDRQQVYQVAERVRREVGDVTILLNHPSTGTGKSLLHCQDEELENALRTNCLANFWTVKAFLPRMNQMNHGHVINVASYLGLFATANMEDYCTAHFATVGFHEALSHELKARRISGVKTTLLCPYLADIEMYSSFKIRKDLATLFTPLTSEYFARRAINGILTDQPMICMPKLLYLAAFLKQVLP 288          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Mouse
Match: Hsd17b13 (hydroxysteroid (17-beta) dehydrogenase 13 [Source:MGI Symbol;Acc:MGI:2140804])

HSP 1 Score: 170.629 bits (431), Expect = 5.872e-50
Identity = 101/282 (35.82%), Postives = 165/282 (58.51%), Query Frame = 1
Query:   40 FVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCF 885
             ++  L ++G+II++ + ++ KFFIP++   KSV  + VLITGAG+G+G   A +FAKQ+ RLVLW+ +   ++   D+C+K  + + V    VD SNR++I N+ D VK +VG V+I++NNAG  + + +   ++  I KT  VN L   WI+++ L  M  RNSGH+V+++S  G   +  L  YC SKFA  GF  +L  E+ +  K+G+    + P  + T   +N      +   LE E VA  +   ILTN  ++++P  ++  +IL+  LP +  
Sbjct:    3 LILEFLLLVGVIIYSYLESLVKFFIPRR--RKSVTGQTVLITGAGHGIGRLTAYEFAKQKSRLVLWDINKRGVEETADKCRKLGAVVHVF--VVDCSNRAEIYNSVDQVKREVGDVEIVVNNAGAIYPADLLSAKDEEITKTFEVNILGHFWIIKALLPSMLRRNSGHIVTVASVCGHGVIPYLIPYCSSKFAAVGFHRALTAELDTLGKTGIQTSCLCPVFVNTGFTKNP--STRLWPVLEPEEVARSLINGILTNKKMIFVPSYINISLILEKFLPERAL 278          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Mouse
Match: Hsd17b13 (hydroxysteroid (17-beta) dehydrogenase 13 [Source:MGI Symbol;Acc:MGI:2140804])

HSP 1 Score: 166.392 bits (420), Expect = 2.065e-48
Identity = 99/274 (36.13%), Postives = 162/274 (59.12%), Query Frame = 1
Query:   40 FVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILK 861
             ++  L ++G+II++ + ++ KFFIP++   KSV  + VLITGAG+G+G   A +FAKQ+ RLVLW+ +   ++   D+C+K  + + V    VD SNR++I N+ D VK +VG V+I++NNAG  + + +   ++  I KT  VN L   WI+++ L  M  RNSGH+V+++S  G   +  L  YC SKFA  GF  +L  E+ +  K+G+    + P  + T   +N      +   LE E VA  +   ILTN  ++++P  ++  +IL+
Sbjct:    3 LILEFLLLVGVIIYSYLESLVKFFIPRR--RKSVTGQTVLITGAGHGIGRLTAYEFAKQKSRLVLWDINKRGVEETADKCRKLGAVVHVF--VVDCSNRAEIYNSVDQVKREVGDVEIVVNNAGAIYPADLLSAKDEEITKTFEVNILGHFWIIKALLPSMLRRNSGHIVTVASVCGHGVIPYLIPYCSSKFAAVGFHRALTAELDTLGKTGIQTSCLCPVFVNTGFTKNPSTR--LWPVLEPEEVARSLINGILTNKKMIFVPSYINISLILE 270          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Mouse
Match: Sdr16c5 (short chain dehydrogenase/reductase family 16C, member 5 [Source:MGI Symbol;Acc:MGI:2668443])

HSP 1 Score: 164.466 bits (415), Expect = 1.621e-47
Identity = 101/253 (39.92%), Postives = 149/253 (58.89%), Query Frame = 1
Query:  133 KSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQV---DISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTK 879
            K+V  ++VLITGAG+GLG  LA++FA+    LVLW+ + ++     DE  +   +     +     D S R ++   AD VK +VG V I+INNAG+    +  +  ++ + K+ +VN  + +W+ ++FL  M + N GH+V ISS  GL+GV  L+DYC SKFA  GF ES+  E  + K+ G+    V PF +KT MF+     CP +L  L+ EY   KI +AIL     LY+PK L+F+V LK +LP K
Sbjct:   36 KNVAGEIVLITGAGSGLGRLLALQFARLGAVLVLWDVNKEA----NDETHQLAREAGAARVHAYTCDCSRREEVYRVADQVKKEVGDVSILINNAGIVTGRNFLDCPDDLMEKSFDVNFKAHLWMYKAFLPAMIANNHGHLVCISSSAGLIGVNGLSDYCASKFAALGFAESMFIETLAKKQWGIKTTIVCPFFIKTGMFEGCTTKCPTLLPILDPEYAVRKIIDAILQEQLYLYMPKFLYFIVFLKSILPIK 284          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Mouse
Match: Hsd17b11 (hydroxysteroid (17-beta) dehydrogenase 11 [Source:MGI Symbol;Acc:MGI:2149821])

HSP 1 Score: 147.902 bits (372), Expect = 2.551e-41
Identity = 98/273 (35.90%), Postives = 155/273 (56.78%), Query Frame = 1
Query:   85 SIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKK--YQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLL 897
            SI ++ K FIPKK   KSV  ++VLITGAG+G+G   A +FAK   +LVLW+ + + ++    +C+K   Q+  FV    VD S R +I +AA  VK +VG V I++NNAGV +T+ +   ++  I KT  VN L+  W  ++FL  M   N GH+V+++S  G   V  L  YC SKFA  GF  +L  E+ +  ++G+    + P  + T   +N   +  +  +LE E V   +   ILT   ++++P  +  L +L+ ++P + FL +L
Sbjct:   18 SIESLVKLFIPKK--KKSVAGEIVLITGAGHGIGRLTAYEFAKLNTKLVLWDINKNGIEETAAKCRKLGAQAHPFV----VDCSQREEIYSAAKKVKEEVGDVSILVNNAGVVYTADLFATQDPQIEKTFEVNVLAHFWTTKAFLPVMMKNNHGHIVTVASAAGHTVVPFLLAYCSSKFAAVGFHRALTDELAALGRTGVRTSCLCPNFINTGFIKNPSTN--LGPTLEPEEVVEHLMHGILTEKQMIFVPSSIALLTVLERIVPER-FLQVL 281          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Mouse
Match: Sdr16c6 (short chain dehydrogenase/reductase family 16C, member 6 [Source:MGI Symbol;Acc:MGI:2685269])

HSP 1 Score: 144.05 bits (362), Expect = 1.177e-39
Identity = 104/264 (39.39%), Postives = 146/264 (55.30%), Query Frame = 1
Query:  112 IPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECK--KYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFD-CPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCL 894
            IPK+   K V+ ++VLITGAG+GLG  LAI FA     LVLW+ + +     ++ C+  K + D+ V   + D S+R ++   AD VK +VG V I+INNAGV    S     ++ + K+  VN +S  W  ++FL  M   N GH+V ISS  GLVG+  L+DY  SKFA  GF ESL  E+    K+ +    V P+ +KT MF+        +L  LE EYVA KI  AIL     L +PK  +  + LK ++  K  + L
Sbjct:   27 IPKR--KKDVSGEIVLITGAGSGLGRLLAIHFASHGATLVLWDINQEG---NMETCRLVKQKGDVKVFAYKCDCSSRIEVYRVADQVKEEVGDVTILINNAGVVTGKSFLNTPDHLVEKSFLVNAISHFWTCKAFLPAMVKANHGHLVCISSIAGLVGINGLSDYSSSKFAAFGFAESLFLELTMIMKTKVKSTIVCPYFIKTGMFEGCTTKYPLLLPLLEQEYVAQKIFNAILEEQVYLIIPKFAYVALFLKQIISPKMMIAL 285          
BLAST of Epidermal retinol dehydrogenase 2 vs. UniProt/SwissProt
Match: sp|Q8VCR2|DHB13_MOUSE (17-beta-hydroxysteroid dehydrogenase 13 OS=Mus musculus OX=10090 GN=Hsd17b13 PE=1 SV=2)

