Receptor-type tyrosine-protein phosphatase F

Overview
NameReceptor-type tyrosine-protein phosphatase F
Smed IDSMED30014428
Length (bp)7024
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor-type tyrosine-protein phosphatase F (SMED30014428) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase F (SMED30014428) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor-type tyrosine-protein phosphatase F (SMED30014428) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor-type tyrosine-protein phosphatase F (SMED30014428) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014428

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30014428SMESG000025325.1 SmedASXL_018308SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30014428SMESG000025325.1 SmedASXL_018309SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30014428SMESG000025325.1 dd_Smed_v4_14794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014428SMESG000025325.1 dd_Smed_v4_14794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014428SMESG000025325.1 dd_Smed_v4_14794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014428SMESG000025325.1 dd_Smed_v4_14794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30014428SMESG000025325.1 dd_Smed_v4_14794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014428SMESG000025325.1 dd_Smed_v4_14794_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014428SMESG000025325.1 dd_Smed_v6_14794_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30014428SMESG000025325.1 OX_Smed_1.0.09080ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
central nervous systemSMED30014428SMESG000025325.1 dd_Smed_v4_14794_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
enteric musculatureSMED30014428SMESG000025325.1 dd_Smed_v4_14794_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
enteric musculatureSMED30014428SMESG000025325.1 dd_Smed_v4_14794_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30014428SMESG000025325.1 dd_Smed_v4_14794_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30014428SMESG000025325.1 Contig35127newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30014428SMESG000025325.1 Contig35127newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30014428SMESG000025325.1 Contig35127uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30014428SMESG000025325.1 Contig35127uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Human
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 326/613 (53.18%), Postives = 432/613 (70.47%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L ++I  LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L           +++    +DY+NANYI+GYRKQNAYIATQG L ET  DFWRMIWEQRS  +VM+T L ERSRVKC+QYWP  +RGT  T+G + VT+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QYIFIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQF + A LEYL
Sbjct: 1337 IPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL----------SAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWP--SRGTE-THGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ASSKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYL 1904          

HSP 2 Score: 230.72 bits (587), Expect = 8.426e-60
Identity = 130/305 (42.62%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++ K  E+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1619 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFD 1908          

HSP 3 Score: 194.512 bits (493), Expect = 1.073e-48
Identity = 145/511 (28.38%), Postives = 225/511 (44.03%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD-------LRSIRYQMLDG----KNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIR----VSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+    P + + ++     FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    S  + V  + + +P+GFP       + V ++    T+ C   G     + WFKDF P+D       ++ +R + + G      L I ++ ESD GKY+C+A N  G+  S   +L +R    V R  P F     +  I  G SV + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P    ++E +  S  LTW             + +YI     +  + L K+ID  +            +  L PY++Y   +V     G   PS+    QT E  P+SAPR V   + S T++ V+WK P E NG+I  Y+V+YT      +  W  +++        + +   I  L     Y   V +  S G+GP S  +Q
Sbjct:   24 PRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRE-DQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWD------SGNPEPVSYYIIQHKPKNSEELYKEIDGVA-------TTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVA-------DSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQ 508          

HSP 4 Score: 174.096 bits (440), Expect = 1.777e-42
Identity = 92/251 (36.65%), Postives = 142/251 (56.57%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I G+ GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ    V+ +  + E     C+QYWP+  +  +    V  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1372 WEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKTCNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE 1619          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Human
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 326/613 (53.18%), Postives = 432/613 (70.47%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L ++I  LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L           +++    +DY+NANYI+GYRKQNAYIATQG L ET  DFWRMIWEQRS  +VM+T L ERSRVKC+QYWP  +RGT  T+G + VT+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QYIFIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQF + A LEYL
Sbjct: 1337 IPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL----------SAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWP--SRGTE-THGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ASSKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYL 1904          

HSP 2 Score: 230.72 bits (587), Expect = 8.426e-60
Identity = 130/305 (42.62%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++ K  E+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1619 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFD 1908          

HSP 3 Score: 194.512 bits (493), Expect = 1.073e-48
Identity = 145/511 (28.38%), Postives = 225/511 (44.03%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD-------LRSIRYQMLDG----KNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIR----VSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+    P + + ++     FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    S  + V  + + +P+GFP       + V ++    T+ C   G     + WFKDF P+D       ++ +R + + G      L I ++ ESD GKY+C+A N  G+  S   +L +R    V R  P F     +  I  G SV + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P    ++E +  S  LTW             + +YI     +  + L K+ID  +            +  L PY++Y   +V     G   PS+    QT E  P+SAPR V   + S T++ V+WK P E NG+I  Y+V+YT      +  W  +++        + +   I  L     Y   V +  S G+GP S  +Q
Sbjct:   24 PRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRE-DQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWD------SGNPEPVSYYIIQHKPKNSEELYKEIDGVA-------TTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVA-------DSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQ 508          

HSP 4 Score: 174.096 bits (440), Expect = 1.777e-42
Identity = 92/251 (36.65%), Postives = 142/251 (56.57%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I G+ GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ    V+ +  + E     C+QYWP+  +  +    V  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1372 WEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKTCNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE 1619          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Human
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 326/613 (53.18%), Postives = 432/613 (70.47%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L ++I  LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L           +++    +DY+NANYI+GYRKQNAYIATQG L ET  DFWRMIWEQRS  +VM+T L ERSRVKC+QYWP  +RGT  T+G + VT+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QYIFIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQF + A LEYL
Sbjct: 1337 IPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL----------SAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWP--SRGTE-THGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ASSKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYL 1904          

HSP 2 Score: 230.72 bits (587), Expect = 8.426e-60
Identity = 130/305 (42.62%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++ K  E+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1619 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFD 1908          

HSP 3 Score: 194.512 bits (493), Expect = 1.073e-48
Identity = 145/511 (28.38%), Postives = 225/511 (44.03%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD-------LRSIRYQMLDG----KNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIR----VSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+    P + + ++     FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    S  + V  + + +P+GFP       + V ++    T+ C   G     + WFKDF P+D       ++ +R + + G      L I ++ ESD GKY+C+A N  G+  S   +L +R    V R  P F     +  I  G SV + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P    ++E +  S  LTW             + +YI     +  + L K+ID  +            +  L PY++Y   +V     G   PS+    QT E  P+SAPR V   + S T++ V+WK P E NG+I  Y+V+YT      +  W  +++        + +   I  L     Y   V +  S G+GP S  +Q
Sbjct:   24 PRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRE-DQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWD------SGNPEPVSYYIIQHKPKNSEELYKEIDGVA-------TTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVA-------DSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQ 508          

HSP 4 Score: 174.096 bits (440), Expect = 1.777e-42
Identity = 92/251 (36.65%), Postives = 142/251 (56.57%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I G+ GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ    V+ +  + E     C+QYWP+  +  +    V  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1372 WEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKTCNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE 1619          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Human
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 326/613 (53.18%), Postives = 432/613 (70.47%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L ++I  LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L           +++    +DY+NANYI+GYRKQNAYIATQG L ET  DFWRMIWEQRS  +VM+T L ERSRVKC+QYWP  +RGT  T+G + VT+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QYIFIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQF + A LEYL
Sbjct: 1337 IPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL----------SAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWP--SRGTE-THGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ASSKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYL 1904          

HSP 2 Score: 230.72 bits (587), Expect = 8.426e-60
Identity = 130/305 (42.62%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++ K  E+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1619 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFD 1908          

HSP 3 Score: 194.512 bits (493), Expect = 1.073e-48
Identity = 145/511 (28.38%), Postives = 225/511 (44.03%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD-------LRSIRYQMLDG----KNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIR----VSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+    P + + ++     FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    S  + V  + + +P+GFP       + V ++    T+ C   G     + WFKDF P+D       ++ +R + + G      L I ++ ESD GKY+C+A N  G+  S   +L +R    V R  P F     +  I  G SV + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P    ++E +  S  LTW             + +YI     +  + L K+ID  +            +  L PY++Y   +V     G   PS+    QT E  P+SAPR V   + S T++ V+WK P E NG+I  Y+V+YT      +  W  +++        + +   I  L     Y   V +  S G+GP S  +Q
Sbjct:   24 PRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRE-DQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWD------SGNPEPVSYYIIQHKPKNSEELYKEIDGVA-------TTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVA-------DSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQ 508          

HSP 4 Score: 174.096 bits (440), Expect = 1.777e-42
Identity = 92/251 (36.65%), Postives = 142/251 (56.57%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I G+ GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ    V+ +  + E     C+QYWP+  +  +    V  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1372 WEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKTCNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE 1619          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Human
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 326/613 (53.18%), Postives = 432/613 (70.47%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L ++I  LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L           +++    +DY+NANYI+GYRKQNAYIATQG L ET  DFWRMIWEQRS  +VM+T L ERSRVKC+QYWP  +RGT  T+G + VT+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QYIFIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQF + A LEYL
Sbjct: 1337 IPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL----------SAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWP--SRGTE-THGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ASSKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYL 1904          

HSP 2 Score: 230.72 bits (587), Expect = 8.426e-60
Identity = 130/305 (42.62%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++ K  E+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1619 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFD 1908          

HSP 3 Score: 194.512 bits (493), Expect = 1.073e-48
Identity = 145/511 (28.38%), Postives = 225/511 (44.03%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD-------LRSIRYQMLDG----KNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIR----VSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+    P + + ++     FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    S  + V  + + +P+GFP       + V ++    T+ C   G     + WFKDF P+D       ++ +R + + G      L I ++ ESD GKY+C+A N  G+  S   +L +R    V R  P F     +  I  G SV + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P    ++E +  S  LTW             + +YI     +  + L K+ID  +            +  L PY++Y   +V     G   PS+    QT E  P+SAPR V   + S T++ V+WK P E NG+I  Y+V+YT      +  W  +++        + +   I  L     Y   V +  S G+GP S  +Q
Sbjct:   24 PRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRE-DQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWD------SGNPEPVSYYIIQHKPKNSEELYKEIDGVA-------TTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVA-------DSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQ 508          

HSP 4 Score: 174.096 bits (440), Expect = 1.777e-42
Identity = 92/251 (36.65%), Postives = 142/251 (56.57%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I G+ GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ    V+ +  + E     C+QYWP+  +  +    V  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1372 WEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKTCNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE 1619          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 574.318 bits (1479), Expect = 2.253e-177
Identity = 284/620 (45.81%), Postives = 390/620 (62.90%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRL--LRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSD 6363
            VPIA L  +I  L+ N N GF +EF SI+    F+WE S+   NK KNRYANV AYDHSRVVL +          ++ Y   DYINANY++GY K  +YIATQGPL ET +DFWRM+WE++SV IVMLT L ERSRVKC+QYWP  +RGT  TYG I VT+      A++  R+  ++ +G PE REIKH Q+TAWPDHGVP    PFL+F+ R+K   P D+GP++ HCSAG+GRTG +I +D MLE+++++ +VD+Y  VT +R+QR+YMVQTEEQYIFIHD +LD   S +T++  S+L  H+  LS+   +     Q +G  +E+R L  L+W+S                             N    + L VN+ KNR   ++P D+NRVI+  + G +GSDY NASWIDG+K R AYIATQ P  ET  DFWR +WE N  I+  L    E     C+ YWP +   +    VV+P+ EY M H+ +REF+++D    + R +RQF F  W  D   P + +H L+ + QV  T  QFG  GP+TVHC +G+ RT +F+ LSI+L++++ ++ V+VF T KLL+ +R ++I+  +QY F + A  EYL  Y +
Sbjct:  510 VPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSN----------VEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWP--SRGT-ATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSAD-----QLSGIDMEFRHLTTLKWTS-----------------------------NRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEW-PDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYDN 1081          

HSP 2 Score: 158.303 bits (399), Expect = 1.855e-38
Identity = 83/251 (33.07%), Postives = 136/251 (54.18%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S   +N+ KNR       D +RV+L  + G  G DY NA+++DG+   ++YIATQ PL ET  DFWRM+WE+    ++ L  + E     C+QYWP+  +A Y    V  +    ++H+ MR  +L    + + R ++  Q+T W D   +P      L  + +V+         GP+  HC+ G  RTG F+V+  +LE+L+ DN V+++     L+ QR  ++++E+QY F   A+L+ +   S E
Sbjct:  545 WEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHG-VPDHPTPFLIFLKRVKTLNPN--DAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTE 792          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 574.704 bits (1480), Expect = 5.572e-176
Identity = 284/620 (45.81%), Postives = 390/620 (62.90%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRL--LRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSD 6363
            VPIA L  +I  L+ N N GF +EF SI+    F+WE S+   NK KNRYANV AYDHSRVVL +          ++ Y   DYINANY++GY K  +YIATQGPL ET +DFWRM+WE++SV IVMLT L ERSRVKC+QYWP  +RGT  TYG I VT+      A++  R+  ++ +G PE REIKH Q+TAWPDHGVP    PFL+F+ R+K   P D+GP++ HCSAG+GRTG +I +D MLE+++++ +VD+Y  VT +R+QR+YMVQTEEQYIFIHD +LD   S +T++  S+L  H+  LS+   +     Q +G  +E+R L  L+W+S                             N    + L VN+ KNR   ++P D+NRVI+  + G +GSDY NASWIDG+K R AYIATQ P  ET  DFWR +WE N  I+  L    E     C+ YWP +   +    VV+P+ EY M H+ +REF+++D    + R +RQF F  W  D   P + +H L+ + QV  T  QFG  GP+TVHC +G+ RT +F+ LSI+L++++ ++ V+VF T KLL+ +R ++I+  +QY F + A  EYL  Y +
Sbjct:  643 VPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSN----------VEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWP--SRGT-ATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSAD-----QLSGIDMEFRHLTTLKWTS-----------------------------NRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEW-PDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYDN 1214          