HSP 1 Score: 166.392 bits (420), Expect = 1.444e-47
Identity = 99/274 (36.13%), Postives = 162/274 (59.12%), Query Frame = 1
Query:   40 FVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILK 861
             ++  L ++G+II++ + ++ KFFIP++   KSV  + VLITGAG+G+G   A +FAKQ+ RLVLW+ +   ++   D+C+K  + + V    VD SNR++I N+ D VK +VG V+I++NNAG  + + +   ++  I KT  VN L   WI+++ L  M  RNSGH+V+++S  G   +  L  YC SKFA  GF  +L  E+ +  K+G+    + P  + T   +N      +   LE E VA  +   ILTN  ++++P  ++  +IL+
Sbjct:    3 LILEFLLLVGVIIYSYLESLVKFFIPRR--RKSVTGQTVLITGAGHGIGRLTAYEFAKQKSRLVLWDINKRGVEETADKCRKLGAVVHVF--VVDCSNRAEIYNSVDQVKREVGDVEIVVNNAGAIYPADLLSAKDEEITKTFEVNILGHFWIIKALLPSMLRRNSGHIVTVASVCGHGVIPYLIPYCSSKFAAVGFHRALTAELDTLGKTGIQTSCLCPVFVNTGFTKNPSTR--LWPVLEPEEVARSLINGILTNKKMIFVPSYINISLILE 270          
BLAST of Epidermal retinol dehydrogenase 2 vs. UniProt/SwissProt
Match: sp|Q7TQA3|RDHE2_MOUSE (Epidermal retinol dehydrogenase 2 OS=Mus musculus OX=10090 GN=Sdr16c5 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.134e-46
Identity = 101/253 (39.92%), Postives = 149/253 (58.89%), Query Frame = 1
Query:  133 KSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQV---DISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTK 879
            K+V  ++VLITGAG+GLG  LA++FA+    LVLW+ + ++     DE  +   +     +     D S R ++   AD VK +VG V I+INNAG+    +  +  ++ + K+ +VN  + +W+ ++FL  M + N GH+V ISS  GL+GV  L+DYC SKFA  GF ES+  E  + K+ G+    V PF +KT MF+     CP +L  L+ EY   KI +AIL     LY+PK L+F+V LK +LP K
Sbjct:   36 KNVAGEIVLITGAGSGLGRLLALQFARLGAVLVLWDVNKEA----NDETHQLAREAGAARVHAYTCDCSRREEVYRVADQVKKEVGDVSILINNAGIVTGRNFLDCPDDLMEKSFDVNFKAHLWMYKAFLPAMIANNHGHLVCISSSAGLIGVNGLSDYCASKFAALGFAESMFIETLAKKQWGIKTTIVCPFFIKTGMFEGCTTKCPTLLPILDPEYAVRKIIDAILQEQLYLYMPKFLYFIVFLKSILPIK 284          
BLAST of Epidermal retinol dehydrogenase 2 vs. UniProt/SwissProt
Match: sp|Q8N3Y7|RDHE2_HUMAN (Epidermal retinol dehydrogenase 2 OS=Homo sapiens OX=9606 GN=SDR16C5 PE=1 SV=2)

HSP 1 Score: 160.999 bits (406), Expect = 1.858e-45
Identity = 108/284 (38.03%), Postives = 158/284 (55.63%), Query Frame = 1
Query:   64 IGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECK--KYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVL 906
            +G  +F+ +  +    +PK    K+V  ++VLITGAG+GLG  LA++FA+    LVLW+ + +  +   + CK  +      V     D S +  +   AD VK +VG V I+INNAG+       +  +  + K+ +VN  + +W  ++FL  M + + GH+V ISS  GL GV  LADYC SKFA  GF ES+  E +  K+ G+    V PF +KT MF+     CP +L  LE +Y   KI EAIL     LY+PKLL+F++ LK  LP K  L + + L
Sbjct:   15 LGKSLFSLLEAMIFALLPK--PRKNVAGEIVLITGAGSGLGRLLALQFARLGSVLVLWDINKEGNE---ETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVSILINNAGIVTGKKFLDCPDELMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAGLSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKTGMFEGCTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYL 293          
BLAST of Epidermal retinol dehydrogenase 2 vs. UniProt/SwissProt
Match: sp|Q5NVG2|DHB11_PONAB (Estradiol 17-beta-dehydrogenase 11 OS=Pongo abelii OX=9601 GN=HSD17B11 PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 6.666e-43
Identity = 99/274 (36.13%), Postives = 155/274 (56.57%), Query Frame = 1
Query:   76 IFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLL 897
            I  S+ +  K FIPK+   KSV  ++VLITGAG+G+G   A +FAK + +LVLW+ +   L+    +CK   + +      VD SNR  I +AA  VK ++G V I++NNAGV +TS +   ++  I KT  VN L+  W  ++FL  M   N GH+V+++S  G V V  L  YC SKFA  GF ++L  E+ + + +G+    + P  + T   +N      +  +LE E V +++   ILT   ++++P  + FL  L+ +LP + FL +L
Sbjct:   15 IVCSLESFVKLFIPKR--RKSVTGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLGAKVHTF--VVDCSNREDIYSAAKKVKAEIGDVSILVNNAGVVYTSDLFATQDPQIEKTFEVNVLAHFWTTKAFLPAMMKNNHGHIVTVASAAGHVSVPFLLAYCSSKFAAVGFHKTLTDELAALQITGVKTTCLCPNFVNTGFIKNP--STSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPER-FLAVL 281          
BLAST of Epidermal retinol dehydrogenase 2 vs. UniProt/SwissProt
Match: sp|A5PJJ7|S16C6_BOVIN (Short-chain dehydrogenase/reductase family 16C member 6 OS=Bos taurus OX=9913 GN=SDR16C6 PE=2 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.813e-42
Identity = 101/261 (38.70%), Postives = 142/261 (54.41%), Query Frame = 1
Query:  139 VNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLW----ETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVL 906
            V  ++VLITGA +GLG  LAIKFA     LVLW    E ++++ +II     K + D  V     D SNR  +   AD VK +VG V I+INNAGV       +  ++ + ++  VN +S  W  ++FL  M   N GH+V ISSF G+VG+ +L+DYC SKFA  GF ESL  E+   +KS ++   V P+ +KT MF+      P +L  L  EY A  I  AIL     L +P+  H  + LK ++ T   + +   L
Sbjct:   34 VTGEIVLITGAASGLGRLLAIKFASLGAILVLWDINEEGNMETCRII-----KEERDAKVFAYTCDCSNRQDVYRVADQVKKEVGNVTILINNAGVVTGREFLKTPDHMVERSFLVNVMSHFWTYKAFLPAMLEANHGHLVCISSFAGIVGINELSDYCASKFAAYGFAESLHFELKLLQKSKINTTIVCPYFIKTGMFEGCSTKYPLLLPMLTQEYAAQSILNAILEEQLYLIMPRFSHVALFLKQIISTNMMMTMAEYL 289          
BLAST of Epidermal retinol dehydrogenase 2 vs. TrEMBL
Match: A0A1S3H788 (epidermal retinol dehydrogenase 2 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106152058 PE=3 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 5.240e-55
Identity = 107/264 (40.53%), Postives = 161/264 (60.98%), Query Frame = 1
Query:  106 FFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCL 894
             FIP  + MK +    VL+TGAG+G+G  +AIKFAK+  +LVLW+ +  +++    E KKY   +F    + D+S R +I   A+ VK     V I++NNAG+       +  +N I KT+ VN ++  W V++FL  M  +N GH+VSI+S  GLVGV  LADYC SKFA  GF ESL +E+ +  K G+H   V P+++ T MF+  K   P +L  +  +Y AS+I +A+L N  ++Y+P++L+F + LK ++P K  L L
Sbjct:   30 LFIPWSWRMKDITEDTVLVTGAGSGIGRLMAIKFAKKGAKLVLWDINETAIEETATEIKKYGGRVFTY--KCDLSKRDEIYTVAEKVKQDGLDVTILVNNAGIVTGKKYLDCPDNMIEKTMAVNSMAHFWTVKAFLPSMLRKNHGHIVSIASSAGLVGVTGLADYCASKFAAVGFDESLKYELNAMGKDGVHTTVVCPYYINTGMFEGVKTRFPKVLPIVNQDYAASRIVDAVLINQEIVYIPRVLYFFLALKGLIPVKVGLLL 291          
BLAST of Epidermal retinol dehydrogenase 2 vs. TrEMBL
Match: A0A0K0EGM3 (Uncharacterized protein OS=Strongyloides stercoralis OX=6248 PE=3 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 5.756e-55
Identity = 121/305 (39.67%), Postives = 176/305 (57.70%), Query Frame = 1
Query:   13 ISLIMKYLIFVINILKVIGLIIFTSIGNIFKFFIPKKY-AMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSD--LFVLGIQ-----VDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLN 900
            I++I+ +L+  ++ LK+  + I+  +    K  +P K    KSV N++VLITGA +G+G  +AI+F K + ++V+W+         IDE K  ++   L   G+Q     VD+S + QI  AA+ VKT+VG VDI+INNAG+       E E+  +  T++VN +S  +  ++FL  M +RN GH+VSI+S  G  G+  L DYC SKF   GF E+L  E+ S KK  +HV TV P+++ TKMF       P +L  L+ EY   KI EAILTN   LYLP+  +   IL  +LP K    L N
Sbjct:   12 ITVILTFLVNFVDTLKIFAIFIYYWLEGCLKVILPSKLLTKKSVKNEIVLITGASSGIGKLMAIEFGKLKSKIVIWD---------IDEKKANETTNLLKNKGVQCWFYKVDVSKKEQIYEAAEKVKTEVGDVDILINNAGIVTGKKFFECEDQLMELTMSVNVISHFFTTKAFLPSMLNRNHGHIVSIASLAGKFGITGLVDYCASKFGAVGFSEALSEELLSLKKDNVHVTTVCPYYIDTKMFDGVVTKAPNVLPILKPEYAVDKIMEAILTNTEYLYLPRFAYLANILNSILPVKAMRVLTN 307          
BLAST of Epidermal retinol dehydrogenase 2 vs. TrEMBL
Match: A0A1S3H680 (epidermal retinol dehydrogenase 2 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106152058 PE=3 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 2.936e-54
Identity = 105/256 (41.02%), Postives = 158/256 (61.72%), Query Frame = 1
Query:  109 FIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLP 873
            FIP  + MK +    VL+TGAG+G+G  +AIKFAK+  +LVLW+ +  +++    E KKY   +F    + D+S R +I   A+ VK     V I++NNAG+       +  +N I KT+ VN ++  W V++FL  M  +N GH+VSI+S  GLVGV  LADYC SKFA  GF ESL +E+ +  K G+H   V P+++ T MF+  K   P +L  +  +Y AS+I +A+L N  ++Y+P++L+F + LK +LP
Sbjct:   31 FIPWSWRMKDITEDTVLVTGAGSGIGRLMAIKFAKKGAKLVLWDINETAIEETATEIKKYGGRVFTY--KCDLSKRDEIYTVAEKVKQDGLDVTILVNNAGIVTGKKYLDCPDNMIEKTMAVNSMAHFWTVKAFLPSMLRKNHGHIVSIASSAGLVGVTGLADYCASKFAAVGFDESLKYELNAMGKDGVHTTVVCPYYINTGMFEGVKTRFPKVLPIVNQDYAASRIVDAVLINQEIVYIPRVLYFFLALKGLLP 284          
BLAST of Epidermal retinol dehydrogenase 2 vs. TrEMBL
Match: A8E7S3 (Short chain dehydrogenase/reductase family 16C, member 5a OS=Danio rerio OX=7955 GN=sdr16c5a PE=1 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 4.348e-53
Identity = 112/280 (40.00%), Postives = 168/280 (60.00%), Query Frame = 1
Query:   43 VINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKS-LEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTK 879
            ++  L++I L ++ ++    KFFIP +   K V+ ++VLITG+G+G+G  +A++FA     LVLW+ ++D LK   ++ K+  +   V   Q D S+R  +   AD VK+++G V I+INNAG+       +  +  I KTL VN +S  W  ++FL  M  +N GH+VS++S  GL+GV  LADYC SKFA  GF ES+  E+ SA K G+    V PF + T +F       P+L   LE +YVA +I  AILT+   + LP+ L+FL+ LK V+P K
Sbjct:    4 LLETLRLIFLTVYYNLEAFLKFFIPLR--KKDVSGEIVLITGSGSGIGRLMALEFASLDVSLVLWDINVDGLKETAEQVKEKGASR-VHYYQCDCSDREAVYRVADQVKSEIGDVTILINNAGIVSGKKFMDTPDALIEKTLRVNAMSHFWTYKAFLPAMMDKNHGHLVSVASSAGLIGVNGLADYCASKFAAVGFAESVALELLSAGKDGIKTTIVCPFLINTGLFDGCGTKWPLLMPMLEPDYVAKRIVSAILTDQVFVLLPRSLYFLMALKGVIPYK 280          
BLAST of Epidermal retinol dehydrogenase 2 vs. TrEMBL
Match: A0A2R8QN16 (Short chain dehydrogenase/reductase family 16C, member 5a OS=Danio rerio OX=7955 GN=sdr16c5a PE=1 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 4.610e-53
Identity = 112/280 (40.00%), Postives = 168/280 (60.00%), Query Frame = 1
Query:   43 VINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKS-LEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTK 879
            ++  L++I L ++ ++    KFFIP +   K V+ ++VLITG+G+G+G  +A++FA     LVLW+ ++D LK   ++ K+  +   V   Q D S+R  +   AD VK+++G V I+INNAG+       +  +  I KTL VN +S  W  ++FL  M  +N GH+VS++S  GL+GV  LADYC SKFA  GF ES+  E+ SA K G+    V PF + T +F       P+L   LE +YVA +I  AILT+   + LP+ L+FL+ LK V+P K
Sbjct:   15 LLETLRLIFLTVYYNLEAFLKFFIPLR--KKDVSGEIVLITGSGSGIGRLMALEFASLDVSLVLWDINVDGLKETAEQVKEKGASR-VHYYQCDCSDREAVYRVADQVKSEIGDVTILINNAGIVSGKKFMDTPDALIEKTLRVNAMSHFWTYKAFLPAMMDKNHGHLVSVASSAGLIGVNGLADYCASKFAAVGFAESVALELLSAGKDGIKTTIVCPFLINTGLFDGCGTKWPLLMPMLEPDYVAKRIVSAILTDQVFVLLPRSLYFLMALKGVIPYK 291          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Cavefish
Match: sdr16c5a (epidermal retinol dehydrogenase 2-like [Source:NCBI gene;Acc:103046429])