HSP 2 Score: 158.688 bits (400), Expect = 2.059e-38
Identity = 83/251 (33.07%), Postives = 136/251 (54.18%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S   +N+ KNR       D +RV+L  + G  G DY NA+++DG+   ++YIATQ PL ET  DFWRM+WE+    ++ L  + E     C+QYWP+  +A Y    V  +    ++H+ MR  +L    + + R ++  Q+T W D   +P      L  + +V+         GP+  HC+ G  RTG F+V+  +LE+L+ DN V+++     L+ QR  ++++E+QY F   A+L+ +   S E
Sbjct:  678 WEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHG-VPDHPTPFLIFLKRVKTLNPN--DAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTE 925          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 575.089 bits (1481), Expect = 8.943e-176
Identity = 284/620 (45.81%), Postives = 390/620 (62.90%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRL--LRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSD 6363
            VPIA L  +I  L+ N N GF +EF SI+    F+WE S+   NK KNRYANV AYDHSRVVL +          ++ Y   DYINANY++GY K  +YIATQGPL ET +DFWRM+WE++SV IVMLT L ERSRVKC+QYWP  +RGT  TYG I VT+      A++  R+  ++ +G PE REIKH Q+TAWPDHGVP    PFL+F+ R+K   P D+GP++ HCSAG+GRTG +I +D MLE+++++ +VD+Y  VT +R+QR+YMVQTEEQYIFIHD +LD   S +T++  S+L  H+  LS+   +     Q +G  +E+R L  L+W+S                             N    + L VN+ KNR   ++P D+NRVI+  + G +GSDY NASWIDG+K R AYIATQ P  ET  DFWR +WE N  I+  L    E     C+ YWP +   +    VV+P+ EY M H+ +REF+++D    + R +RQF F  W  D   P + +H L+ + QV  T  QFG  GP+TVHC +G+ RT +F+ LSI+L++++ ++ V+VF T KLL+ +R ++I+  +QY F + A  EYL  Y +
Sbjct:  674 VPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSN----------VEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWP--SRGT-ATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSAD-----QLSGIDMEFRHLTTLKWTS-----------------------------NRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEW-PDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYDN 1245          

HSP 2 Score: 158.688 bits (400), Expect = 2.045e-38
Identity = 83/251 (33.07%), Postives = 136/251 (54.18%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S   +N+ KNR       D +RV+L  + G  G DY NA+++DG+   ++YIATQ PL ET  DFWRM+WE+    ++ L  + E     C+QYWP+  +A Y    V  +    ++H+ MR  +L    + + R ++  Q+T W D   +P      L  + +V+         GP+  HC+ G  RTG F+V+  +LE+L+ DN V+++     L+ QR  ++++E+QY F   A+L+ +   S E
Sbjct:  709 WEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHG-VPDHPTPFLIFLKRVKTLNPN--DAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTE 956          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 577.015 bits (1486), Expect = 4.537e-174
Identity = 286/629 (45.47%), Postives = 393/629 (62.48%), Query Frame = 1
Query: 4501 NIKQFQH-KVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRL--LRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSD 6363
            N+    H  VPIA L  +I  L+ N N GF +EF SI+    F+WE S+   NK KNRYANV AYDHSRVVL +          ++ Y   DYINANY++GY K  +YIATQGPL ET +DFWRM+WE++SV IVMLT L ERSRVKC+QYWP  +RGT  TYG I VT+      A++  R+  ++ +G PE REIKH Q+TAWPDHGVP    PFL+F+ R+K   P D+GP++ HCSAG+GRTG +I +D MLE+++++ +VD+Y  VT +R+QR+YMVQTEEQYIFIHD +LD   S +T++  S+L  H+  LS+   +     Q +G  +E+R L  L+W+S                             N    + L VN+ KNR   ++P D+NRVI+  + G +GSDY NASWIDG+K R AYIATQ P  ET  DFWR +WE N  I+  L    E     C+ YWP +   +    VV+P+ EY M H+ +REF+++D    + R +RQF F  W  D   P + +H L+ + QV  T  QFG  GP+TVHC +G+ RT +F+ LSI+L++++ ++ V+VF T KLL+ +R ++I+  +QY F + A  EYL  Y +
Sbjct:  905 NMTTVSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSN----------VEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWP--SRGT-ATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSAD-----QLSGIDMEFRHLTTLKWTS-----------------------------NRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEW-PDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYDN 1485          

HSP 2 Score: 159.073 bits (401), Expect = 1.957e-38
Identity = 83/251 (33.07%), Postives = 136/251 (54.18%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S   +N+ KNR       D +RV+L  + G  G DY NA+++DG+   ++YIATQ PL ET  DFWRM+WE+    ++ L  + E     C+QYWP+  +A Y    V  +    ++H+ MR  +L    + + R ++  Q+T W D   +P      L  + +V+         GP+  HC+ G  RTG F+V+  +LE+L+ DN V+++     L+ QR  ++++E+QY F   A+L+ +   S E
Sbjct:  949 WEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHG-VPDHPTPFLIFLKRVKTLNPN--DAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTE 1196          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Celegans
Match: ptp-3 (Tyrosine-protein phosphatase Lar-like [Source:UniProtKB/Swiss-Prot;Acc:Q9BMN8])

HSP 1 Score: 576.244 bits (1484), Expect = 5.140e-174
Identity = 286/629 (45.47%), Postives = 393/629 (62.48%), Query Frame = 1
Query: 4501 NIKQFQH-KVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRL--LRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSD 6363
            N+    H  VPIA L  +I  L+ N N GF +EF SI+    F+WE S+   NK KNRYANV AYDHSRVVL +          ++ Y   DYINANY++GY K  +YIATQGPL ET +DFWRM+WE++SV IVMLT L ERSRVKC+QYWP  +RGT  TYG I VT+      A++  R+  ++ +G PE REIKH Q+TAWPDHGVP    PFL+F+ R+K   P D+GP++ HCSAG+GRTG +I +D MLE+++++ +VD+Y  VT +R+QR+YMVQTEEQYIFIHD +LD   S +T++  S+L  H+  LS+   +     Q +G  +E+R L  L+W+S                             N    + L VN+ KNR   ++P D+NRVI+  + G +GSDY NASWIDG+K R AYIATQ P  ET  DFWR +WE N  I+  L    E     C+ YWP +   +    VV+P+ EY M H+ +REF+++D    + R +RQF F  W  D   P + +H L+ + QV  T  QFG  GP+TVHC +G+ RT +F+ LSI+L++++ ++ V+VF T KLL+ +R ++I+  +QY F + A  EYL  Y +
Sbjct:  885 NMTTVSHPAVPIAELANHIERLRMNNNAGFQSEFESIETGQHFTWEHSSADMNKHKNRYANVAAYDHSRVVLSN----------VEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWP--SRGT-ATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHGVPDHPTPFLIFLKRVKTLNPNDAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTEVPASRLHQHLHILSQPSAD-----QLSGIDMEFRHLTTLKWTS-----------------------------NRCTVANLPVNRPKNRMLSAVPYDSNRVIMRLLPGADGSDYINASWIDGYKERGAYIATQAPTNETAADFWRAIWEHNSPIIAMLVRTNERGQEQCSDYWPLETGVQVGMLVVEPMAEYDMKHYHLREFRISDINTREVRTVRQFHFMEW-PDVGKPHTADHFLDFVTQVHNTYAQFGCTGPITVHCCSGAGRTAVFIALSIILDRMRAEHVVDVFTTVKLLRTERQNMIQEPEQYHFLYLAAYEYLAAYDN 1465          

HSP 2 Score: 158.688 bits (400), Expect = 2.532e-38
Identity = 83/251 (33.07%), Postives = 136/251 (54.18%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S   +N+ KNR       D +RV+L  + G  G DY NA+++DG+   ++YIATQ PL ET  DFWRM+WE+    ++ L  + E     C+QYWP+  +A Y    V  +    ++H+ MR  +L    + + R ++  Q+T W D   +P      L  + +V+         GP+  HC+ G  RTG F+V+  +LE+L+ DN V+++     L+ QR  ++++E+QY F   A+L+ +   S E
Sbjct:  929 WEHSSADMNKHKNRYANVAAYDHSRVVLSNVEGYPGMDYINANYVDGYDKPRSYIATQGPLPETFSDFWRMVWEEQSVTIVMLTNLEERSRVKCDQYWPSRGTATYGDIEVTLLESVHLAHYTMRTMRLKMVGEPEVREIKHLQYTAWPDHG-VPDHPTPFLIFLKRVKTLNPN--DAGPIISHCSAGIGRTGAFIVIDCMLERLRYDNTVDIYGCVTALRAQRSYMVQTEEQYIFIHDAVLDAVNSGSTE 1176          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331242)

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 310/652 (47.55%), Postives = 422/652 (64.72%), Query Frame = 1
Query: 4435 DLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTN 6375
            DL    +PS     ++L      +      +PI+    +I  LK+N+N+ FS E+ SI+   QF+W+ SN   NKSKNRYANV AYDHSRV L +   V  +  S       DYINANY +GYRK NAY+ATQGPL ET  DFWRM WE ++  IVM+T L ER+R+KC+QYWP   RGT  TYG I VT+   QE A +  R+F + + G  ++REIK  QFTAWPDHGVP    PFL F+ R +   P +SGPV+VHCSAGVGRTG YI +D+MLE+MKHEK +D+Y +VT +R+QRNYMVQTE+QYIFIHD +L+      T++    L +H++KL   E  +      +G ++E+++L                                 ++ + T+ L  N+ KNR  + LP +++RV L PI G+EGSDY NAS+IDG++ R AYIA Q P+++  EDFWRMLWE N  IV+ L  + E     C QYWP++RS RYQ++VVDPI EY M  + +REFK+TDARDG SR +RQFQF +W  +  +P S E  ++ I QV KTKEQFGQ GP+TVHC+ G  R+G+F+ LSI+LE+++ +  ++VF+T ++L+ QRP+++++EDQY FC+ A LEYL  + D  TN
Sbjct: 1337 DLGAGPTPSDPVDMRRLNFQTPGMIS-HPPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPA---VEGVVGS-------DYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWP--TRGTE-TYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLLITEPGET----ISGMEVEFKKL---------------------------SNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSF-DNYTN 1941          

HSP 2 Score: 196.052 bits (497), Expect = 1.667e-49
Identity = 147/501 (29.34%), Postives = 225/501 (44.91%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGK--PQLPERYNIIRD----SVLHLSSARSEDNGAIVSCVCRNVMGSE-DKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRT---GSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+II  P+N  V       F C + G+P P + W  NGK       RY ++      S+L +   R+  + A   CV  N +G      A++ +Y   +  P GFP         V +    V + C   G     + W K+   +D+ + RY + DG  L I  + E D GKY+C+A N  G+  S A +L ++V R  P F    P + I     GS++ L C   GSP PHV W+ G+  LT  N        IG   + L +I ES N TC+A +     +    + V++LP APT V+ISE++  S  L W Y+                 +   + Q   K+ + +  EI     +   +  L PYT Y  +++     G   PS   +  T  TE  SAPR+V +   S +++ + W+PP   NG++T Y+V+YT +   P   W  NS  +     +N +   +  L  + +Y   V +  S G GP S  VQ
Sbjct:   50 PEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEG-DKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDG-FLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFS--RPPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPEN-----EMPIGRNVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPE-------------DLQYYVIQYKPKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPS---APATCTTEMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASW--NSQMV-----DNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQ 518          

HSP 3 Score: 87.0409 bits (214), Expect = 2.528e-16
Identity = 132/605 (21.82%), Postives = 249/605 (41.16%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNG-KPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFK---DFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEM-----VLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWL---VTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDR---NTMYYFCVNSRNSAGEGPSSQIV----QKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISK-----VNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFT---KISNLSPNTPYIVEI 1983
            P I   P    +     +L  C + GNP P + W+ N  K  +      ++D  L + ++R ED G    CV  N MG+E   A+  +Y  +  VP  F +     +I+     SN+ L C+  G     V W K   D  P +      +M  G+N+  L  ++ ++  Y C+A +  G + S    + ++    +P  V +S      T +SV+L+ S +G      + I    K    N ++  +E  G I M      LS  +E                         +  AP  V++  +S  + ++TW+   T    +T + V+Y            S   + S      D +  T + EL P+  Y++ +    + G   +S P ++ + Q + ++P++  R+  I    ET+V ++W  P  ++  I  Y++++  +  +       +  +I N E         Y LD    +T+YY  + +R+  GEG ++  +    ++++  D     +++    + S S  + WK  P+ K     +  + I       H  +  +  K FLN+  K  +  T    ++ L P+T Y +++
Sbjct:  154 PVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDGFLQIENSREEDQGKY-ECVAENSMGTEHSKAT-NLYVKVRRVPPTFSR--PPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPEN------EMPIGRNVLQLINIQ-ESANYTCIAASTLGQIDS-VSVVKVQSLPTAPTDVQISE----VTATSVRLEWSYKGPEDLQYYVIQYKPK----NANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTEMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTN---------SNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNF-RATDIG---ETAVTLQWTKPTHSSENIVHYELYWNDTYAN-----QAHHKRISNSEA--------YTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGDP----QDVKATPLNSTSIHVSWK-PPLEKDRNGIIRGYHI-------HAQELRDEGKGFLNEPFKFDVVDTLEFNVTGLQPDTKYSIQV 700          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331240)

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 310/652 (47.55%), Postives = 422/652 (64.72%), Query Frame = 1
Query: 4435 DLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTN 6375
            DL    +PS     ++L      +      +PI+    +I  LK+N+N+ FS E+ SI+   QF+W+ SN   NKSKNRYANV AYDHSRV L +   V  +  S       DYINANY +GYRK NAY+ATQGPL ET  DFWRM WE ++  IVM+T L ER+R+KC+QYWP   RGT  TYG I VT+   QE A +  R+F + + G  ++REIK  QFTAWPDHGVP    PFL F+ R +   P +SGPV+VHCSAGVGRTG YI +D+MLE+MKHEK +D+Y +VT +R+QRNYMVQTE+QYIFIHD +L+      T++    L +H++KL   E  +      +G ++E+++L                                 ++ + T+ L  N+ KNR  + LP +++RV L PI G+EGSDY NAS+IDG++ R AYIA Q P+++  EDFWRMLWE N  IV+ L  + E     C QYWP++RS RYQ++VVDPI EY M  + +REFK+TDARDG SR +RQFQF +W +   +P S E  ++ I QV KTKEQFGQ GP+TVHC+ G  R+G+F+ LSI+LE+++ +  ++VF+T ++L+ QRP+++++EDQY FC+ A LEYL  + D  TN
Sbjct: 1331 DLGAGPTPSDPVDMRRLNFQTPGMIS-HPPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPA---VEGVVGS-------DYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWP--TRGTE-TYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLLITEPGET----ISGMEVEFKKL---------------------------SNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQG-VPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSF-DNYTN 1935          