HSP 1 Score: 171.4 bits (433), Expect = 2.450e-50
Identity = 105/281 (37.37%), Postives = 165/281 (58.72%), Query Frame = 1
Query:   40 FVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTK 879
            F++  L++I   I+  +  + K FIP +   KS+  + VLITGAG+G+G  LA++FA     +VLW+ +++ LK      K+  +   V   + D S+R+++   AD VK +VG V I++NNAG+       +  ++ I KT  +N ++  W  ++FL  M  +N GH+VS++S  GL+GV  LADYC SKF   GF ES+  E+ ++ K G+    V PF + T MF       P +L +L+ EYVA KI  AI T+ T LYLP+ ++ L+ +K ++P K
Sbjct:    3 FLVETLRLIVFSIYYLLEALVKMFIPIR---KSIAGETVLITGAGSGIGRLLAVEFAGMDVTVVLWDINVEGLKETARAMKEKGASR-VHYYRTDCSDRAEVYRVADQVKREVGDVTILVNNAGIVTGKKFMDSPDSLIEKTFQINTMAHFWTYKAFLPAMTEKNHGHLVSVASSAGLIGVNGLADYCSSKFGAVGFAESVALELVASGKDGIKTTIVCPFFIDTGMFDGCGTKWPRLLPALKPEYVAKKIVNAIQTDQTYLYLPRAIYALMFVKNLVPFK 279          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Cavefish
Match: sdr16c5b (short chain dehydrogenase/reductase family 16C member 5 [Source:NCBI gene;Acc:103045570])

HSP 1 Score: 165.236 bits (417), Expect = 5.494e-48
Identity = 104/284 (36.62%), Postives = 165/284 (58.10%), Query Frame = 1
Query:   76 IFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLW----ETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLLG 912
            ++ S+  +++  +P +   KSV  + VL+TGAG+GLG  +A++FA+   RLVLW    E ++++ +II  E    ++  +      D S R ++   AD VK +VG V I+INNAG+       +  ++ ++KT++VN  +  W  ++FL  M + N GH+VSI+S  GLVGV  LADYC SKFA  GF ES+  E+ ++   G+    V PF + T MF+      P ++  LE EYV  KI +A+  +   L LP+ ++ +V LK++LP K     + V+LG
Sbjct:   15 LWFSLEALWRALVPAR--RKSVAGETVLLTGAGSGLGRLMALEFARLGARLVLWDIYEEGNLETARII-KETHNVRAHTYT----CDCSKREEVYKVADQVKREVGDVTILINNAGIVTGKKFLQCPDSLMQKTMDVNSTAHFWTYKAFLPAMIAGNHGHLVSIASSAGLVGVNGLADYCASKFAAIGFAESVGLELLASGSDGVKTTIVCPFFINTGMFEGANTKFPRLMPILEPEYVCKKIMDAVRRDQVYLCLPRFMYLIVALKHILPAK-----MGVMLG 286          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Cavefish
Match: sdr16c5a (epidermal retinol dehydrogenase 2-like [Source:NCBI gene;Acc:103046429])

HSP 1 Score: 146.362 bits (368), Expect = 5.668e-41
Identity = 98/281 (34.88%), Postives = 154/281 (54.80%), Query Frame = 1
Query:   40 FVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTK 879
            F++  L++I   I+  +  + K FIP +   KS+  + VLITGAG+G+G  LA++FA     +VLW+ +++ LK      K+  +   V   + D S+R+++   AD VK +VG V I++NNAG+       +  ++ I KT  +N ++  W  ++FL                  GL+GV  LADYC SKF   GF ES+  E+ ++ K G+    V PF + T MF       P +L +L+ EYVA KI  AI T+ T LYLP+ ++ L+ +K ++P K
Sbjct:    3 FLVETLRLIVFSIYYLLEALVKMFIPIR---KSIAGETVLITGAGSGIGRLLAVEFAGMDVTVVLWDINVEGLKETARAMKEKGASR-VHYYRTDCSDRAEVYRVADQVKREVGDVTILVNNAGIVTGKKFMDSPDSLIEKTFQINTMAHFWTYKAFLS----------------AGLIGVNGLADYCSSKFGAVGFAESVALELVASGKDGIKTTIVCPFFIDTGMFDGCGTKWPRLLPALKPEYVAKKIVNAIQTDQTYLYLPRAIYALMFVKNLVPFK 263          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Cavefish
Match: rdh10b (retinol dehydrogenase 10-B [Source:NCBI gene;Acc:103023718])