HSP 2 Score: 192.971 bits (489), Expect = 1.531e-48
Identity = 146/506 (28.85%), Postives = 224/506 (44.27%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGK--PQLPERYNIIRD----SVLHLSSARSEDNGAIVSCVCRNVMGSE-DKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRT---GSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSK-----IHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+II  P+N  V       F C + G+P P + W  NGK       RY ++      S+L +   R+  + A   CV  N +G      A++ +Y   +  P GFP         V +    V + C   G     + W K+   +D+ + RY + DG  L I  + E D GKY+C+A N  G+  S A +L ++V R  P F    P + I     GS++ L C   GSP PHV W+ G+  LT  N        IG   + L +I ES N TC+A +     +    + V++LP APT V+ISE++  S  L W Y+                 +   + Q   K+ + +  EI     +   +  L PYT Y  +++     G   PS         F    T+  SAPR+V +   S +++ + W+PP   NG++T Y+V+YT +   P   W  NS  +     +N +   +  L  + +Y   V +  S G GP S  VQ
Sbjct:   36 PEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEG-DKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDG-FLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFS--RPPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPEN-----EMPIGRNVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPE-------------DLQYYVIQYKPKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGDFSFGGTKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASW--NSQMV-----DNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQ 512          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331239)

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 310/652 (47.55%), Postives = 422/652 (64.72%), Query Frame = 1
Query: 4435 DLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTN 6375
            DL    +PS     ++L      +      +PI+    +I  LK+N+N+ FS E+ SI+   QF+W+ SN   NKSKNRYANV AYDHSRV L +   V  +  S       DYINANY +GYRK NAY+ATQGPL ET  DFWRM WE ++  IVM+T L ER+R+KC+QYWP   RGT  TYG I VT+   QE A +  R+F + + G  ++REIK  QFTAWPDHGVP    PFL F+ R +   P +SGPV+VHCSAGVGRTG YI +D+MLE+MKHEK +D+Y +VT +R+QRNYMVQTE+QYIFIHD +L+      T++    L +H++KL   E  +      +G ++E+++L                                 ++ + T+ L  N+ KNR  + LP +++RV L PI G+EGSDY NAS+IDG++ R AYIA Q P+++  EDFWRMLWE N  IV+ L  + E     C QYWP++RS RYQ++VVDPI EY M  + +REFK+TDARDG SR +RQFQF +W  +  +P S E  ++ I QV KTKEQFGQ GP+TVHC+ G  R+G+F+ LSI+LE+++ +  ++VF+T ++L+ QRP+++++EDQY FC+ A LEYL  + D  TN
Sbjct: 1428 DLGAGPTPSDPVDMRRLNFQTPGMIS-HPPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPA---VEGVVGS-------DYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWP--TRGTE-TYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLLITEPGET----ISGMEVEFKKL---------------------------SNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSF-DNYTN 2032          

HSP 2 Score: 192.586 bits (488), Expect = 2.176e-48
Identity = 145/505 (28.71%), Postives = 226/505 (44.75%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGK--PQLPERYNIIRD----SVLHLSSARSEDNGAIVSCVCRNVMGSE-DKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQF--IRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLE-----TEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+II  P+N  V       F C + G+P P + W  NGK       RY ++      S+L +   R+  + A   CV  N +G      A++ +Y   +  P GFP         V +    V + C   G     + W K+   +D+ + RY + DG  L I  + E D GKY+C+A N  G+  S A +L ++V R  P F    P+    +  GS++ L C   GSP PHV W+ G+  LT  N        IG   + L +I ES N TC+A +     +    + V++LP APT V+ISE++  S  L W Y+                 +   + Q   K+ + +  EI     +   +  L PYT Y  +++     G   PS   +  T +     T+  SAPR+V +   S +++ + W+PP   NG++T Y+V+YT +   P   W  NS  +     +N +   +  L  + +Y   V +  S G GP S  VQ
Sbjct:   36 PEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEG-DKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDG-FLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSR-PPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPEN-----EMPIGRNVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPED-------------LQYYVIQYKPKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGDFSFGGTKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASW--NSQMV-----DNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQ 512          

HSP 3 Score: 54.299 bits (129), Expect = 2.196e-6
Identity = 58/232 (25.00%), Postives = 100/232 (43.10%), Query Frame = 1
Query: 1324 LKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKW-KPPIE-TNGEITLYQVFYTK--SKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISK-----VNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFT---KISNLSPNTPYIVEI 1983
            L P T Y +WL      G  E +          +  + PR+++   TS T++ + W  PP+E +NG I  Y+VF+ +   ++D  T  ++N   IV +E           L R T Y   V +  S G+GP S  +     +D     +++    + S S  + WK  P+ K     +  + I       H  +  +  K FLN+  K  +  T    ++ L P+T Y +++
Sbjct:  581 LYPDTLYYIWLAARSQRG--EGATTPPIPVRTKQYGAPPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSIVLDE-----------LKRWTEYKIWVLAGTSVGDGPRSHPIILRTQEDVPGDPQDVKATPLNSTSIHVSWK-PPLEKDRNGIIRGYHI-------HAQELRDEGKGFLNEPFKFDVVDTLEFNVTGLQPDTKYSIQV 791          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0331241)

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 311/653 (47.63%), Postives = 423/653 (64.78%), Query Frame = 1
Query: 4435 DLLVQSSPSTSFKDKKLVLSEKNIKQFQHK-VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTN 6375
            DL    +PS     ++L      +    H  +PI+    +I  LK+N+N+ FS E+ SI+   QF+W+ SN   NKSKNRYANV AYDHSRV L +   V  +  S       DYINANY +GYRK NAY+ATQGPL ET  DFWRM WE ++  IVM+T L ER+R+KC+QYWP   RGT  TYG I VT+   QE A +  R+F + + G  ++REIK  QFTAWPDHGVP    PFL F+ R +   P +SGPV+VHCSAGVGRTG YI +D+MLE+MKHEK +D+Y +VT +R+QRNYMVQTE+QYIFIHD +L+      T++    L +H++KL   E  +      +G ++E+++L                                 ++ + T+ L  N+ KNR  + LP +++RV L PI G+EGSDY NAS+IDG++ R AYIA Q P+++  EDFWRMLWE N  IV+ L  + E     C QYWP++RS RYQ++VVDPI EY M  + +REFK+TDARDG SR +RQFQF +W +   +P S E  ++ I QV KTKEQFGQ GP+TVHC+ G  R+G+F+ LSI+LE+++ +  ++VF+T ++L+ QRP+++++EDQY FC+ A LEYL  + D  TN
Sbjct: 1323 DLGAGPTPSDPVDMRRLNFQTPGM--ISHPPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPA---VEGVVGS-------DYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWP--TRGTE-TYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLLITEPGET----ISGMEVEFKKL---------------------------SNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDWPEQG-VPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSF-DNYTN 1927          

HSP 2 Score: 196.052 bits (497), Expect = 1.497e-49
Identity = 147/501 (29.34%), Postives = 225/501 (44.91%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGK--PQLPERYNIIRD----SVLHLSSARSEDNGAIVSCVCRNVMGSE-DKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRT---GSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+II  P+N  V       F C + G+P P + W  NGK       RY ++      S+L +   R+  + A   CV  N +G      A++ +Y   +  P GFP         V +    V + C   G     + W K+   +D+ + RY + DG  L I  + E D GKY+C+A N  G+  S A +L ++V R  P F    P + I     GS++ L C   GSP PHV W+ G+  LT  N        IG   + L +I ES N TC+A +     +    + V++LP APT V+ISE++  S  L W Y+                 +   + Q   K+ + +  EI     +   +  L PYT Y  +++     G   PS   +  T  TE  SAPR+V +   S +++ + W+PP   NG++T Y+V+YT +   P   W  NS  +     +N +   +  L  + +Y   V +  S G GP S  VQ
Sbjct:   36 PEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEG-DKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDG-FLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFS--RPPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPEN-----EMPIGRNVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPE-------------DLQYYVIQYKPKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPS---APATCTTEMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASW--NSQMV-----DNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQ 504          

HSP 3 Score: 87.0409 bits (214), Expect = 2.545e-16
Identity = 132/605 (21.82%), Postives = 249/605 (41.16%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNG-KPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFK---DFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEM-----VLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWL---VTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDR---NTMYYFCVNSRNSAGEGPSSQIV----QKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISK-----VNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFT---KISNLSPNTPYIVEI 1983
            P I   P    +     +L  C + GNP P + W+ N  K  +      ++D  L + ++R ED G    CV  N MG+E   A+  +Y  +  VP  F +     +I+     SN+ L C+  G     V W K   D  P +      +M  G+N+  L  ++ ++  Y C+A +  G + S    + ++    +P  V +S      T +SV+L+ S +G      + I    K    N ++  +E  G I M      LS  +E                         +  AP  V++  +S  + ++TW+   T    +T + V+Y            S   + S      D +  T + EL P+  Y++ +    + G   +S P ++ + Q + ++P++  R+  I    ET+V ++W  P  ++  I  Y++++  +  +       +  +I N E         Y LD    +T+YY  + +R+  GEG ++  +    ++++  D     +++    + S S  + WK  P+ K     +  + I       H  +  +  K FLN+  K  +  T    ++ L P+T Y +++
Sbjct:  140 PVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDGFLQIENSREEDQGKY-ECVAENSMGTEHSKAT-NLYVKVRRVPPTFSR--PPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPEN------EMPIGRNVLQLINIQ-ESANYTCIAASTLGQIDS-VSVVKVQSLPTAPTDVQISE----VTATSVRLEWSYKGPEDLQYYVIQYKPK----NANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTEMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTN---------SNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNF-RATDIG---ETAVTLQWTKPTHSSENIVHYELYWNDTYAN-----QAHHKRISNSEA--------YTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGDP----QDVKATPLNSTSIHVSWK-PPLEKDRNGIIRGYHI-------HAQELRDEGKGFLNEPFKFDVVDTLEFNVTGLQPDTKYSIQV 686          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Fly
Match: Lar (gene:FBgn0000464 transcript:FBtr0081260)

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 310/652 (47.55%), Postives = 422/652 (64.72%), Query Frame = 1
Query: 4435 DLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTN 6375
            DL    +PS     ++L      +      +PI+    +I  LK+N+N+ FS E+ SI+   QF+W+ SN   NKSKNRYANV AYDHSRV L +   V  +  S       DYINANY +GYRK NAY+ATQGPL ET  DFWRM WE ++  IVM+T L ER+R+KC+QYWP   RGT  TYG I VT+   QE A +  R+F + + G  ++REIK  QFTAWPDHGVP    PFL F+ R +   P +SGPV+VHCSAGVGRTG YI +D+MLE+MKHEK +D+Y +VT +R+QRNYMVQTE+QYIFIHD +L+      T++    L +H++KL   E  +      +G ++E+++L                                 ++ + T+ L  N+ KNR  + LP +++RV L PI G+EGSDY NAS+IDG++ R AYIA Q P+++  EDFWRMLWE N  IV+ L  + E     C QYWP++RS RYQ++VVDPI EY M  + +REFK+TDARDG SR +RQFQF +W  +  +P S E  ++ I QV KTKEQFGQ GP+TVHC+ G  R+G+F+ LSI+LE+++ +  ++VF+T ++L+ QRP+++++EDQY FC+ A LEYL  + D  TN
Sbjct: 1425 DLGAGPTPSDPVDMRRLNFQTPGMIS-HPPIPISEFANHIERLKSNDNQKFSQEYESIEPGQQFTWDNSNLEHNKSKNRYANVTAYDHSRVQLPA---VEGVVGS-------DYINANYCDGYRKHNAYVATQGPLQETFVDFWRMCWELKTATIVMMTRLEERTRIKCDQYWP--TRGTE-TYGQIFVTITETQELATYSIRTFQLCRQGFNDRREIKQLQFTAWPDHGVPDHPAPFLQFLRRCRALTPPESGPVIVHCSAGVGRTGCYIVIDSMLERMKHEKIIDIYGHVTCLRAQRNYMVQTEDQYIFIHDAILEAIICGVTEVPARNLHTHLQKLLITEPGET----ISGMEVEFKKL---------------------------SNVKMDSSKFVTANLPCNKHKNRLVHILPYESSRVYLTPIHGIEGSDYVNASFIDGYRYRSAYIAAQGPVQDAAEDFWRMLWEHNSTIVVMLTKLKEMGREKCFQYWPHERSVRYQYYVVDPIAEYNMPQYKLREFKVTDARDGSSRTVRQFQFIDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRSGVFITLSIVLERMQYEGVLDVFQTVRILRSQRPAMVQTEDQYHFCYRAALEYLGSF-DNYTN 2029          

HSP 2 Score: 200.29 bits (508), Expect = 9.737e-51
Identity = 146/500 (29.20%), Postives = 226/500 (45.20%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGK--PQLPERYNIIRD----SVLHLSSARSEDNGAIVSCVCRNVMGSE-DKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQF--IRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+II  P+N  V       F C + G+P P + W  NGK       RY ++      S+L +   R+  + A   CV  N +G      A++ +Y   +  P GFP         V +    V + C   G     + W K+   +D+ + RY + DG  L I  + E D GKY+C+A N  G+  S A +L ++V R  P F    P+    +  GS++ L C   GSP PHV W+ G+  LT  N        IG   + L +I ES N TC+A +     +    + V++LP APT V+ISE++  S  L W Y+                 +   + Q   K+ + +  EI     +   +  L PYT Y  +++     G   PS   +  T ET+  SAPR+V +   S +++ + W+PP   NG++T Y+V+YT +   P   W  NS  +     +N +   +  L  + +Y   V +  S G GP S  VQ
Sbjct:   36 PEIIRKPQNQGVRVGGVASFYCAARGDPPPSIVWRKNGKKVSGTQSRYTVLEQPGGISILRIEPVRAGRDDAPYECVAENGVGDAVSADATLTIYEG-DKTPAGFPVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDG-FLQIENSREEDQGKYECVAENSMGTEHSKATNLYVKVRRVPPTFSR-PPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPEN-----EMPIGRNVLQLINIQESANYTCIAASTLGQIDSVSVVKVQSLPTAPTDVQISEVTATSVRLEWSYKGPE-------------DLQYYVIQYKPKNANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGETKMESAPRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTNSNQPEASW--NSQMV-----DNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQ 507          

HSP 3 Score: 85.5001 bits (210), Expect = 6.495e-16
Identity = 125/565 (22.12%), Postives = 232/565 (41.06%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNG-KPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFK---DFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEM-----VLSDISE----------------SLNCTCV-AKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWL---VTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDR---NTMYYFCVNSRNSAGEGPSSQIV----QKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNA 1836
            P I   P    +     +L  C + GNP P + W+ N  K  +      ++D  L + ++R ED G    CV  N MG+E   A+  +Y  +  VP  F +     +I+     SN+ L C+  G     V W K   D  P +      +M  G+N+  L  ++ ++  Y C+A +  G + S    + ++    +P  V +S      T +SV+L+ S +G      + I    K    N ++  +E  G I M      LS  +E                S   TC   +TK E+A              P  V++  +S  + ++TW+   T    +T + V+Y            S   + S      D +  T + EL P+  Y++ +    + G   +S P ++ + Q + ++P++  R+  I    ET+V ++W  P  ++  I  Y++++  +  +       +  +I N E         Y LD    +T+YY  + +R+  GEG ++  +    ++++        +N+T +   S +  + W   P+ + N 
Sbjct:  140 PVITQGPGTRVIEVGHTVLMTCKAIGNPTPNIYWIKNQTKVDMSNPRYSLKDGFLQIENSREEDQGKY-ECVAENSMGTEHSKAT-NLYVKVRRVPPTFSR--PPETISEVMLGSNLNLSCIAVGSPMPHVKWMKGSEDLTPEN------EMPIGRNVLQLINIQ-ESANYTCIAASTLGQIDS-VSVVKVQSLPTAPTDVQISE----VTATSVRLEWSYKGPEDLQYYVIQYKPK----NANQAFSEISGIITMYYVVRALSPYTEYEFYVIAVNNIGRGPPSAPATCTTGETKMESA--------------PRNVQVRTLSSSTMVITWEPPETPNGQVTGYKVYYTTN---------SNQPEASWNSQMVDNSELTTVSELTPHAIYTVRVQAYTSMGAGPMSTPVQVKAQQGVPSQPSNF-RATDIG---ETAVTLQWTKPTHSSENIVHYELYWNDTYAN-----QAHHKRISNSEA--------YTLDGLYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAP---PRNITAIATSSTTISLSWLPPPVERSNG 641          

HSP 4 Score: 60.4622 bits (145), Expect = 2.640e-8
Identity = 59/232 (25.43%), Postives = 102/232 (43.97%), Query Frame = 1
Query: 1324 LKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKW-KPPIE-TNGEITLYQVFYTK--SKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISK-----VNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFT---KISNLSPNTPYIVEI 1983
            L P T Y +WL      G    +     +T +  P + PR+++   TS T++ + W  PP+E +NG I  Y+VF+ +   ++D  T  ++N   IV +E           L R T Y   V +  S G+GP S  +     +D     +++    + S S  + WK  P+ K     +  + I       H  +  +  K FLN+  K  +  T    ++ L P+T Y +++
Sbjct:  576 LYPDTLYYIWLAARSQRGEGATTPPIPVRTKQYVPGAPPRNITAIATSSTTISLSWLPPPVERSNGRIIYYKVFFVEVGREDDEATTMTLNMTSIVLDE-----------LKRWTEYKIWVLAGTSVGDGPRSHPIILRTQEDVPGDPQDVKATPLNSTSIHVSWK-PPLEKDRNGIIRGYHI-------HAQELRDEGKGFLNEPFKFDVVDTLEFNVTGLQPDTKYSIQV 788          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 331/657 (50.38%), Postives = 446/657 (67.88%), Query Frame = 1
Query: 4393 DSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            D +E++R    T PD  + S  S +  D + +++   I       PI+ L E+   LK N+N   S E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L   + +            +DYIN+NYI+GYRKQNAYIATQGPL ET  DFWRM+WEQR+  +VM+T L E+SR+KC+QYWP  +RGT  TYG I VT+    E A F  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP++ HCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +RSQRNYMVQTE+QY FIHD LL+     NT++A   LFS+I+KL+++E  +      +G +LE++RL    +                            T+ + ++ L  N+ KNR    +P +T RV L PIRG+EGSDY N+S+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +   +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++ED+YQFC+ A LEYL
Sbjct: 1307 DPVEMRRINFQT-PDSGLSSPVSEAGFDYESMMNHPPI-------PISELAEHTELLKANDNLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGIT----------GSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTRLEEKSRIKCDQYWP--SRGTE-TYGMIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVEAGE----HVSGMELEFKRLANSKA---------------------------HTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQG-VPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1910          

HSP 2 Score: 223.016 bits (567), Expect = 1.269e-57
Identity = 114/260 (43.85%), Postives = 159/260 (61.15%), Query Frame = 1
Query: 4639 SNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +N P NK KNR  N++ Y+ +RV LQ  + +            +DYIN+++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE++Y F +   L+Y  S +
Sbjct: 1670 ANLPCNKFKNRLVNIMPYETTRVCLQPIRGLE----------GSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1914          

HSP 3 Score: 184.882 bits (468), Expect = 6.060e-46
Identity = 142/530 (26.79%), Postives = 227/530 (42.83%), Query Frame = 1
Query:  241 IKRPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD--LRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWK 1809
            +  P+    P +   ++   + F+C + G+PKPKVTW   GK    +R   I       +VL +   R+  +  +  C   N  G  +  A + +  + + +P GFP       + V ++    T+ C   G     + WFKDF P+D    + R + L    L I  T E+D GKY+C+A N  G   S   +L +RV R  P F  +   Q I  G SV + C   GSP P+V W+  +  LT  +        +G   + L+ + ES N TCVA +          I VK+LP  P    ++E +  S  +TW             +  YI  +  R + P SK   + S    +       I  L P T+Y + +      G   PS+    +T E  P S PR++   + S+ +V V+W  P E NG+I  Y+V+YT     P++ W I+++       ++     I  L  +  Y   V +  S G+GP S  +   +      Q  N  +  V     ++ W+
Sbjct:   28 LSSPRFTKVPVDMIGVSGGVVSFVCQATGDPKPKVTWNKKGKRVNSQRIETIEFDEGAGAVLRIQPLRAPRDENVYECQAENSEGEINVQAKLSIIRE-DLLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPIDPNTSNGRIKQLRSGALQIENTEETDQGKYECVASNVEGVRYSSPANLYVRVRRVPPRFSILPTSQEIMPGGSVNITCVAVGSPMPYVKWMLNSEDLTPED-----EMPVGRNVLELNSVRESANYTCVAMSSLGIIETVAQITVKSLPKPPGTPVVTETTATSITITWD------SGNPEPVSHYI--IQYRAKSPESKFETVDSITTTR-----YSIGGLSPNTDYEIRVSAFNTIGQGPPSEPVEARTGEQAPASPPRNIQARIISQNTVLVRWDEPDEPNGQIKGYRVYYTMDPTLPMSMWQIHNV-------QDSVLTTIQSLVTSETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPTNFQVGEVSDTGVELTWE 531          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Zebrafish
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 321/613 (52.37%), Postives = 428/613 (69.82%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI+ L E+   LK N+N   S E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L   + +            +DYIN+NYI+GYRKQNAYIATQGPL ET  DFWRM+WEQR+  +VM+T L E+SR+KC+QYWP  +RGT  TYG I VT+    E A F  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP++ HCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +RSQRNYMVQTE+QY FIHD LL+     NT++A   LFS+I+KL+++E  +      +G +LE++RL    +                            T+ + ++ L  N+ KNR    +P +T RV L PIRG+EGSDY N+S+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +   +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++ED+YQFC+ A LEYL
Sbjct: 1222 IPISELAEHTELLKANDNLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGIT----------GSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRAATVVMMTRLEEKSRIKCDQYWP--SRGTE-TYGMIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVEAGE----HVSGMELEFKRLANSKA---------------------------HTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQG-VPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1789          

HSP 2 Score: 223.016 bits (567), Expect = 1.131e-57
Identity = 114/260 (43.85%), Postives = 159/260 (61.15%), Query Frame = 1
Query: 4639 SNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +N P NK KNR  N++ Y+ +RV LQ  + +            +DYIN+++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE++Y F +   L+Y  S +
Sbjct: 1549 ANLPCNKFKNRLVNIMPYETTRVCLQPIRGLE----------GSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1793          

HSP 3 Score: 155.606 bits (392), Expect = 4.660e-37
Identity = 119/431 (27.61%), Postives = 185/431 (42.92%), Query Frame = 1
Query:  523 NAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSI--RYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWK 1809
            + +P GFP       + V ++    T+ C   G     + WFKDF P+D  +   R + L    L I  T E+D GKY+C+A N  G   S   +L +RV R  P F  +   Q I  G SV + C   GSP P+V W+  +  LT  +        +G   + L+ + ES N TCVA +          I VK+LP  P    ++E +  S  +TW             +  YI  +  R + P SK   + S    +       I  L P T+Y + +      G   PS+    +T E  P S PR++   + S+ +V V+W  P E NG+I  Y+V+YT     P++ W I+++       ++     I  L  +  Y   V +  S G+GP S  +   +      Q  N  +  V     ++ W+
Sbjct:   21 DLLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPIDPNTSNGRIKQLRSGALQIENTEETDQGKYECVASNVEGVRYSSPANLYVRVRRVPPRFSILPTSQEIMPGGSVNITCVAVGSPMPYVKWMLNSEDLTPED-----EMPVGRNVLELNSVRESANYTCVAMSSLGIIETVAQITVKSLPKPPGTPVVTETTATSITITWD------SGNPEPVSHYI--IQYRAKSPESKFETVDSITTTR-----YSIGGLSPNTDYEIRVSAFNTIGQGPPSEPVEARTGEQAPASPPRNIQARIISQNTVLVRWDEPDEPNGQIKGYRVYYTMDPTLPMSMWQIHNV-------QDSVLTTIQSLVTSETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPTNFQVGEVSDTGVELTWE 426          

HSP 4 Score: 62.3882 bits (150), Expect = 8.668e-9
Identity = 115/522 (22.03%), Postives = 190/522 (36.40%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPE----RYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQK---NSNVTLECLVFGQSKITVVWF---KDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISE--------------ISHRSCLLTWKYQXXXXXXXXXXXVFYI--PTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFIND 1737
            P I   P+   V   +    +C + GNP P++TW  +  P  P     R   +R   L + +    D G    CV  NV G    S+   +Y  +  VP  F      S +  SQ+     +V + C+  G     V W    +D  P D      +M  G+N+  L ++  ++  Y C+A++  G +I     + ++     P    V+      T +S+ +     G+P P   +I            + + E + SI      I           T  E      + I +  P  P   R  E              IS  + L+ W         I  + V+Y   PT+ + + Q +    D     IQ      T       YT   L   + G    S+P  +   Q +  +PT    +  +   S+T V + W+P  E  G I+ Y++ Y + K+ PL +          ++     S  +  L  NT Y+F + + +S G G        F ND
Sbjct:   28 PNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPIDPNTSNGRIKQLRSGALQIENTEETDQGK-YECVASNVEGVR-YSSPANLYVRVRRVPPRF------SILPTSQEIMPGGSVNITCVAVGSPMPYVKWMLNSEDLTPED------EMPVGRNVLELNSVR-ESANYTCVAMSSLG-IIETVAQITVKSLPKPPGTPVVTET----TATSITITWD-SGNPEPVSHYIIQYRA----KSPESKFETVDSITTTRYSIG-----GLSPNTDYEIRVSAFNTIGQGPPSEPVEARTGEQAPASPPRNIQARIISQNTVLVRWDEPDEPNGQIKGYRVYYTMDPTLPMSMWQ-IHNVQDSVLTTIQSLVTSET-------YTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPT----NFQVGEVSDTGVELTWEPAFEKEGIIS-YELHYKEGKDGPLGK----------KKFAPTSSFVVDGLRPNTEYFFSLAAVSSKGIG-------AFTND 489          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 661.374 bits (1705), Expect = 0.000e+0
Identity = 320/613 (52.20%), Postives = 426/613 (69.49%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            V +  L ++I  L+ N++  FS E+ S+D   QF+WE SN   NK KNRYANV+AYDHSRVVL            +D    +DYIN NYI+GYRKQNAYIATQGPL ET++DFWRM+WEQR+  IVM+T L E+SRVKC+QYWP  +RGT  TYG I V++    E A +  R+F + K GS EKRE++ FQF AWPDHGVP+   P L F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE+MKHEKSVD+Y +VT +RSQRNYMVQTE+QYIFIH+ LL+     NT++    L++HI+KL++           T  +LE+++L   ++  +H                        T+ + ++ L  N+ KNR    +P +++RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +   +P + E  ++ I QV KTKEQFGQ GP+TVHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K L+ QRP+++++EDQYQ C+ A LEYL
Sbjct: 1339 VSVCALADHIERLRANDSLRFSQEYESVDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTP----------VDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWP--SRGTE-TYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQAPPGDT----VTAMELEFKKL---ANSKAH------------------------TSRFISASLPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQG-VPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYL 1906          

HSP 2 Score: 222.631 bits (566), Expect = 1.632e-57
Identity = 115/257 (44.75%), Postives = 156/257 (60.70%), Query Frame = 1
Query: 4648 PTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIK--KEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            P NK KNR  N++ ++ SRV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R I+ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  +  +R+QR  MVQTE+QY   +   L+Y  S +
Sbjct: 1669 PCNKFKNRLVNIMPFESSRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1910          

HSP 3 Score: 212.616 bits (540), Expect = 1.771e-54
Identity = 148/504 (29.37%), Postives = 229/504 (45.44%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIR---YQMLDGKN-----LFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P  +  P + + ++     F+C + G PKP++TW+  GK    +R+ +I       SVL +   R+  + AI  C   N +G  + SA + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P+D+ S      Q+  G       L I  + ESD GKY+C+A+N  G+  S   +L +RV R  P F     +  +  G SV L C   G+P P+V W+ G  +LT     K +   IG   + L++I +S N TCVA +     + T  I VK LP  P  + ++E +  S  LTW             + +Y+  +  R     SK  D   +E+    +    I  L PY+ Y   ++     G   PS +   +T E  P+S P  V   + S T++ V+W+PP E NG+I  Y+V+YT     PL+ W            E+     I  L  +  Y   V +  S G+GP S I+Q
Sbjct:   33 PSFVKTPEDQTGISGGVASFVCQAVGEPKPRITWMKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLTVLEE-DQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGRIKQLRSGGTPIRGALQIENSEESDQGKYECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWMKGEQELT-----KEEEMPIGRNVLELTNIRQSGNYTCVAISSLGMIDTTAQITVKALPRPPASLIVTETTATSVTLTWD------SGNPEPVSYYV--IQYR-----SKISDNGFQEVDGVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQ-------KHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQ 510          