HSP 1 Score: 141.354 bits (355), Expect = 1.231e-38
Identity = 92/283 (32.51%), Postives = 145/283 (51.24%), Query Frame = 1
Query:  133 KSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLW----ETDIDSLKIIID-----ECKKYQSDLFVLGIQ-------------VDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFD---CPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVL 906
            K V  +V ++TGAG+GLG   A +FA++R  LVLW    E + ++ +++ D     E ++   D    G++              D+S R  + + A+ V+ +VG V  +INNAGV     + E  +  I +T+ VN  +  W  ++FL  M   N GH+V+++S  GL     + DYC SKF   GF ESL HE+ +A K G+ +  V PF + T MFQ  K      P    L+ EY   +   AILTN  ++  P+ ++ +  +K +LP    +C+   L
Sbjct:   32 KRVAGQVCVVTGAGSGLGRLFATEFARRRATLVLWDINREANEETAELVRDIYRETEPRRGSGD----GVEDVPFYQPRVYTYVCDVSKRESVYSTAEKVRQEVGNVTFLINNAGVVSGHHLLECPDELIERTMMVNCHAHFWTTKAFLPKMLDLNHGHIVTVASSLGLFTTAGVEDYCASKFGAIGFHESLSHELKAANKDGIKMTLVCPFLVDTGMFQGCKIRKEIAPFFPPLKPEYCVEQAMRAILTNQPMVCTPRAMYVVNFMKTILPFDAIVCMYRFL 310          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Cavefish
Match: rdh10a (retinol dehydrogenase 10-A [Source:NCBI gene;Acc:103034859])

HSP 1 Score: 140.198 bits (352), Expect = 3.682e-38
Identity = 90/286 (31.47%), Postives = 145/286 (50.70%), Query Frame = 1
Query:  115 PKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLW-------------------ETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDC---PILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVL 906
            PK+   KSV  +V +ITGAG  LG   A +FA++R  LVLW                   E D  +     +E   +Q  ++      D+  R  + + A+ V+ +VG VD++INNAGV     + E  +  I +T+ VN  +  W  ++FL  M   N GH+V+++S  GL     + DYC SKF   GF ESL HEI +++K G+ +  V P+ + T MF+  +      P L  L  E+   +   AILT+  ++  P++++ +  +K +LP +  +C+   L
Sbjct:   30 PKE---KSVCGQVCVITGAGGELGRLFAREFARRRATLVLWDINSTSNEETAEMVREIYRELDTQTEGPGSEEGSTFQPQVYTY--VCDVGKRESVYSTAERVRREVGEVDLLINNAGVVSGHHLLECPDELIERTMVVNCHAHFWTTKAFLPKMLEMNHGHIVTVASSLGLFSTAGVEDYCASKFGAIGFHESLSHEIKASEKDGIKMTLVCPYLVDTGMFRGCRIRKEIEPFLPPLRPEFCVKQAMRAILTDQPMVCTPRIVYMVNFMKSILPFEAIVCMYRFL 310          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Sea Lamprey
Match: si:dkey-221h15.4 (si:dkey-221h15.4 [Source:ZFIN;Acc:ZDB-GENE-041014-340])

HSP 1 Score: 148.673 bits (374), Expect = 3.073e-42
Identity = 100/299 (33.44%), Postives = 166/299 (55.52%), Query Frame = 1
Query:   40 FVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWE----TDIDSLKIIIDECKKYQSD---LFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLLG 912
            F++  L V+ L +   +  +F+  +P +   KSV  +VVL+TGAG+GLG  +A+  A+    LV+W+     + ++ ++I +E    + +     V    VD S R  +   AD+V   VG +DI++NNAG+       +  +  ++KT++VN ++  W  ++FL  M + + GH+VSI+S  GL+GV  LADYC SKFA  GF ES+  E+ +  K G+    V P+ + T MF       P ++  L+  Y ++KI +AIL     L +P+ ++ ++ LK ++P K     L VLLG
Sbjct:    7 FLLETLMVMVLSVVYWLECLFRCVVPPRR--KSVAGQVVLVTGAGSGLGRLVALSLARLGATLVIWDVNRAANEETAQLIREEGDGVEGNGRKPSVHAYSVDCSRRDDVYRVADLVMRDVGDIDILVNNAGIVTGRKFIDSPDELLQKTMDVNIMAHFWTYKAFLPAMVANDHGHLVSIASSAGLIGVNGLADYCASKFAAVGFAESVALEMLALGKFGVKTTIVCPYFINTGMFNGCVTKWPRLMPILDQHYASNKIVDAILREQVQLVMPRSIYGMMALKNIIPVK-----LGVLLG 298          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Sea Lamprey
Match: dhrs7b (dehydrogenase/reductase (SDR family) member 7B [Source:NCBI gene;Acc:550454])

HSP 1 Score: 76.6406 bits (187), Expect = 6.297e-16
Identity = 61/206 (29.61%), Postives = 107/206 (51.94%), Query Frame = 1
Query:  142 NNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLG--------IQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAF--TSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQN 729
            + KVV++TGA +GLG A A  F  +  RLVL   D+  L+ + DE  +    L   G        +  D+ +  ++  AA++V    G VD++++ AG+++   +++T M+ +  R+ + VN    I ++ + L  M  +  GH+V+ISS  G + +   + Y  SK A   + +SL  E+     SGL V  V P +++T +  N
Sbjct:   54 HGKVVVVTGASSGLGLACARAFHAEGARLVLCGRDLRRLESLRDELSERVRILAPQGPEDRTPRVVPFDLGSPGEVARAAELVVAAHGRVDVLVSGAGISYRGEAALTAMDVH--RQLMEVNYFGAIALLTALLPSMLKQGEGHIVAISSVQGRIAIPFRSAYAASKHATQAYFDSLRAEV---ADSGLKVTVVSPGYIRTNLSLN 254          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010315.1 (pep scaffold:Pmarinus_7.0:GL479994:4152:14615:1 gene:ENSPMAG00000009341.1 transcript:ENSPMAT00000010315.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 6.910e-10
Identity = 72/271 (26.57%), Postives = 119/271 (43.91%), Query Frame = 1
Query:  139 VNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKK----YQSDLFVLGIQV-DISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNS--GHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQN-----------------YKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTK 879
            +   VV +TGA +G+G ALA + A+  C+LVL       L+ +   C +     +SD+ VL + V D+S       A   V  + G VD+++NNAG +  S   + +    R    +N L+ + + +  L  M +  S  G ++++SS  GL GV   A YC SK AV G   +L  E+    +  + + TV P  +++ +  N                 YK        L    +A+++ EA +     L    L  +   L + L  K
Sbjct:   48 LRGHVVWVTGASSGIGEALARELARCGCQLVLSARREAELQRVRKNCLEDSSLKESDILVLPMDVLDLSTHEACTKA---VLDRFGRVDVLVNNAGRSQRSLFMDTDLCVYRTLFELNVLAPVSLARCVLPGMMAPGSHGGILLAVSSIAGLAGVPLSAGYCASKHAVQGAFNALRSELDEYPQ--ITISTVCPGPVQSHIISNAFSGKGDEAVGEQKDQTYKMSAERCARLIAVSLAARLPEAWIAQQPYLSAAYLWQYAPTLAWRLTAK 313          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Sea Lamprey
Match: bdh2 (3-hydroxybutyrate dehydrogenase, type 2 [Source:NCBI gene;Acc:550507])

HSP 1 Score: 56.225 bits (134), Expect = 2.227e-9
Identity = 52/203 (25.62%), Postives = 105/203 (51.72%), Query Frame = 1
Query:  130 MKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQV---DISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSF-TGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQ 726
            M  ++ KVV++T AG G+G A AI FAK+  +++  + + ++LK +            + GI+V   +++++ QI    + +  K+  VD++ N AG     +I + E+ +   T+N+N     +++++FL  M ++ SG +++++S  + + GV     Y  SK A+ G  +S+  +  +    G+    V P  + T   Q
Sbjct:    1 MGRLDGKVVVLTAAGQGIGRACAIAFAKEGAKVIATDINGEALKELEQ----------IPGIEVGVLNVTSKDQI----EALAAKIDKVDVLFNCAGFVHHGTILDCEDKDWDFTMNLNVKGMYYMIRAFLPKMLAQKSGSIINMASVASSIKGVANRCVYSTSKAAIIGLTKSVAADFLT---EGIRCNAVCPGTVDTPSLQ 186          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Sea Lamprey
Match: zgc:56585 (zgc:56585 [Source:ZFIN;Acc:ZDB-GENE-040426-1084])