HSP 4 Score: 178.333 bits (451), Expect = 5.384e-44
Identity = 91/251 (36.25%), Postives = 141/251 (56.18%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L P+ GV GSDY N ++IDG++ + AYIATQ PL ET  DFWRM+WEQ    ++ +  + E     C+QYWP+  +  Y    V  +   +++ + +R F L      + R +RQFQF  W D   +P     +L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++     ++ QR  ++++EDQY F   ALLE  T  + E
Sbjct: 1374 WENSNLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHG-VPEYPTPILAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTE 1621          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 320/613 (52.20%), Postives = 426/613 (69.49%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            V +  L ++I  L+ N++  FS E+ S+D   QF+WE SN   NK KNRYANV+AYDHSRVVL            +D    +DYIN NYI+GYRKQNAYIATQGPL ET++DFWRM+WEQR+  IVM+T L E+SRVKC+QYWP  +RGT  TYG I V++    E A +  R+F + K GS EKRE++ FQF AWPDHGVP+   P L F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE+MKHEKSVD+Y +VT +RSQRNYMVQTE+QYIFIH+ LL+     NT++    L++HI+KL++           T  +LE+++L   ++  +H                        T+ + ++ L  N+ KNR    +P +++RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P + E  ++ I QV KTKEQFGQ GP+TVHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K L+ QRP+++++EDQYQ C+ A LEYL
Sbjct: 1322 VSVCALADHIERLRANDSLRFSQEYESVDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTP----------VDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWP--SRGTE-TYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQAPPGDT----VTAMELEFKKL---ANSKAH------------------------TSRFISASLPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDW-PEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYL 1889          

HSP 2 Score: 221.861 bits (564), Expect = 2.993e-57
Identity = 115/257 (44.75%), Postives = 156/257 (60.70%), Query Frame = 1
Query: 4648 PTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            P NK KNR  N++ ++ SRV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R I+ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  +  +R+QR  MVQTE+QY   +   L+Y  S +
Sbjct: 1652 PCNKFKNRLVNIMPFESSRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1893          

HSP 3 Score: 218.394 bits (555), Expect = 3.140e-56
Identity = 148/498 (29.72%), Postives = 229/498 (45.98%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSI--RYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P  +  P + + ++     F+C + G PKP++TW+  GK    +R+ +I       SVL +   R+  + AI  C   N +G  + SA + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P+D+ S   R + L    L I  + ESD GKY+C+A+N  G+  S   +L +RV R  P F     +  +  G SV L C   G+P P+V W+ G  +LT     K +   IG   + L++I +S N TCVA +     + T  I VK LP  P  + ++E +  S  LTW             + +Y+  +  R     SK  D   +E+    +    I  L PY+ Y   ++     G   PS +   +T E  P+S P  V   + S T++ V+W+PP E NG+I  Y+V+YT     PL+ W            E+     I  L  +  Y   V +  S G+GP S I+Q
Sbjct:   33 PSFVKTPEDQTGISGGVASFVCQAVGEPKPRITWMKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLTVLEE-DQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGRIKQLRSGALQIENSEESDQGKYECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWMKGEQELT-----KEEEMPIGRNVLELTNIRQSGNYTCVAISSLGMIDTTAQITVKALPRPPASLIVTETTATSVTLTWD------SGNPEPVSYYV--IQYR-----SKISDNGFQEVDGVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQ-------KHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQ 504          

HSP 4 Score: 177.563 bits (449), Expect = 9.571e-44
Identity = 91/252 (36.11%), Postives = 141/252 (55.95%), Query Frame = 1
Query: 5626 NYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
             +E S L VN+ KNR    +  D +RV+L P+ GV GSDY N ++IDG++ + AYIATQ PL ET  DFWRM+WEQ    ++ +  + E     C+QYWP+  +  Y    V  +   +++ + +R F L      + R +RQFQF  W  D  +P     +L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++     ++ QR  ++++EDQY F   ALLE  T  + E
Sbjct: 1356 TWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAW-PDHGVPEYPTPILAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTE 1604          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Zebrafish
Match: ptprfa (protein tyrosine phosphatase receptor type Fa [Source:ZFIN;Acc:ZDB-GENE-020107-2])

HSP 1 Score: 659.833 bits (1701), Expect = 0.000e+0
Identity = 319/613 (52.04%), Postives = 423/613 (69.00%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            V +  L ++I  L+ N++  FS E+ S+D   QF+WE SN   NK KNRYANV+AYDHSRVVL            +D    +DYIN NYI+GYRKQNAYIATQGPL ET++DFWRM+WEQR+  IVM+T L E+SRVKC+QYWP  +RGT  TYG I V++    E A +  R+F + K GS EKRE++ FQF AWPDHGVP+   P L F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE+MKHEKSVD+Y +VT +RSQRNYMVQTE+QYIFIH+ LL+     NT++    L++HI+KL++           T  +LE+++L    +                            T+ + ++ L  N+ KNR    +P +++RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +   +P + E  ++ I QV KTKEQFGQ GP+TVHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K L+ QRP+++++EDQYQ C+ A LEYL
Sbjct: 1216 VSVCALADHIERLRANDSLRFSQEYESVDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLTP----------VDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWP--SRGTE-TYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHGVPEYPTPILAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTEVPARSLYTHIQKLTQAPPGDT----VTAMELEFKKLANSKA---------------------------HTSRFISASLPCNKFKNRLVNIMPFESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQG-VPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYL 1783          

HSP 2 Score: 221.861 bits (564), Expect = 2.558e-57
Identity = 115/257 (44.75%), Postives = 156/257 (60.70%), Query Frame = 1
Query: 4648 PTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            P NK KNR  N++ ++ SRV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R I+ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  +  +R+QR  MVQTE+QY   +   L+Y  S +
Sbjct: 1546 PCNKFKNRLVNIMPFESSRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLSETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQTIKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFD 1787          

HSP 3 Score: 218.779 bits (556), Expect = 2.579e-56
Identity = 148/498 (29.72%), Postives = 229/498 (45.98%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSI--RYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P  +  P + + ++     F+C + G PKP++TW+  GK    +R+ +I       SVL +   R+  + AI  C   N +G  + SA + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P+D+ S   R + L    L I  + ESD GKY+C+A+N  G+  S   +L +RV R  P F     +  +  G SV L C   G+P P+V W+ G  +LT     K +   IG   + L++I +S N TCVA +     + T  I VK LP  P  + ++E +  S  LTW             + +Y+  +  R     SK  D   +E+    +    I  L PY+ Y   ++     G   PS +   +T E  P+S P  V   + S T++ V+W+PP E NG+I  Y+V+YT     PL+ W            E+     I  L  +  Y   V +  S G+GP S I+Q
Sbjct:   33 PSFVKTPEDQTGISGGVASFVCQAVGEPKPRITWMKKGKKVSSQRFEVIEFDDGSGSVLRIQPLRTHRDEAIYECTATNSVGEINTSAKLTVLEE-DQIPHGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEISWFKDFLPVDINSSNGRIKQLRSGALQIENSEESDQGKYECVAVNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEVMPGGSVNLTCVAVGAPMPYVKWMKGEQELT-----KEEEMPIGRNVLELTNIRQSGNYTCVAISSLGMIDTTAQITVKALPRPPASLIVTETTATSVTLTWD------SGNPEPVSYYV--IQYR-----SKISDNGFQEVDGVASTRYSIGGLSPYSEYEFRVMAVNNIGRGPPSGMVETRTSEQAPSSPPLRVQARMLSATTMLVQWEPPEEPNGQIRGYRVYYTSDLHFPLSTWQ-------KHNTEDSSLTTISGLVPDITYGLRVLAFTSVGDGPPSDILQ 504          

HSP 4 Score: 177.563 bits (449), Expect = 8.768e-44
Identity = 91/252 (36.11%), Postives = 141/252 (55.95%), Query Frame = 1
Query: 5626 NYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
             +E S L VN+ KNR    +  D +RV+L P+ GV GSDY N ++IDG++ + AYIATQ PL ET  DFWRM+WEQ    ++ +  + E     C+QYWP+  +  Y    V  +   +++ + +R F L      + R +RQFQF  W D   +P     +L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++     ++ QR  ++++EDQY F   ALLE  T  + E
Sbjct: 1250 TWENSNLEVNKPKNRYANVIAYDHSRVVLTPVDGVPGSDYINGNYIDGYRKQNAYIATQGPLPETLSDFWRMVWEQRTSTIVMMTRLEEKSRVKCDQYWPSRGTETYGMIQVSMLDTVELATYSVRTFALYKNGSSEKREVRQFQFMAWPDHG-VPEYPTPILAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKSVDIYGHVTCMRSQRNYMVQTEDQYIFIHEALLEAATCGNTE 1498          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Xenopus
Match: brdt (bromodomain, testis-specific [Source:Xenbase;Acc:XB-GENE-983868])

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 340/657 (51.75%), Postives = 447/657 (68.04%), Query Frame = 1
Query: 4393 DSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            D +E++R    T PD  + S PS    D + +L+   I       PIA L E+  +LK N+N   S E+ S+D   QF+WE SN   NK+KNRYANV+AYDHSRV+L     V  I  S       DYINANYI+GYRKQNAYIATQG L ET  DFWRM+WEQRS  +VM+T L E+SR+KC+QYWP  +RGT  TYG I VT+    E A F  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GPVVVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +RSQRNYMVQTE+QY FIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL    +                            T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++ED+YQFC+ A LEYL
Sbjct: 1278 DPVEMRRINFQT-PDSGLSSPPSDHEFDFESMLNHPPI-------PIADLSEHTEHLKANDNLKLSQEYESVDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVILLP---VEGIIGS-------DYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTKLEEKSRIKCDQYWP--SRGTE-TYGMIQVTLLDTIELATFCVRTFSLHKSGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIELGE----HVTGMELEFKRLANSKA---------------------------HTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1881          

HSP 2 Score: 226.098 bits (575), Expect = 2.373e-58
Identity = 127/305 (41.64%), Postives = 175/305 (57.38%), Query Frame = 1
Query: 4522 KVPIALLQEYISNLKTNE----NRGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   E      G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE++Y F +   L+Y  S +
Sbjct: 1596 EVPARNLYTYIQKLAQIELGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1885          

HSP 3 Score: 204.527 bits (519), Expect = 7.278e-52
Identity = 163/606 (26.90%), Postives = 255/606 (42.08%), Query Frame = 1
Query:  247 RPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSI--RYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINT-KIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEIIP-----IFNNTAKSSMKI 2025
            +PK I  P +   ++     F+C + G+PKP+VTW   GK    +R+  I       +VL +   R+  +  +  CV +NV G E  SA + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P+D  S   R + L    L I  + E+D GKY+C+A N  G   S   +L +RV R +P F  +     I  G +V + C   GSP P+V W+ G   LT  +        +G   + L+++ ES N TCVA +          I VK+LP AP    ++E +  S  +TW   +              P     IE   SK  D    +I++D       I  L P + Y +W+      G   PS+    +T E  P SAPR+V   + S T++ ++W+ P+E NG+I  Y+V+YT   + P++ W       +    ++     I  L  +  Y   V +  S G+GP S  +Q         Q  N         S  + W                     P + + + K  LN    + ++        P T Y VE +      +F   A+SS  +
Sbjct:   23 KPKFIKIPTDEIGVSGGVASFVCQATGDPKPRVTWNKRGKKVNSQRFETIEFDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEVVSAKLTVLRE-DQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRSGALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMVGAEDLTPED-----DMPVGRNVLELTNVKESANYTCVAMSSLGVIESVAQITVKSLPKAPGTPVVTETTATSITVTWDSGNPD------------PVSYYVIEYK-SKSQD-GPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSSW-------LKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNFRAEAKSETSIGLTWS--------------------PPRQDSIVKYELNYREGEGVFLQIRKTFDPATSYTVEGLKPNTEYLFRLAARSSHGL 581          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Xenopus
Match: brdt (bromodomain, testis-specific [Source:Xenbase;Acc:XB-GENE-983868])

HSP 1 Score: 679.093 bits (1751), Expect = 0.000e+0
Identity = 340/657 (51.75%), Postives = 447/657 (68.04%), Query Frame = 1
Query: 4393 DSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            D +E++R    T PD  + S PS    D + +L+   I       PIA L E+  +LK N+N   S E+ S+D   QF+WE SN   NK+KNRYANV+AYDHSRV+L     V  I  S       DYINANYI+GYRKQNAYIATQG L ET  DFWRM+WEQRS  +VM+T L E+SR+KC+QYWP  +RGT  TYG I VT+    E A F  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GPVVVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +RSQRNYMVQTE+QY FIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL    +                            T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +   +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++ED+YQFC+ A LEYL
Sbjct: 1314 DPVEMRRINFQT-PDSGLSSPPSDHEFDFESMLNHPPI-------PIADLSEHTEHLKANDNLKLSQEYESVDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVILLP---VEGIIGS-------DYINANYIDGYRKQNAYIATQGALPETFGDFWRMVWEQRSATVVMMTKLEEKSRIKCDQYWP--SRGTE-TYGMIQVTLLDTIELATFCVRTFSLHKSGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIELGE----HVTGMELEFKRLANSKA---------------------------HTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQG-VPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1917          

HSP 2 Score: 225.713 bits (574), Expect = 2.490e-58
Identity = 129/307 (42.02%), Postives = 175/307 (57.00%), Query Frame = 1
Query: 4522 KVPIALLQEYISNLKTNE----NRGFSTEFV----SIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   E      G   EF     S  H ++F    +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE++Y F +   L+Y  S +
Sbjct: 1632 EVPARNLYTYIQKLAQIELGEHVTGMELEFKRLANSKAHTSRFI--SANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1921          

HSP 3 Score: 201.06 bits (510), Expect = 1.042e-50
Identity = 147/506 (29.05%), Postives = 229/506 (45.26%), Query Frame = 1
Query:  247 RPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSI--RYQMLDGKN------LFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINT-KIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            +PK I  P +   ++     F+C + G+PKP+VTW   GK    +R+  I       +VL +   R+  +  +  CV +NV G E  SA + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P+D  S   R + L  +N      L I  + E+D GKY+C+A N  G   S   +L +RV R +P F  +     I  G +V + C   GSP P+V W+ G   LT  +        +G   + L+++ ES N TCVA +          I VK+LP AP    ++E +  S  +TW   +              P     IE   SK  D    +I++D       I  L P + Y +W+      G   PS+    +T E  P SAPR+V   + S T++ ++W+ P+E NG+I  Y+V+YT   + P++ W       +    ++     I  L  +  Y   V +  S G+GP S  +Q
Sbjct:   29 KPKFIKIPTDEIGVSGGVASFVCQATGDPKPRVTWNKRGKKVNSQRFETIEFDEGAGAVLRIQPLRTPRDENVYECVAQNVHGEEVVSAKLTVLRE-DQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRSENTPIRGALQIENSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMVGAEDLTPED-----DMPVGRNVLELTNVKESANYTCVAMSSLGVIESVAQITVKSLPKAPGTPVVTETTATSITVTWDSGNPD------------PVSYYVIEYK-SKSQD-GPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSSW-------LKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQ 507          

HSP 4 Score: 55.8398 bits (133), Expect = 1.283e-6
Identity = 112/525 (21.33%), Postives = 203/525 (38.67%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKP-----------QLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQK---NSNVTLECLVFGQSKITVVWF---KDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISE--------------ISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKI---MELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKE-------DPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEG 1701
            P I   P+   V   +    +C + GNP P++TW  +  P           QL      IR + L + ++   D G    CV  N  G    S+   +Y  +  V   F      S + VS +     NV + C+  G     V W    +D  P D       M  G+N+  L  ++ ++  Y C+A++  G + S A+ + ++    +P    V+      T +S+ +     G+P P  +++    K    +G     E+I +    +  +S +        ++ E     V+ I +  P  P + R  E              +S  + ++ W+        I  + V+Y     +  +QP+S     S  +   D ++ T I   +E + YT   L   + G   +S+P ++ + Q +  +P +          SETS+ + W PP + +  I  Y++ Y + +        DP T +++  LK                   NT Y F + +R+S G G
Sbjct:  132 PNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPASSNGRIKQLRSENTPIRGA-LQIENSEETDQGKY-ECVATNSAGVR-YSSPANLYVRVRRVAPRF------SILPVSHEIMPGGNVNITCVAVGSPMPYVKWMVGAEDLTPED------DMPVGRNVLELTNVK-ESANYTCVAMSSLGVIESVAQ-ITVKSLPKAPGTPVVTET----TATSITVTWD-SGNPDPVSYYVI-EYKSKSQDGPYQIKEDITTTRYSIGGLSPN--------SEYEIWVSAVNSIGQGPPSEPVVTRTGEQAPASAPRNVQARMLSSTTMIIQWEEPVEPNGQIRGYRVYYT----MEPDQPVS-----SWLKYNVDDSLLTTIGSLLEHETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMN----FRAEAKSETSIGLTWSPPRQDS--IVKYELNYREGEGGNEVRTFDPATSYTVEGLK------------------PNTEYLFRLAARSSHGLG 592          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 326/613 (53.18%), Postives = 434/613 (70.80%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L ++I  LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L           +++    +DYIN+NYI+GYRKQNAYIATQGPL ET  DFWRM+WEQR+  IVM+T L ERSR+KC+QYWP  +RGT  TYG I +T+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE+++HEK+VD+Y +VT +R+QRNYMVQTE+QYIFIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQFC+ A LEYL
Sbjct: 1341 IPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL----------SAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWP--SRGTE-TYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ASSKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYL 1908          

HSP 2 Score: 228.794 bits (582), Expect = 3.253e-59
Identity = 129/305 (42.30%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++ K  E+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  +VQTE+QY F +   L+Y  S +
Sbjct: 1623 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYLGSFD 1912          

HSP 3 Score: 201.06 bits (510), Expect = 9.457e-51
Identity = 142/498 (28.51%), Postives = 222/498 (44.58%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDL--RSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            PK+   P +   ++     FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    +  + V  + + +P+GFP       + V ++    T+ C   G     + WFKD+ P+D    + R + L    L I ++ ESD GKY+C+A N  G+  S   +L +RV R +P F     +  I  G SV + C   GSP P+V W+ G+  LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P    ++E +  S  LTW   +                V   I Q   K  +   KEI         +  L PY+ Y   +V     G   PS+    +T E  P+S PR+V   + S T++ V+W+ P E NG+I  Y+V+YT      +  W+ +++        + +   I  L+    Y   V +  S G+GP S  +Q
Sbjct:   31 PKLTRTPVDQIGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNSVGEVATTTRLTVLRE-DQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDYLPVDTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRVRRIAPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPED-----DMPIGRNVLELTDVRQSANYTCVAMSTLGVIEAIAQINVKALPKPPGTPMVTESTATSITLTWDSGNPE-------------PVSYYIIQHKPKSSEEQYKEIDGVATTRYSVAGLSPYSEYEFRVVAVNNIGRGPPSEPVMTRTSEQAPSSPPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMDPTQHINSWTKHNVA-------DSQITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQ 502          

HSP 4 Score: 177.178 bits (448), Expect = 1.668e-43
Identity = 90/251 (35.86%), Postives = 143/251 (56.97%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I G+ GSDY N+++IDG++ + AYIATQ PL ET  DFWRM+WEQ    ++ +  + E     C+QYWP+  +  Y    +  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE+++ +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1376 WEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRGTETYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKTCNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE 1623          

HSP 5 Score: 66.2402 bits (160), Expect = 8.829e-10
Identity = 136/615 (22.11%), Postives = 247/615 (40.16%), Query Frame = 1
Query:  232 YEKIKR--PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTG-------KYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFI--RTGSSVKLKCSGEGSPTPH-------VFWICGNTK----LTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKE-IQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKW-KPPIE-TNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGP-SSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPIS-----KVNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEI 1983
            Y +++R  P+    P N  ++    +   C++ G+P P V W+   +   PE    I  +VL L+  R   N    +CV  + +G  +  A I V        K  PK  G   +T S   S +TL     G  +    +     P      +Y+ +DG    +  T  S  G       +++ +A+N  G    P++ +M R S  +P     SP + +  R  SS  +    E    P+       V++    T+     T  N    Q   IG++E   +   + L  T V       +N    I    +P  P   +    S  S LL+W      + +I+S+ ++Y             K+ D + ++ I  D   + ++  LKP + Y   L      G+   +   S +T++++P++ P+ +     S TS+ V W  PP+E  NG+I  Y + YT    D      I  L I +E ++      +  L++ T Y   + +    G GP SS I+ +   D      + + +  V S S  + W+  P++     ++  +++  +   +   +   + K  +    +++I    IS L P T Y + +
Sbjct:  222 YVRVRRIAPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPEDDMPIGRNVLELTDVRQSAN---YTCVAMSTLGVIEAIAQINV--------KALPKPPGTPMVTESTATS-ITL-TWDSGNPEPVSYYIIQHKPKSSEE-QYKEIDG----VATTRYSVAGLSPYSEYEFRVVAVNNIGRG-PPSEPVMTRTSEQAPS----SPPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMDPTQHINSWTKHNVADSQITTIGNLEPQKTYSVKVLAFTSVGDGP--LSNDIQVITQTGVPSQPLNFKAEPESETSILLSWT--PPRSDTISSYDLYY-------------KEGDHAEEQVITIDPATSYRLQGLKPNSLYYFRLAARAQVGLGASTAEISARTMQSKPSAPPQDIRCNSQSSTSILVSWLPPPVEKQNGKIMGYSIKYTGVDTDDAKSHEI--LSISSETRQ----YLLEQLEKWTQYRIIMIAYTDVGPGPESSPILIRTDEDVPSGPPRKVEVEAVNSTSVKVSWR-SPVANKQHGQIRGYQVHYVRMENGEPKGQPMLKDVMLADAQEMI----ISGLQPETAYSITV 785          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 326/613 (53.18%), Postives = 434/613 (70.80%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L ++I  LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L           +++    +DYIN+NYI+GYRKQNAYIATQGPL ET  DFWRM+WEQR+  IVM+T L ERSR+KC+QYWP  +RGT  TYG I +T+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE+++HEK+VD+Y +VT +R+QRNYMVQTE+QYIFIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQFC+ A LEYL
Sbjct: 1327 IPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL----------SAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWP--SRGTE-TYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ASSKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYL 1894          

HSP 2 Score: 228.409 bits (581), Expect = 4.085e-59
Identity = 129/305 (42.30%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++ K  E+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  +VQTE+QY F +   L+Y  S +
Sbjct: 1609 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYLGSFD 1898          

HSP 3 Score: 195.667 bits (496), Expect = 4.163e-49
Identity = 142/504 (28.17%), Postives = 222/504 (44.05%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIR---YQMLDGKN-----LFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            PK+   P +   ++     FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    +  + V  + + +P+GFP       + V ++    T+ C   G     + WFKD+ P+D  +      Q+  G       L I ++ ESD GKY+C+A N  G+  S   +L +RV R +P F     +  I  G SV + C   GSP P+V W+ G+  LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P    ++E +  S  LTW   +                V   I Q   K  +   KEI         +  L PY+ Y   +V     G   PS+    +T E  P+S PR+V   + S T++ V+W+ P E NG+I  Y+V+YT      +  W+ +++        + +   I  L+    Y   V +  S G+GP S  +Q
Sbjct:    7 PKLTRTPVDQIGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNSVGEVATTTRLTVLRE-DQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDYLPVDTSNNNGRIKQLRSGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRVRRIAPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPED-----DMPIGRNVLELTDVRQSANYTCVAMSTLGVIEAIAQINVKALPKPPGTPMVTESTATSITLTWDSGNPE-------------PVSYYIIQHKPKSSEEQYKEIDGVATTRYSVAGLSPYSEYEFRVVAVNNIGRGPPSEPVMTRTSEQAPSSPPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMDPTQHINSWTKHNVA-------DSQITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQ 484          

HSP 4 Score: 177.178 bits (448), Expect = 1.883e-43
Identity = 90/251 (35.86%), Postives = 143/251 (56.97%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I G+ GSDY N+++IDG++ + AYIATQ PL ET  DFWRM+WEQ    ++ +  + E     C+QYWP+  +  Y    +  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE+++ +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1362 WEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRGTETYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKTCNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE 1609          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Xenopus
Match: sema6d (semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070])

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 326/613 (53.18%), Postives = 434/613 (70.80%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L ++I  LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L           +++    +DYIN+NYI+GYRKQNAYIATQGPL ET  DFWRM+WEQR+  IVM+T L ERSR+KC+QYWP  +RGT  TYG I +T+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE+++HEK+VD+Y +VT +R+QRNYMVQTE+QYIFIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQFC+ A LEYL
Sbjct: 1323 IPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL----------SAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWP--SRGTE-TYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ASSKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYL 1890          

HSP 2 Score: 228.794 bits (582), Expect = 3.619e-59
Identity = 129/305 (42.30%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++ K  E+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  +VQTE+QY F +   L+Y  S +
Sbjct: 1605 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAVVQTEDQYQFCYRAGLEYLGSFD 1894          

HSP 3 Score: 192.2 bits (487), Expect = 4.531e-48
Identity = 139/485 (28.66%), Postives = 215/485 (44.33%), Query Frame = 1
Query:  307 FICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIR---YQMLDGKN-----LFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    +  + V  + + +P+GFP       + V ++    T+ C   G     + WFKD+ P+D  +      Q+  G       L I ++ ESD GKY+C+A N  G+  S   +L +RV R +P F     +  I  G SV + C   GSP P+V W+ G+  LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P    ++E +  S  LTW   +                V   I Q   K  +   KEI         +  L PY+ Y   +V     G   PS+    +T E  P+S PR+V   + S T++ V+W+ P E NG+I  Y+V+YT      +  W+ +++        + +   I  L+    Y   V +  S G+GP S  +Q
Sbjct:   36 FICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNSVGEVATTTRLTVLRE-DQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDYLPVDTSNNNGRIKQLRSGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRVRRIAPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPED-----DMPIGRNVLELTDVRQSANYTCVAMSTLGVIEAIAQINVKALPKPPGTPMVTESTATSITLTWDSGNPE-------------PVSYYIIQHKPKSSEEQYKEIDGVATTRYSVAGLSPYSEYEFRVVAVNNIGRGPPSEPVMTRTSEQAPSSPPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMDPTQHINSWTKHNVA-------DSQITTIGNLEPQKTYSVKVLAFTSVGDGPLSNDIQ 494          

HSP 4 Score: 177.178 bits (448), Expect = 1.787e-43
Identity = 90/251 (35.86%), Postives = 143/251 (56.97%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I G+ GSDY N+++IDG++ + AYIATQ PL ET  DFWRM+WEQ    ++ +  + E     C+QYWP+  +  Y    +  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE+++ +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1358 WEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYINSNYIDGYRKQNAYIATQGPLPETFGDFWRMMWEQRTATIVMMTKLEERSRIKCDQYWPSRGTETYGLIQITLLDTVELATYTVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKTCNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIRHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE 1605          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 327/613 (53.34%), Postives = 431/613 (70.31%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  + E++  LK N++   S E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+LQ           L+    +DYINANY++GYR+QNAYIATQGPL ET  DFWRM+WEQRS  +VM+T L E+SR+KC+QYWP  NRGT  TYG I VT+    E A F  R+F + K GS EKRE++HFQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++K EK+VDVY +VT +RSQRNYMVQTE+QY FIH+ LL+     NT++    L+++I+KL+++E  +      TG +LE++RL   +S  +H                        T+ + T+ L  N+ KNR    LP +++RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWR LWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +    P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++ED+YQFCF A LEYL
Sbjct: 1332 IPITDMAEHMERLKANDSLKLSQEYESIDPGQQFTWEHSNLEANKPKNRYANVIAYDHSRVILQP----------LEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWP--NRGTE-TYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVEPGE----HVTGMELEFKRL---ASSKAH------------------------TSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGA-PKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYL 1899          

HSP 2 Score: 220.705 bits (561), Expect = 6.612e-57
Identity = 125/305 (40.98%), Postives = 172/305 (56.39%), Query Frame = 1
Query: 4522 KVPIALLQEYISNLKTNEN----RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   E      G   EF  ++   A+   +  ++ P NK KNR  N++ Y+ SRV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWR +WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ G P+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE++Y F     L+Y  S +
Sbjct: 1614 EVPARSLYTYIQKLAQVEPGEHVTGMELEFKRLASSKAHTSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFD 1903          