HSP 1 Score: 51.9878 bits (123), Expect = 4.332e-8
Identity = 49/195 (25.13%), Postives = 86/195 (44.10%), Query Frame = 1
Query:  313 IQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQS-FLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKM------------FQNYK-------FDCPILKSLE-VEYVASKIEEAILTNATVLYLPK 834
            +Q D+++ +++ +A +  K+  G +DI+INNAG+          E    KT N+N    + +V+S +L        G V++I+S  GL  +     YC SK  V GF  ++       +  G+ V  V P ++ T +            F++ +        D PI++    VE V   +E+  L    +   PK
Sbjct:   32 LQCDVTSATELQDAFNKTKSHFGAIDIVINNAGI--------NNEAEWEKTFNIN---LVAVVRSTYLALEILSKGGVVINIASMAGLGVIPYAPVYCASKHGVVGFSRAIAGAC-ELQGRGVRVCCVCPTYVDTPLLSTVGRADTMGQFEDLREGLVKTLMDTPIMQPCSVVEGVIRLLEDDSLNGTVMSVTPK 214          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Yeast
Match: YDL114W_mRNA (Putative short-chain dehydrogenase/reductase; YDL114W is not an essential gene [Source:SGD;Acc:S000002272])

HSP 1 Score: 60.4622 bits (145), Expect = 6.909e-11
Identity = 49/169 (28.99%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  316 QVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYS----AKKSGLHVLTVYPFHMKTKMFQNYKFDCPIL-KSLEVEYVASKIEEAILT 807
            Q DI++  +I N    ++   G ++IIINNAGVA    +  M    + + +++N +    I+ +F +DM     G +++I+S  G +   +L  Y  SK A+ GF + +     S      K+G+  L V P  +KT MF     D P   K L  + + S++  AI++
Sbjct:   88 QCDITSLDEIKNLKKAIERDHGNINIIINNAGVAHIKKLEHMTNKEVEQLIDINLIGAYRIISTFAEDMIDNREGFIINIASVLGELTPARLTSYGASKGAMIGFHKCMSRHFRSLSTECNKTGIKTLLVCPGKIKTNMF----IDVPTPSKLLAPDIIPSQLALAIIS 252          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Yeast
Match: YMR226C (NADP(+)-dependent serine dehydrogenase and carbonyl reductase; acts on serine, L-allo-threonine, and other 3-hydroxy acids; green fluorescent protein fusion protein localizes to the cytoplasm and nucleus; may interact with ribosomes, based on co-purification experiments [Source:SGD;Acc:S000004839])

HSP 1 Score: 57.3806 bits (137), Expect = 5.425e-10
Identity = 39/135 (28.89%), Postives = 71/135 (52.59%), Query Frame = 1
Query:  316 QVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSS-ITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTK 717
            Q+DI+   +I    + +  +   +DI++NNAG A  S  + ++   +I+   + N  + I I Q+ L    ++NSG +V++ S  G       + YC SKFAV  F +SL  E+ + K   + V+ + P  ++T+
Sbjct:   73 QLDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVGQIATEDIQDVFDTNVTALINITQAVLPIFQAKNSGDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKELINTK---IRVILIAPGLVETE 204          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Yeast
Match: FOX2 (3-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydratase; multifunctional enzyme of the peroxisomal fatty acid beta-oxidation pathway; mutation is functionally complemented by human HSD17B4 [Source:SGD;Acc:S000001717])

HSP 1 Score: 49.2914 bits (116), Expect = 7.299e-7
Identity = 60/223 (26.91%), Postives = 107/223 (47.98%), Query Frame = 1
Query:  136 SVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWE---------TDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYV 777
            S  ++VV+ITGAG GLG   A+ +A +  ++V+ +          +  +  +++DE KK    + V        N  +II  A  +K + G VD++INNAG+    S  +M E      ++V+      + ++    M S+  G +++ +S  GL G    A+Y  +K  + G  E+L  E     K  ++V ++ P   +++M +N      ILK L  E +
Sbjct:    6 SFKDRVVVITGAGGGLGKVYALAYASRGAKVVVNDLGGTLGGSGHNSKAADLVVDEIKK-AGGIAVANYDSVNENGEKIIETA--IK-EFGRVDVLINNAGILRDVSFAKMTEREFASVVDVHLTGGYKLSRAAWPYMRSQKFGRIINTASPAGLFGNFGQANYSAAKMGLVGLAETLAKE---GAKYNINVNSIAPL-ARSRMTENV-LPPHILKQLGPEKI 219          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Nematostella
Match: EDO31056 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ09])

HSP 1 Score: 170.244 bits (430), Expect = 2.618e-50
Identity = 100/267 (37.45%), Postives = 159/267 (59.55%), Query Frame = 1
Query:  103 KFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKS-LEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLN 900
            + F+P     KS+ +++VLITGAG+G+G  +AI+FAK   ++V  + +  +    ++  K      F  G + D S+R  I   AD+VK +VG V I++NNAG+       + E+  I+KT+ VN ++  W V+SFL  M ++N GHVV+I+S  G  GV  + DYC SKF   GF ESL  E+ S  K+G+    V P+++ T MF   K   P+L   L+ ++V  +I +A+L N  VL LPK+L F +++K+++P+  ++ L N
Sbjct:   25 RLFVP--VPRKSIQDEIVLITGAGSGIGKGMAIEFAKIGAKIVCVDINKQANDQTVEVIKSLNQKAF--GYKCDCSSREDIYRVADIVKREVGEVTILVNNAGIVSGKKFLDTEDWMIQKTMEVNTMAHFWTVKSFLPSMLAKNHGHVVNIASSAGFFGVPGMCDYCSSKFGAVGFDESLRMELSSLGKTGVKTTVVCPYYINTGMFDGVKTRFPMLLPILDPDWVVKEIVDAVLRNKEVLILPKILSFFLVIKWIIPSSSYVLLAN 287          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Nematostella
Match: EDO41496 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4C5])

HSP 1 Score: 161.77 bits (408), Expect = 4.819e-47
Identity = 95/293 (32.42%), Postives = 160/293 (54.61%), Query Frame = 1
Query:   43 VINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKF---DCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLLG 912
            V++ +K++ ++++     + +F  P++   KS+  + VLITGA +G+G   A+  AK+ C+LVLW+ ++++LK +  E +   ++      + D+  + ++   A+ V+ + G V I+INNAGV          E+++ +T  VN L+ IW +Q F+  M  +N GH+VSI+S  G  G+    DYC SKFA  G  E+L  EI+   K G+   T+ P    T MF   K    + P L  L+ E+VA KI + I TN+  +++P +      L+ V+PT     L+  L G
Sbjct:    4 VVDFIKLLFVVVYQVFQALAQFVFPRR---KSLRGETVLITGAASGIGRLTALILAKKGCKLVLWDINLEALKAVAQEIQDLGAETHYF--ECDVRKKDEVEKVANAVEDQAGNVTILINNAGVVTGKKFLNCSESDVMRTFQVNSLAHIWTIQRFIPSMMEKNRGHIVSIASVAGYFGLVGCVDYCASKFAAVGLIEALRREIHGLGKMGIEFTTICPHFTATGMFAGVKLKYPNLPGLGELKPEFVAEKIVDGIETNSRTVFIPFMSRISYYLQTVIPTHSSDMLVRFLGG 291          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Nematostella
Match: EDO39789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S945])

HSP 1 Score: 130.954 bits (328), Expect = 1.082e-35
Identity = 85/248 (34.27%), Postives = 135/248 (54.44%), Query Frame = 1
Query:  127 AMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKM--FQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKY 864
            A K V  K+VLITG+G GLG  LA +FAK   RLVLW+ + D      +  +   ++  V     D ++R +I   A  VK +VG VDI++NNAG+     + +  +  I+K + +N L+  W  +SFL  M  +N GH+V+ISS +G        +YC SK+   GF ++L HE+Y+  K G+    V PF   T +  +   +F   + K LE  YVA +   AIL +   +++ +  +F +++K+
Sbjct:   30 ADKEVKGKIVLITGSGRGLGRLLAARFAKLGARLVLWDINEDLNHETAEVVEALGAE--VHSYACDCTSREEIYATASRVKGEVGDVDILVNNAGILHGKRLLDQTDAQIQKAIELNLLAHFWTSRSFLGRMLEQNQGHIVTISSVSGSFPTAFQVEYCASKYGAVGFHDALSHELYTLGKDGVKTTLVQPFFFDTGISWYPKMRFQ-KLHKVLEPSYVADQAMSAILKDMPSIFITRQWNFALVMKW 274          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Nematostella
Match: EDO26456 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBZ5])