HSP 3 Score: 196.438 bits (498), Expect = 1.937e-49
Identity = 147/527 (27.89%), Postives = 233/527 (44.21%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNII-----RDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD--LRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINT-KIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILW 1806
            P+ I  P++   ++     F+C + G+PKP+VTW   GK    +R+  I       +VL +   R+  +  +  CV +N +G     A + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P+D    + R + L    L I  + E+D GKY+C+A N  G   S   +L +RV R +P F  +     I  G +V + C   GSP P+V W+ G   LT  +        +G   + L+D+ +S N TCVA +          I VK+LP AP    ++E +  S  +TW             + +Y+      IE   SK  D    +I++D       I  L P + Y +W+      G   PS+    +T E  P SAPR+V   + S T++ V+W+ P+E NG I  Y+V+YT   E P+  W  +++       ++     +  L  +  Y   V +  S G+GP S  +Q         Q  NL        S  + W
Sbjct:   33 PRFIREPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIDFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITIHAKLTVLRE-DQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPED-----DMPVGRNVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITVTWD------SGNPDPVSYYV------IEY-KSKSQD-GPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-------DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSW 532          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 326/613 (53.18%), Postives = 433/613 (70.64%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L ++I  LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L           +++    +DY+NANYI+GYRKQNAYIATQG L ET  DFWRMIWEQRS  +VM+T L ERSRVKC+QYWP  +RGT  T+G + VT+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QYIFIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS++DG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +   +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQFC+ A LEYL
Sbjct: 1315 IPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL----------SAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWP--SRGTE-THGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ASSKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQG-VPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYL 1882          

HSP 2 Score: 230.335 bits (586), Expect = 7.102e-60
Identity = 129/305 (42.30%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++++GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1597 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFD 1886          

HSP 3 Score: 199.134 bits (505), Expect = 2.754e-50
Identity = 145/498 (29.12%), Postives = 219/498 (43.98%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDL--RSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+    P + + ++     FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    S  + V  + + +P+GFP       + V ++    T+ C   G     + WFKDF P+D    + R + L    L I ++ ESD GKY+C+A N  G+  S   +L +RV R  P F     +  I  G SV + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P    ++E +  S  LTW   +                V   I Q   K+ +   KEI         +  L PY++Y   +V     G    S+    QT E  P+SAPR V   + S T++ V+WK P E NG+I  Y+V+YT      +  W  +++        + +   I  L     Y   V +  S G+GP S  +Q
Sbjct:   24 PRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRE-DQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPE-------------PVSYYIIQHKPKNSEEPYKEIDGIATTRYSVAGLSPYSDYEFRVVAVNNIGRGPASEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVA-------DSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQ 495          

HSP 4 Score: 173.711 bits (439), Expect = 1.305e-42
Identity = 92/251 (36.65%), Postives = 142/251 (56.57%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I G+ GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ    V+ +  + E     C+QYWP+  +  +    V  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1350 WEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKTCNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE 1597          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 327/613 (53.34%), Postives = 431/613 (70.31%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  + E++  LK N++   S E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+LQ           L+    +DYINANY++GYR+QNAYIATQGPL ET  DFWRM+WEQRS  +VM+T L E+SR+KC+QYWP  NRGT  TYG I VT+    E A F  R+F + K GS EKRE++HFQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++K EK+VDVY +VT +RSQRNYMVQTE+QY FIH+ LL+     NT++    L+++I+KL+++E  +      TG +LE++RL   +S  +H                        T+ + T+ L  N+ KNR    LP +++RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWR LWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +    P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++ED+YQFCF A LEYL
Sbjct:  922 IPITDMAEHMERLKANDSLKLSQEYESIDPGQQFTWEHSNLEANKPKNRYANVIAYDHSRVILQP----------LEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWP--NRGTE-TYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVEPGE----HVTGMELEFKRL---ASSKAH------------------------TSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGA-PKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYL 1489          

HSP 2 Score: 220.705 bits (561), Expect = 4.679e-57
Identity = 125/305 (40.98%), Postives = 172/305 (56.39%), Query Frame = 1
Query: 4522 KVPIALLQEYISNLKTNEN----RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   E      G   EF  ++   A+   +  ++ P NK KNR  N++ Y+ SRV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWR +WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ G P+    F+ FI ++ K  E+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE++Y F     L+Y  S +
Sbjct: 1204 EVPARSLYTYIQKLAQVEPGEHVTGMELEFKRLASSKAHTSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFD 1493          

HSP 3 Score: 196.438 bits (498), Expect = 1.340e-49
Identity = 142/499 (28.46%), Postives = 225/499 (45.09%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNII-----RDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD--LRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINT-KIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+ I  P++   ++     F+C + G+PKP+VTW   GK    +R+  I       +VL +   R+  +  +  CV +N +G     A + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P+D    + R + L    L I  + E+D GKY+C+A N  G   S   +L +RV R +P F  +     I  G +V + C   GSP P+V W+ G   LT  +        +G   + L+D+ +S N TCVA +          I VK+LP AP    ++E +  S  +TW   +              P     IE   SK  D    +I++D       I  L P + Y +W+      G   PS+    +T E  P SAPR+V   + S T++ V+W+ P+E NG I  Y+V+YT   E P+  W  +++       ++     +  L  +  Y   V +  S G+GP S  +Q
Sbjct:   33 PRFIREPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIDFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITIHAKLTVLRE-DQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPED-----DMPVGRNVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITVTWDSGNPD------------PVSYYVIEYK-SKSQD-GPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-------DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQ 504          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Mouse
Match: Ptprd (protein tyrosine phosphatase, receptor type, D [Source:MGI Symbol;Acc:MGI:97812])

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 326/613 (53.18%), Postives = 433/613 (70.64%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L ++I  LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L +          ++    +DY+NANYI+GYRKQNAYIATQG L ET  DFWRMIWEQRS  +VM+T L ERSRVKC+QYWP  +RGT  T+G + VT+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QYIFIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS++DG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQFC+ A LEYL
Sbjct: 1337 IPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSA----------IEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWP--SRGTE-THGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ASSKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYL 1904          

HSP 2 Score: 230.335 bits (586), Expect = 8.609e-60
Identity = 129/305 (42.30%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++++GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++ K  E+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1619 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFD 1908          

HSP 3 Score: 191.045 bits (484), Expect = 6.843e-48
Identity = 145/511 (28.38%), Postives = 222/511 (43.44%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD-------LRSIRYQMLDG----KNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIR----VSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+    P + + ++     FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    S  + V  + + +P+GFP       + V ++    T+ C   G     + WFKDF P+D       ++ +R + + G      L I ++ ESD GKY+C+A N  G+  S   +L +R    V R  P F     +  I  G SV + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P    ++E +  S  LTW   +                V   I Q   K+ +   KEI         +  L PY++Y   +V     G    S+    QT E  P+SAPR V   + S T++ V+WK P E NG+I  Y+V+YT      +  W  +++        + +   I  L     Y   V +  S G+GP S  +Q
Sbjct:   24 PRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRE-DQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPE-------------PVSYYIIQHKPKNSEEPYKEIDGIATTRYSVAGLSPYSDYEFRVVAVNNIGRGPASEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVA-------DSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQ 508          

HSP 4 Score: 173.711 bits (439), Expect = 1.519e-42
Identity = 92/251 (36.65%), Postives = 142/251 (56.57%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I G+ GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ    V+ +  + E     C+QYWP+  +  +    V  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1372 WEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKTCNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE 1619          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Mouse
Match: Ptprs (protein tyrosine phosphatase, receptor type, S [Source:MGI Symbol;Acc:MGI:97815])

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 327/613 (53.34%), Postives = 431/613 (70.31%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  + E++  LK N++   S E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+LQ           L+    +DYINANY++GYR+QNAYIATQGPL ET  DFWRM+WEQRS  +VM+T L E+SR+KC+QYWP  NRGT  TYG I VT+    E A F  R+F + K GS EKRE++HFQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++K EK+VDVY +VT +RSQRNYMVQTE+QY FIH+ LL+     NT++    L+++I+KL+++E  +      TG +LE++RL   +S  +H                        T+ + T+ L  N+ KNR    LP +++RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWR LWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +    P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++ED+YQFCF A LEYL
Sbjct:  926 IPITDMAEHMERLKANDSLKLSQEYESIDPGQQFTWEHSNLEANKPKNRYANVIAYDHSRVILQP----------LEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWP--NRGTE-TYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVEPGE----HVTGMELEFKRL---ASSKAH------------------------TSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGA-PKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYL 1493          

HSP 2 Score: 220.32 bits (560), Expect = 5.674e-57
Identity = 125/305 (40.98%), Postives = 172/305 (56.39%), Query Frame = 1
Query: 4522 KVPIALLQEYISNLKTNEN----RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   E      G   EF  ++   A+   +  ++ P NK KNR  N++ Y+ SRV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWR +WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ G P+    F+ FI ++ K  E+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE++Y F     L+Y  S +
Sbjct: 1208 EVPARSLYTYIQKLAQVEPGEHVTGMELEFKRLASSKAHTSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFD 1497          

HSP 3 Score: 196.052 bits (497), Expect = 1.970e-49
Identity = 142/499 (28.46%), Postives = 225/499 (45.09%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNII-----RDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD--LRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINT-KIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+ I  P++   ++     F+C + G+PKP+VTW   GK    +R+  I       +VL +   R+  +  +  CV +N +G     A + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P+D    + R + L    L I  + E+D GKY+C+A N  G   S   +L +RV R +P F  +     I  G +V + C   GSP P+V W+ G   LT  +        +G   + L+D+ +S N TCVA +          I VK+LP AP    ++E +  S  +TW   +              P     IE   SK  D    +I++D       I  L P + Y +W+      G   PS+    +T E  P SAPR+V   + S T++ V+W+ P+E NG I  Y+V+YT   E P+  W  +++       ++     +  L  +  Y   V +  S G+GP S  +Q
Sbjct:   33 PRFIREPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIDFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITIHAKLTVLRE-DQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPED-----DMPVGRNVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITVTWDSGNPD------------PVSYYVIEYK-SKSQD-GPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-------DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQ 504          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. UniProt/SwissProt
Match: sp|Q64605|PTPRS_RAT (Receptor-type tyrosine-protein phosphatase S OS=Rattus norvegicus OX=10116 GN=Ptprs PE=1 SV=2)

HSP 1 Score: 678.322 bits (1749), Expect = 0.000e+0
Identity = 328/613 (53.51%), Postives = 431/613 (70.31%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  + E++  LK N++   S E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+LQ           L+    +DYINANY++GYR+QNAYIATQGPL ET  DFWRM+WEQRS  +VM+T L E+SRVKC+QYWP  NRGT  TYG I VT+    E A F  R+F + K GS EKRE++HFQFTAWPDHGVP+   PFL F+ R+K   P D+GPVVVHCSAGVGRTG +I +DAMLE+++ EK+VDVY +VT +RSQRNYMVQTE+QY FIH+ LL+     NT++    L+++I+KL+++E  +      TG +LE++RL   +S  +H                        T+ + T+ L  N+ KNR    LP +++RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWR LWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +    P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++ED+YQFCF A LEYL
Sbjct: 1332 IPITDMAEHMERLKANDSLKLSQEYESIDPGQQFTWEHSNLEANKPKNRYANVIAYDHSRVILQP----------LEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRVKCDQYWP--NRGTE-TYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIRTEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVEPGE----HVTGMELEFKRL---ASSKAH------------------------TSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGA-PKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYL 1899          

HSP 2 Score: 221.09 bits (562), Expect = 4.143e-56
Identity = 125/305 (40.98%), Postives = 172/305 (56.39%), Query Frame = 1
Query: 4522 KVPIALLQEYISNLKTNEN----RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   E      G   EF  ++   A+   +  ++ P NK KNR  N++ Y+ SRV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWR +WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ G P+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE++Y F     L+Y  S +
Sbjct: 1614 EVPARSLYTYIQKLAQVEPGEHVTGMELEFKRLASSKAHTSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFD 1903          

HSP 3 Score: 196.438 bits (498), Expect = 1.310e-48
Identity = 147/527 (27.89%), Postives = 233/527 (44.21%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNII-----RDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSI--RYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINT-KIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILW 1806
            P+ I  P++   ++     F+C + G+PKP+VTW   GK    +R+  I       +VL +   R+  +  +  CV +N +G     A + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P+D  +   R + L    L I  + E+D GKY+C+A N  G   S   +L +RV R +P F  +     I  G +V + C   GSP P+V W+ G   LT  +        +G   + L+D+ +S N TCVA +          I VK+LP AP    ++E +  S  +TW             + +Y+      IE   SK  D    +I++D       I  L P + Y +W+      G   PS+    +T E  P SAPR+V   + S T++ V+W+ P+E NG I  Y+V+YT   E P+  W  +++       ++     +  L  +  Y   V +  S G+GP S  +Q         Q  NL        S  + W
Sbjct:   33 PRFIREPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIDFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLRE-DQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPED-----DMPVGRNVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITVTWD------SGNPDPVSYYV------IEY-KSKSQD-GPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-------DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSW 532          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. UniProt/SwissProt
Match: sp|F1NWE3|PTPRS_CHICK (Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3)

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 340/657 (51.75%), Postives = 445/657 (67.73%), Query Frame = 1
Query: 4393 DSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            D +E++R    T PD  + S  S    D + +LS   I       P++ L E+  +LK N+N   S E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L     +  I  S       DYINANYI+GYRKQNAYIATQGPL ET  DFWRM+WEQRS  IVM+T L E+SR+KC+QYWP   RGT  TYG I VT+    E A F  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +RSQRNYMVQTE+QY FIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL    +                            T+ + ++ L  N+ KNR    +P +T RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +   +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++ED+YQFC+ A LEYL
Sbjct:  905 DPVEMRRINFQT-PDSGLSSPLSDPEFDFESMLSHPPI-------PVSELAEHTEHLKANDNLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILLP---IEGIVGS-------DYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTKLEEKSRIKCDQYWP--GRGTD-TYGMIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYSFIHDALLEAVACGNTEVPARNLYTYIQKLAQIEVGE----HVTGMELEFKRLANSKA---------------------------HTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQG-VPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1508          

HSP 2 Score: 226.098 bits (575), Expect = 8.298e-58
Identity = 127/305 (41.64%), Postives = 175/305 (57.38%), Query Frame = 1
Query: 4522 KVPIALLQEYISNLKTNEN----RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   E      G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE++Y F +   L+Y  S +
Sbjct: 1223 EVPARNLYTYIQKLAQIEVGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGV----------EGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1512          