HSP 1 Score: 122.865 bits (307), Expect = 4.510e-34
Identity = 60/144 (41.67%), Postives = 85/144 (59.03%), Query Frame = 1
Query:  304 VLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYK 735
              G + D S+R  I   AD+VK +VG V I++NNAG+       + E+  I+KT+ VN ++  W V+SFL  M ++N GHVV+I+S  G  GV  + DYC SKF   GF ESL  E+ S  K+G+    V P+++ T MF   K
Sbjct:    3 AFGYKCDCSSREDIYRVADIVKREVGEVTILVNNAGIVSGKKFLDTEDWMIQKTMEVNTMAHFWTVKSFLPSMLAKNHGHVVNIASSAGFFGVPGMCDYCSSKFGAVGFDESLRMELSSLGKTGVKTTVVCPYYINTGMFDGVK 146          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Nematostella
Match: EDO43519 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYH1])

HSP 1 Score: 70.8626 bits (172), Expect = 1.083e-14
Identity = 42/148 (28.38%), Postives = 79/148 (53.38%), Query Frame = 1
Query:  202 KFAKQRCRLVLWETDIDSLKIIIDECKKYQSD-LFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESL 642
            K  ++R R+     ++D    +   C+    D LF+   ++D+S+   +  A + +  + G +DI++NNAG++    +    ++ +++T N N    + + ++ +  M S +SGH+++ISS  G  G+     YC SKFAV G  ESL
Sbjct:   25 KDGEKRFRVYATMRNLDKKGSLESACQNALGDTLFIR--ELDVSSDDSVEEALNAIYEEEGRIDILVNNAGISHIGMLETQTQSLVKETFNTNFFGVLRMSKAVIPRMKSDHSGHIINISSTAGHTGMPFTGLYCASKFAVEGLSESL 170          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Medaka
Match: sdr16c5a (short chain dehydrogenase/reductase family 16C member 5 [Source:NCBI gene;Acc:101174946])

HSP 1 Score: 161.77 bits (408), Expect = 1.131e-46
Identity = 108/294 (36.73%), Postives = 170/294 (57.82%), Query Frame = 1
Query:   40 FVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSD--LFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLLG 912
            F +  ++V+ L I+ ++ +    F+P+K   K+++ +VVLITGAG+G+G  +A +FA     LVLW+ + D +K   +  +  QS+  + V     D S+++++   AD VK +VG V I++NNAG+       +  ++ I KT+ VN ++  W  ++FL  M + N GH+VSI+S  GL+GV  LADYC SKFA  GF ES+  E+ +  K G+    V P+ + T MF   +   P +L  L+  YV  +I  A+LT+   L LP+ ++ +  LK VLP K  L LL   LG
Sbjct:    3 FFLETIQVVLLSIWFNVESFIHLFVPRK--RKNISGEVVLITGAGSGIGRLMAQEFAALGTVLVLWDINKDGVK---ETARLAQSNGAIKVHHYLCDCSDKNEVYRVADQVKREVGDVSILVNNAGIVTGKKFIDAPDSLIEKTMEVNTMAHFWTYKAFLPAMIANNHGHLVSIASSAGLIGVNGLADYCASKFAAVGFAESVGLELLATGKDGVKTTIVCPYFINTGMFDGCQTKWPTVLPILDPHYVVKQILYAVLTDQVFLLLPRSMYLIAGLKNVLPVKQGL-LLGRYLG 290          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Medaka
Match: sdr16c5a (short chain dehydrogenase/reductase family 16C member 5 [Source:NCBI gene;Acc:101174946])

HSP 1 Score: 156.762 bits (395), Expect = 6.799e-45
Identity = 105/295 (35.59%), Postives = 169/295 (57.29%), Query Frame = 1
Query:   40 FVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSD--LFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCP-ILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLLGI 915
            F +  ++V+ L I+ ++ +    F+P+K   K+++ +VVLITGAG+G+G  +A +FA     LVLW+ + D +K   +  +  QS+  + V     D S+++++   AD VK +VG V I++NNAG+       +  ++ I KT+ VN ++  W  ++FL  M + N GH+VSI+S  GL+GV  LADYC SKFA  GF ES+  E+ +  K G+    V P+ + T MF   +   P +L  L+  YV  +I  A+LT+   L LP+ ++ +  LK +L       LL V LG+
Sbjct:    3 FFLETIQVVLLSIWFNVESFIHLFVPRK--RKNISGEVVLITGAGSGIGRLMAQEFAALGTVLVLWDINKDGVK---ETARLAQSNGAIKVHHYLCDCSDKNEVYRVADQVKREVGDVSILVNNAGIVTGKKFIDAPDSLIEKTMEVNTMAHFWTYKAFLPAMIANNHGHLVSIASSAGLIGVNGLADYCASKFAAVGFAESVGLELLATGKDGVKTTIVCPYFINTGMFDGCQTKWPTVLPILDPHYVVKQILYAVLTDQVFLLLPRSMYLIAGLKNILQWNVS-SLLGVYLGL 291          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Medaka
Match: rdh10a (retinol dehydrogenase 10 [Source:NCBI gene;Acc:101173817])

HSP 1 Score: 140.198 bits (352), Expect = 3.786e-38
Identity = 98/313 (31.31%), Postives = 163/313 (52.08%), Query Frame = 1
Query:   40 FVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDL--------FVLGIQ-------------VDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDC---PILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVL 906
            F + ILKV  +  F + G   K+ +P+K   KSV  +V +ITGAG+GLG   A +FA++   LVLW+ +  S +   +  ++   +L         V G++              D+  R  + + A+ V+ +VG VDI+INNAGV     + E  +  I +T+ VN  +  W  ++FL  M   N GH+V+++S  GL     + DYC SKF   GF ESL HEI  ++K G+ +  V P+ + T++F+  +      P L  L+ E+   +   AILT+  ++  P++++ +  +K +LP    +C+   L
Sbjct:    8 FFVVILKV--MWAFVAAGA--KWVVPRKE--KSVAGQVCVITGAGSGLGRLFAKEFARRGATLVLWDINSQSNEETAEMVRQIYKELDAPPLKAEAVGGVEEVPTFQPHVHTYVCDVGKRENVYSTAEQVRREVGEVDILINNAGVVSGHHLLECPDELIERTMVVNCHAHFWTTKAFLPKMLELNHGHIVTVASSLGLFSTAGVEDYCASKFGAIGFHESLSHEIQVSEKDGISMTLVCPYLVDTELFKGCRIRKEIEPFLPPLKPEFCVKQAMRAILTDQPMVCTPRIVYMVNFMKSILPFDAIVCMYRFL 314          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Medaka
Match: ENSORLT00000000762.2 (retinol dehydrogenase 10-A [Source:NCBI gene;Acc:101170667])

HSP 1 Score: 132.494 bits (332), Expect = 2.094e-35
Identity = 88/268 (32.84%), Postives = 140/268 (52.24%), Query Frame = 1
Query:   97 IFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFV--LGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKS-------LEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLP 873
            + +  +P +  +KSV  ++ LITGAG  LG   A++FAK+  +LVLW+ D  +     +   +   DL V      VD+S R  I  AAD V+ +VG V +++NNAGV     + +  +  + +TL VN  +  W+ ++FL  M +RN GH+V+I+S  GL     + DYC SKF   GF ESL  E+ +  + G+    V P+ +   MF      C I K        LE  Y   +  +AIL    ++ +P+L++   + + +LP
Sbjct:   38 VLQTLLPPR--LKSVEGELCLITGAGGALGRLFALEFAKEGAQLVLWDCDTAA----NEHTARLARDLGVKVHAYTVDLSKREHIYEAADRVRAEVGDVTMVVNNAGVVAGRRLLDCPDELLERTLLVNCHALFWMTKAFLPQMKARNHGHIVTIASALGLFTTSCVEDYCASKFGAVGFHESLALELQAENQGGIKTTLVCPYIVNNGMFAG----CEIRKELRSLIPPLEPLYTVQESMKAILGEQQMVCIPRLIYIPFLARVLLP 295          
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Medaka
Match: dhrs3b (dehydrogenase/reductase 3 [Source:NCBI gene;Acc:101159580])

HSP 1 Score: 131.339 bits (329), Expect = 4.268e-35
Identity = 93/251 (37.05%), Postives = 134/251 (53.39%), Query Frame = 1
Query:  133 KSVNNKVVLITXXXXXXXXXXXIKFAKQRCR-LVLWETDIDSLKIIIDE--CKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPIL-KSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLP 873
            K ++ +VVLITG G G+G  LA +FAKQ  + ++LW     +LK   +E      +S  F    Q D++N+ ++   A +V+ KVG V I++NNA V     +   ++N + KT +VN L Q W  ++FL  M     GHVV I+S      +  + DYC SK +   F ESL   +      G+   TV PFH  T+MFQ  +   P L   L+ E VA K  +A+ TN   +YLP  +H LVILK  +P
Sbjct:   50 KDLSKEVVLITGGGRGIGRHLAKEFAKQGAKKVILWGRTEKTLKETAEEIALSGTESHYF----QCDVANKEEVYKQAKLVREKVGDVTILVNNAAVVHGKGLMSSDDNALLKTQHVNTLGQFWTTKAFLPRMLELQHGHVVCINSILSQSPIPGVIDYCTSKASSLAFMESLTLGLLDC--PGVSCTTVLPFHTNTEMFQGMRIRFPQLFPPLKPEVVAQKTVDAVRTNKAFIYLPWTMHALVILKSFMP 294          
BLAST of Epidermal retinol dehydrogenase 2 vs. Planmine SMEST
Match: SMESG000018759.1 (SMESG000018759.1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 298/298 (100.00%), Postives = 298/298 (100.00%), Query Frame = 1
Query:   25 MKYLIFVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLLGIP 918
            MKYLIFVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITGAGNGLGAALAIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLLGIP
Sbjct:    1 MKYLIFVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITGAGNGLGAALAIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLLGIP 298          
BLAST of Epidermal retinol dehydrogenase 2 vs. Planmine SMEST
Match: SMESG000018759.1 (SMESG000018759.1)

HSP 1 Score: 509.605 bits (1311), Expect = 0.000e+0
Identity = 263/263 (100.00%), Postives = 263/263 (100.00%), Query Frame = 1
Query:  130 MKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLLGIP 918
            MKSVNNKVVLITGAGNGLGAALAIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLLGIP
Sbjct:    1 MKSVNNKVVLITGAGNGLGAALAIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVLLGIP 263          
BLAST of Epidermal retinol dehydrogenase 2 vs. Planmine SMEST
Match: SMESG000018758.1 (SMESG000018758.1)

HSP 1 Score: 288.886 bits (738), Expect = 3.598e-96
Identity = 146/294 (49.66%), Postives = 213/294 (72.45%), Query Frame = 1
Query:   25 MKYLIFVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVL 906
            M YL F IN+L  + L+++  I   FK F P K+ MK++NNK+VLITGAG+GLGAALA++FAK +CRL+LW+ + + L+   +EC+++QS+  +   +VDI+ R Q+++ AD +K+++GFVDI+INNAGV    SI E++E +I +T NVN +S  W +Q+FL +M SR+SGH+VSISS  G  G+ KL+DYC SKFA  G  ESLL EI S +KS + +LTV PF++ T MF     +CP+L  L++++V SK+E AILTN T+L +P++ +F+  LK++LPTK FL L  +L
Sbjct:    1 MVYLKFAINLLITLVLVLYYIIVEFFKCFCPSKFRMKNINNKIVLITGAGHGLGAALAVRFAKHKCRLILWDINFEGLQKTREECRQFQSESLIYIYKVDITKRKQVLDTADKIKSEIGFVDILINNAGVVSGKSILELDEASIERTFNVNVVSHFWTIQAFLPEMLSRDSGHIVSISSLAGFTGINKLSDYCASKFAAIGLHESLLCEINSKQKSNIQILTVCPFYINTGMFDGITTNCPLLPILDLDFVVSKVETAILTNGTILLIPRIAYFMAPLKHILPTKGFLALAKLL 294          
BLAST of Epidermal retinol dehydrogenase 2 vs. Planmine SMEST
Match: SMESG000018758.1 (SMESG000018758.1)

HSP 1 Score: 267.7 bits (683), Expect = 2.238e-88
Identity = 132/259 (50.97%), Postives = 193/259 (74.52%), Query Frame = 1
Query:  130 MKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVL 906
            MK++NNK+VLITGAG+GLGAALA++FAK +CRL+LW+ + + L+   +EC+++QS+  +   +VDI+ R Q+++ AD +K+++GFVDI+INNAGV    SI E++E +I +T NVN +S  W +Q+FL +M SR+SGH+VSISS  G  G+ KL+DYC SKFA  G  ESLL EI S +KS + +LTV PF++ T MF     +CP+L  L++++V SK+E AILTN T+L +P++ +F+  LK++LPTK FL L  +L
Sbjct:    1 MKNINNKIVLITGAGHGLGAALAVRFAKHKCRLILWDINFEGLQKTREECRQFQSESLIYIYKVDITKRKQVLDTADKIKSEIGFVDILINNAGVVSGKSILELDEASIERTFNVNVVSHFWTIQAFLPEMLSRDSGHIVSISSLAGFTGINKLSDYCASKFAAIGLHESLLCEINSKQKSNIQILTVCPFYINTGMFDGITTNCPLLPILDLDFVVSKVETAILTNGTILLIPRIAYFMAPLKHILPTKGFLALAKLL 259          
BLAST of Epidermal retinol dehydrogenase 2 vs. Planmine SMEST
Match: SMESG000018757.1 (SMESG000018757.1)

HSP 1 Score: 268.085 bits (684), Expect = 5.688e-88
Identity = 145/290 (50.00%), Postives = 202/290 (69.66%), Query Frame = 1
Query:   25 MKYLIFVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVVLITXXXXXXXXXXXIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFVLGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNIRKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCFSKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILKSLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCL 894
            M+Y   +  ILK   L+ F+ +    KFFIP  +  KSV NK++LITGAG+GLGAALAI FAK + +LVL +     LK   +EC+K+QS   +   Q+DI+NR ++   ++ +K  +G VDI++NNAGV    S+ E++E+ + KT NVN +S IWI+Q+FL DM  RNSG +VS++S  GL GV KL+DYC SKFA  G QESLL+E+   KK+G+H+LTV PF++ T MF+  K D P L  L+V+YV SKI +AILTN+ VLY+P++ +F+ ILKY+LP K +L L
Sbjct:    1 MRYFNIISRILKATILVPFSILEESLKFFIPTIFLRKSVENKIILITGAGSGLGAALAISFAKLKSKLVLLDISEVGLKRTSNECEKHQSHTSIFIFQIDITNRMEVFKLSEKIKNDIGIVDILVNNAGVVSGKSLLELDEDMVHKTFNVNVISHIWIIQAFLPDMLLRNSGQIVSLASLAGLFGVNKLSDYCASKFAAVGLQESLLNELRMLKKNGIHLLTVCPFYIDTGMFEGVKSDFPFLPILQVDYVTSKITDAILTNSQVLYIPRIAYFMAILKYMLPVKGYLHL 290          
The following BLAST results are available for this feature:
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SDR16C53.870e-4638.03short chain dehydrogenase/reductase family 16C mem... [more]
SDR16C59.136e-4438.29short chain dehydrogenase/reductase family 16C mem... [more]
HSD17B111.539e-4235.79hydroxysteroid 17-beta dehydrogenase 11 [Source:HG... [more]
HSD17B138.134e-4032.97hydroxysteroid 17-beta dehydrogenase 13 [Source:HG... [more]
RDH101.017e-3731.38retinol dehydrogenase 10 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dhs-35.699e-4035.66pep chromosome:WBcel235:I:8212362:8218361:-1 gene:... [more]
dhs-35.699e-4035.66pep chromosome:WBcel235:I:8212362:8218324:-1 gene:... [more]
dhs-193.010e-3835.27DeHydrogenases, Short chain [Source:UniProtKB/TrE... [more]
dhs-32.243e-3736.36pep chromosome:WBcel235:I:8212367:8218287:-1 gene:... [more]
dhs-49.664e-3635.16DeHydrogenases, Short chain [Source:UniProtKB/TrE... [more]
back to top
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG156295.921e-4733.81gene:FBgn0031630 transcript:FBtr0077383[more]
CG92651.691e-3431.60gene:FBgn0032910 transcript:FBtr0331378[more]
CG92651.691e-3431.60gene:FBgn0032910 transcript:FBtr0331377[more]
CG92651.691e-3431.60gene:FBgn0032910 transcript:FBtr0081507[more]
CG92651.691e-3431.60gene:FBgn0032910 transcript:FBtr0331376[more]
back to top
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sdr16c5a1.943e-5640.00short chain dehydrogenase/reductase family 16C, me... [more]
sdr16c5a2.060e-5640.00short chain dehydrogenase/reductase family 16C, me... [more]
sdr16c5b7.823e-4735.84short chain dehydrogenase/reductase family 16C, me... [more]
rdh10b9.363e-4033.22retinol dehydrogenase 10b [Source:NCBI gene;Acc:37... [more]
rdh10a1.704e-3931.23retinol dehydrogenase 10a [Source:NCBI gene;Acc:56... [more]
back to top
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn8.16.602e-4736.99calpain 8 gene 1 [Source:Xenbase;Acc:XB-GENE-92078... [more]
cbx73.055e-4435.42chromobox 7 [Source:Xenbase;Acc:XB-GENE-942584][more]
hsd17b114.011e-4033.33hydroxysteroid (17-beta) dehydrogenase 11 [Source:... [more]
rdh101.058e-3832.39retinol dehydrogenase 10 [Source:NCBI gene;Acc:496... [more]
ENSXETT00000032652.11.941e-3631.10IgGFc-binding protein-like [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsd17b135.872e-5035.82hydroxysteroid (17-beta) dehydrogenase 13 [Source:... [more]
Hsd17b132.065e-4836.13hydroxysteroid (17-beta) dehydrogenase 13 [Source:... [more]
Sdr16c51.621e-4739.92short chain dehydrogenase/reductase family 16C, me... [more]
Hsd17b112.551e-4135.90hydroxysteroid (17-beta) dehydrogenase 11 [Source:... [more]
Sdr16c61.177e-3939.39short chain dehydrogenase/reductase family 16C, me... [more]
back to top
BLAST of Epidermal retinol dehydrogenase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8VCR2|DHB13_MOUSE1.444e-4736.1317-beta-hydroxysteroid dehydrogenase 13 OS=Mus mus... [more]
sp|Q7TQA3|RDHE2_MOUSE1.134e-4639.92Epidermal retinol dehydrogenase 2 OS=Mus musculus ... [more]
sp|Q8N3Y7|RDHE2_HUMAN1.858e-4538.03Epidermal retinol dehydrogenase 2 OS=Homo sapiens ... [more]
sp|Q5NVG2|DHB11_PONAB6.666e-4336.13Estradiol 17-beta-dehydrogenase 11 OS=Pongo abelii... [more]
sp|A5PJJ7|S16C6_BOVIN2.813e-4238.70Short-chain dehydrogenase/reductase family 16C mem... [more]
back to top
BLAST of Epidermal retinol dehydrogenase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H7885.240e-5540.53epidermal retinol dehydrogenase 2 isoform X1 OS=Li... [more]
A0A0K0EGM35.756e-5539.67Uncharacterized protein OS=Strongyloides stercoral... [more]
A0A1S3H6802.936e-5441.02epidermal retinol dehydrogenase 2 isoform X2 OS=Li... [more]
A8E7S34.348e-5340.00Short chain dehydrogenase/reductase family 16C, me... [more]
A0A2R8QN164.610e-5340.00Short chain dehydrogenase/reductase family 16C, me... [more]
back to top
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sdr16c5a2.450e-5037.37epidermal retinol dehydrogenase 2-like [Source:NCB... [more]
sdr16c5b5.494e-4836.62short chain dehydrogenase/reductase family 16C mem... [more]
sdr16c5a5.668e-4134.88epidermal retinol dehydrogenase 2-like [Source:NCB... [more]
rdh10b1.231e-3832.51retinol dehydrogenase 10-B [Source:NCBI gene;Acc:1... [more]
rdh10a3.682e-3831.47retinol dehydrogenase 10-A [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-221h15.43.073e-4233.44si:dkey-221h15.4 [Source:ZFIN;Acc:ZDB-GENE-041014-... [more]
dhrs7b6.297e-1629.61dehydrogenase/reductase (SDR family) member 7B [So... [more]
ENSPMAT00000010315.16.910e-1026.57pep scaffold:Pmarinus_7.0:GL479994:4152:14615:1 ge... [more]
bdh22.227e-925.623-hydroxybutyrate dehydrogenase, type 2 [Source:NC... [more]
zgc:565854.332e-825.13zgc:56585 [Source:ZFIN;Acc:ZDB-GENE-040426-1084][more]
back to top
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
YDL114W_mRNA6.909e-1128.99Putative short-chain dehydrogenase/reductase; YDL1... [more]
YMR226C5.425e-1028.89NADP(+)-dependent serine dehydrogenase and carbony... [more]
FOX27.299e-726.913-hydroxyacyl-CoA dehydrogenase and enoyl-CoA hydr... [more]
back to top
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO310562.618e-5037.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414964.819e-4732.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397891.082e-3534.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO264564.510e-3441.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435191.083e-1428.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Epidermal retinol dehydrogenase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sdr16c5a1.131e-4636.73short chain dehydrogenase/reductase family 16C mem... [more]
sdr16c5a6.799e-4535.59short chain dehydrogenase/reductase family 16C mem... [more]
rdh10a3.786e-3831.31retinol dehydrogenase 10 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000000762.22.094e-3532.84retinol dehydrogenase 10-A [Source:NCBI gene;Acc:1... [more]
dhrs3b4.268e-3537.05dehydrogenase/reductase 3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Epidermal retinol dehydrogenase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018759.10.000e+0100.00SMESG000018759.1[more]
SMESG000018759.10.000e+0100.00SMESG000018759.1[more]
SMESG000018758.13.598e-9649.66SMESG000018758.1[more]
SMESG000018758.12.238e-8850.97SMESG000018758.1[more]
SMESG000018757.15.688e-8850.00SMESG000018757.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014429 ID=SMED30014429|Name=Epidermal retinol dehydrogenase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1090bp
AATTGAATGATAATATCATTAATTATGAAATATTTAATATTCGTAATCAA
TATTCTTAAAGTTATTGGCTTAATTATTTTCACTTCAATTGGAAATATTT
TTAAATTTTTCATTCCTAAAAAGTATGCAATGAAATCGGTCAATAATAAA
GTAGTTTTAATTACCGGAGCAGGAAATGGCCTCGGAGCGGCTTTGGCGAT
AAAATTCGCAAAACAAAGATGCCGACTTGTTCTTTGGGAGACAGATATAG
ACAGTTTGAAGATTATAATAGATGAATGTAAAAAATATCAATCTGATTTA
TTTGTCCTTGGAATTCAGGTGGACATCTCAAATCGCTCCCAGATAATTAA
TGCAGCAGACATGGTTAAAACAAAAGTCGGTTTTGTTGACATAATAATTA
ATAATGCCGGTGTGGCTTTTACAAGCAGTATTACAGAAATGGAGGAAAAT
AATATTCGTAAAACTCTTAATGTAAATGGGTTAAGTCAAATCTGGATTGT
ACAGTCGTTTTTACAGGACATGTTTTCAAGAAACAGCGGACACGTTGTAT
CAATATCTTCATTTACAGGGTTGGTAGGGGTCCGAAAGCTGGCGGATTAT
TGTTTTAGTAAATTTGCTGTCGCGGGATTTCAAGAGAGTTTACTACATGA
AATTTATTCTGCTAAAAAATCCGGGTTGCATGTATTAACCGTTTATCCTT
TTCATATGAAAACAAAAATGTTTCAAAATTACAAATTCGACTGTCCAATT
CTAAAAAGCCTTGAAGTTGAATATGTAGCTTCAAAAATAGAAGAAGCCAT
TCTTACCAATGCTACAGTTCTTTATCTCCCAAAATTACTGCATTTTTTAG
TTATTTTAAAATATGTCCTGCCTACCAAATGTTTTTTGTGTCTTCTAAAT
GTGCTTCTTGGTATTCCGAATAATGAAAAGAAAGTGAAAGAAAATTAGAA
AAATTCTATTAAAAAATTTCACAAAAAATGTTGTAAAATATTCATGTTTT
TCAGTCAAATTCCATTTATAATTGTTCTATGTGTTTAATTCTTAAATAAT
TATTTTTATTAATCACAATAATAATTTCGGTTGTACCCAC
back to top

protein sequence of SMED30014429-orf-1

>SMED30014429-orf-1 ID=SMED30014429-orf-1|Name=SMED30014429-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=314bp
MIISLIMKYLIFVINILKVIGLIIFTSIGNIFKFFIPKKYAMKSVNNKVV
LITGAGNGLGAALAIKFAKQRCRLVLWETDIDSLKIIIDECKKYQSDLFV
LGIQVDISNRSQIINAADMVKTKVGFVDIIINNAGVAFTSSITEMEENNI
RKTLNVNGLSQIWIVQSFLQDMFSRNSGHVVSISSFTGLVGVRKLADYCF
SKFAVAGFQESLLHEIYSAKKSGLHVLTVYPFHMKTKMFQNYKFDCPILK
SLEVEYVASKIEEAILTNATVLYLPKLLHFLVILKYVLPTKCFLCLLNVL
LGIPNNEKKVKEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR002347SDR_fam
IPR016040NAD(P)-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00081GDHRDHcoord: 171..187
score: 28.07
coord: 221..238
score: 25.3
coord: 124..135
score: 52.54
coord: 48..65
score: 44.81
coord: 197..216
score: 29.37
IPR002347Short-chain dehydrogenase/reductase SDRPRINTSPR00080SDRFAMILYcoord: 177..185
score: 39.67
coord: 197..216
score: 33.07
coord: 124..135
score: 51.04
IPR002347Short-chain dehydrogenase/reductase SDRPFAMPF00106adh_shortcoord: 47..241
e-value: 1.0E-40
score: 139.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 32..297
e-value: 2.0E-52
score: 180.0
NoneNo IPR availablePANTHERPTHR24322FAMILY NOT NAMEDcoord: 15..299
NoneNo IPR availableTMHMMTMhelixcoord: 9..31
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 39..298