HSP 3 Score: 188.348 bits (477), Expect = 2.726e-46
Identity = 141/503 (28.03%), Postives = 224/503 (44.53%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD--LRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIR----VSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINT-KIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P  I  P +   ++     F+C + G+PKP+VTW   GK    +R+  I       +VL +   R+  +  I  CV +N  G     A + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P+D    + R + L    L I  + E+D GKY+C+A N  G   S   +L +R    V R +P F  +     I  G +V + C   GSP P+V W+ G   LT  +        +G   + L+D+ +S N TCVA +          I VK+LP AP    ++E +  S  +TW   +              P     IE   SK  D    +I++D       I  L P + Y +W+      G   PS+    +T E  P SAPR+V   + S T++ ++W+ P+E NG+I  Y+V+YT   + P++ W  +++       ++     +  L  +  Y   V +  S G+GP S  +Q
Sbjct:   32 PVFIKKPVDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIEFDESAGAVLRIQPLRTPRDENIYECVAQNPHGEVTVHAKLTVLRE-DQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSTSNGRIKQLRSGGLQIESSEETDQGKYECVASNSAGVRYSSPANLYVRELREVRRVAPRFSILPVSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPED-----DMPVGRNVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTETTATSITITWDSGNPD------------PVSYYVIEY-KSKSQD-GPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQGRMLSSTTMIIQWEEPVEPNGQIRGYRVYYTMEPDQPVSNWQKHNV-------DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQ 507          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. UniProt/SwissProt
Match: sp|B0V2N1|PTPRS_MOUSE (Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1)

HSP 1 Score: 677.552 bits (1747), Expect = 0.000e+0
Identity = 327/613 (53.34%), Postives = 431/613 (70.31%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  + E++  LK N++   S E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+LQ           L+    +DYINANY++GYR+QNAYIATQGPL ET  DFWRM+WEQRS  +VM+T L E+SR+KC+QYWP  NRGT  TYG I VT+    E A F  R+F + K GS EKRE++HFQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++K EK+VDVY +VT +RSQRNYMVQTE+QY FIH+ LL+     NT++    L+++I+KL+++E  +      TG +LE++RL   +S  +H                        T+ + T+ L  N+ KNR    LP +++RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWR LWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +    P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++ED+YQFCF A LEYL
Sbjct: 1332 IPITDMAEHMERLKANDSLKLSQEYESIDPGQQFTWEHSNLEANKPKNRYANVIAYDHSRVILQP----------LEGIMGSDYINANYVDGYRRQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWP--NRGTE-TYGFIQVTLLDTMELATFCVRTFSLHKNGSSEKREVRHFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKTEKTVDVYGHVTLMRSQRNYMVQTEDQYGFIHEALLEAVGCGNTEVPARSLYTYIQKLAQVEPGE----HVTGMELEFKRL---ASSKAH------------------------TSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGA-PKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYL 1899          

HSP 2 Score: 220.705 bits (561), Expect = 4.625e-56
Identity = 125/305 (40.98%), Postives = 172/305 (56.39%), Query Frame = 1
Query: 4522 KVPIALLQEYISNLKTNEN----RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   E      G   EF  ++   A+   +  ++ P NK KNR  N++ Y+ SRV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWR +WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ G P+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE++Y F     L+Y  S +
Sbjct: 1614 EVPARSLYTYIQKLAQVEPGEHVTGMELEFKRLASSKAHTSRFITASLPCNKFKNRLVNILPYESSRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRALWENNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGAPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKVLRTQRPAMVQTEDEYQFCFQAALEYLGSFD 1903          

HSP 3 Score: 196.438 bits (498), Expect = 1.389e-48
Identity = 147/527 (27.89%), Postives = 233/527 (44.21%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNII-----RDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSI--RYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINT-KIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILW 1806
            P+ I  P++   ++     F+C + G+PKP+VTW   GK    +R+  I       +VL +   R+  +  +  CV +N +G     A + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P+D  +   R + L    L I  + E+D GKY+C+A N  G   S   +L +RV R +P F  +     I  G +V + C   GSP P+V W+ G   LT  +        +G   + L+D+ +S N TCVA +          I VK+LP AP    ++E +  S  +TW             + +Y+      IE   SK  D    +I++D       I  L P + Y +W+      G   PS+    +T E  P SAPR+V   + S T++ V+W+ P+E NG I  Y+V+YT   E P+  W  +++       ++     +  L  +  Y   V +  S G+GP S  +Q         Q  NL        S  + W
Sbjct:   33 PRFIREPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNSQRFETIDFDESSGAVLRIQPLRTPRDENVYECVAQNSVGEITIHAKLTVLRE-DQLPPGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSGALQIESSEETDQGKYECVATNSAGVRYSSPANLYVRVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPED-----DMPVGRNVLELTDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPVVTENTATSITVTWD------SGNPDPVSYYV------IEY-KSKSQD-GPYQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEPVEPNGLIRGYRVYYTMEPEHPVGNWQKHNV-------DDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVPGQPMNLRAEAKSETSIGLSW 532          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. UniProt/SwissProt
Match: sp|Q64487|PTPRD_MOUSE (Receptor-type tyrosine-protein phosphatase delta OS=Mus musculus OX=10090 GN=Ptprd PE=1 SV=3)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 326/613 (53.18%), Postives = 433/613 (70.64%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L ++I  LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L +          ++    +DY+NANYI+GYRKQNAYIATQG L ET  DFWRMIWEQRS  +VM+T L ERSRVKC+QYWP  +RGT  T+G + VT+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QYIFIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS++DG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQFC+ A LEYL
Sbjct: 1337 IPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLSA----------IEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWP--SRGTE-THGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ASSKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYL 1904          

HSP 2 Score: 230.335 bits (586), Expect = 6.022e-59
Identity = 129/305 (42.30%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++++GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++ K  E+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1619 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFLDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFD 1908          

HSP 3 Score: 191.045 bits (484), Expect = 4.786e-47
Identity = 145/511 (28.38%), Postives = 222/511 (43.44%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD-------LRSIRYQMLDG----KNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIR----VSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+    P + + ++     FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    S  + V  + + +P+GFP       + V ++    T+ C   G     + WFKDF P+D       ++ +R + + G      L I ++ ESD GKY+C+A N  G+  S   +L +R    V R  P F     +  I  G SV + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P    ++E +  S  LTW   +                V   I Q   K+ +   KEI         +  L PY++Y   +V     G    S+    QT E  P+SAPR V   + S T++ V+WK P E NG+I  Y+V+YT      +  W  +++        + +   I  L     Y   V +  S G+GP S  +Q
Sbjct:   24 PRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRE-DQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWDSGNPE-------------PVSYYIIQHKPKNSEEPYKEIDGIATTRYSVAGLSPYSDYEFRVVAVNNIGRGPASEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVA-------DSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQ 508          

HSP 4 Score: 173.711 bits (439), Expect = 1.063e-41
Identity = 92/251 (36.65%), Postives = 142/251 (56.57%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I G+ GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ    V+ +  + E     C+QYWP+  +  +    V  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1372 WEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKTCNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE 1619          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. UniProt/SwissProt
Match: sp|P23468|PTPRD_HUMAN (Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2)

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 326/613 (53.18%), Postives = 432/613 (70.47%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L ++I  LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L           +++    +DY+NANYI+GYRKQNAYIATQG L ET  DFWRMIWEQRS  +VM+T L ERSRVKC+QYWP  +RGT  T+G + VT+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QYIFIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQF + A LEYL
Sbjct: 1337 IPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLL----------SAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWP--SRGTE-THGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ASSKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYL 1904          

HSP 2 Score: 230.72 bits (587), Expect = 4.047e-59
Identity = 130/305 (42.62%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++ K  E+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1619 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFSYRAALEYLGSFD 1908          

HSP 3 Score: 194.512 bits (493), Expect = 5.154e-48
Identity = 145/511 (28.38%), Postives = 225/511 (44.03%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD-------LRSIRYQMLDG----KNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIR----VSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            P+    P + + ++     FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    S  + V  + + +P+GFP       + V ++    T+ C   G     + WFKDF P+D       ++ +R + + G      L I ++ ESD GKY+C+A N  G+  S   +L +R    V R  P F     +  I  G SV + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P    ++E +  S  LTW             + +YI     +  + L K+ID  +            +  L PY++Y   +V     G   PS+    QT E  P+SAPR V   + S T++ V+WK P E NG+I  Y+V+YT      +  W  +++        + +   I  L     Y   V +  S G+GP S  +Q
Sbjct:   24 PRFTRTPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNNVGEISVSTRLTVLRE-DQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNNGRIKQLRSESIGGTPIRGALQIEQSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTESTATSITLTWD------SGNPEPVSYYIIQHKPKNSEELYKEIDGVA-------TTRYSVAGLSPYSDYEFRVVAVNNIGRGPPSEPVLTQTSEQAPSSAPRDVQARMLSSTTILVQWKEPEEPNGQIQGYRVYYTMDPTQHVNNWMKHNVA-------DSQITTIGNLVPQKTYSVKVLAFTSIGDGPLSSDIQ 508          

HSP 4 Score: 174.096 bits (440), Expect = 8.533e-42
Identity = 92/251 (36.65%), Postives = 142/251 (56.57%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I G+ GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ    V+ +  + E     C+QYWP+  +  +    V  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1372 WEHSNLEVNKPKNRYANVIAYDHSRVLLSAIEGIPGSDYVNANYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRSATVVMMTKLEERSRVKCDQYWPSRGTETHGLVQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKTCNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE 1619          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. TrEMBL
Match: A0A553PDS4 (Uncharacterized protein OS=Tigriopus californicus OX=6832 GN=TCAL_11864 PE=4 SV=1)

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 620/2151 (28.82%), Postives = 997/2151 (46.35%), Query Frame = 1
Query:  178 VDAYVSLEISSNNGYELTYEKIKRPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRD-----SVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFK---DFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWIC----------------GNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEI---YMLDR---NTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSK-SADILWKIDPISKVNA----FKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEIIPIFNNTAKSSMKIRFTTRYHDEKELIKAXXXXXXXXXXXXXXXXXXXXXRIVVGYFPYTE--GNKSLTKSCFLKTDN------SCHLTNLVPETLYQLNIAYNGMTVK----RYVETWAKDPDPVQ-----DFKLELINPKSQPYIKATWKYLT-GPLPIFEITYSPLDAPVNSNFSKYAKTINITDLKYETDPATHV-MGSTVQFSIRAIFNFQTSEPVQSKIKFPEGVPKDYPKSFKVHSKFSDENSF-LSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEFSKNLTNKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISSCCFKISWKWQKEXXXXXXXXXXXXTRNDQINHENFQFRT---------RYASSLFYVAKQNEFDWNKNYSVTMQTVTKSGALSSMSGEVFPRKYSNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSALYDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNT-EKSIINLVIDQPSYENGEISTYFIVV--ESNDPITETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACI----------SPIFNEISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPIAICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQK---------IGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLY 6357
            V A + LEI  +      +     P+II +P        +  L +C + GNP+P + W+ +G    P    II +       L +  ++  D G    CV  N +G+E  S S ++Y  +  VP  F       S       S + L C+  G     V W +   D  P     I      G N+  L  ++ +T  Y C+A ++ G +I     + ++     P  V +S      T +SV+L  S  GSPT   +++                   T    + G    TE    + + ++++        V  T  ETA             AP  V +  +S  + ++ W         +T + V+Y     L + Q  S+ +D          N  T I +L P+T Y++ +      G   PS     +T +  P S P ++ ++    TSVR+ W+ P  +   I  Y++++  +                  + EN +S+ +   Y L+    NT+Y+  + +++  GEG ++  +             +L     +S  S  ++W+  P +K N     +KI  +P++   S A     I +N  ++Q     ++   +    +++    I +      + I+       E + + A  ++  S+ ++    S      ++ GY  Y +    +SL     L+ +       S ++TNL P+T Y + +A   +T K    R      K P  V      D K+   +P     I+ T    T G L  + + Y         +  +    I ITD + +    +++  G   +F +  +      +        PEGVP D PK+  + ++F   +   +S+ P     QNG++T  +++ +  +       R+TTE +  F+    N + +  +R+ T+ G GPWS  V    + + I  P  +  +  S    ++ W+                 R   I +E F   T         R +  L   A+    + +  Y++ +   T  G      G +  R      P   V ++    + +  + + W    R   + ++++++    +F    G  I+   + +  + L    + EY+  I+++ P T Y++++  I  P+   +     +T +T    P+ + +     V   ++  + + + Q S E G IS Y++VV   SN    +  D  N +++ +  K+        +  N+    D+   PY AA+    S+         + F LG+  +   F +N  L KG+ Y+  + A +          SP   E+S+  +        +           N   P    N  + S   I   +  +I+   F+ + IC+L        RR N N  L           Q    A ++ +      P  +    G        D +EL+R    T P ++  S P                      +P++ +  +I +LK+N+N  FS E+ SI+   QF+W+ S+   NK KNRYANV+AYDHSRVVLQ +          D    +DYINANY +GYRKQNAYIATQGPL ET  DFWRM+WEQRS  IVMLT L ER+R+KC+QYWP   RGT  +YG + VT+   QE A ++ R+F +Q+         IG  ++RE+K FQ+TAWPDHGVP+   PFL F+ RI    P+D+GPV+ HCSAGVGRTG +I +D+MLE+++HEK++DVY +VT +RSQRNYMVQTE+QYIFIHD LL+      T++    L  HI++L ++E         T  ++E+++L                        SI  +PD     + ++ L  N+ KNR    LP +++RV L PIRG+EGSDY NAS+IDG++ R AYIATQ PL ET EDFWRM+WE N  I++ L    E     C QYWP+DRSARYQ FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ+GP+TVHC+ G  RTG+F+ +SI+LE+++ +  V+VF+T + L+ QRP+++++EDQYQFC+ A LEYL+ +
Sbjct:   61 VSASIELEIFDDKSLPPGF-----PRIIQSPAMKVEEKGRNALLVCQATGNPQPNIYWVKDGMRLNPNPRYIITEQGKLRGSLQIKDSQETDQGKY-ECVAENAVGTE-YSYSAQLYVRVRRVPPQF--TIPPESEYEVMVGSGINLTCVANGSPMPHVKWRRGSQDVTPGMAPPI------GMNVLQLHNIQ-ETENYTCVAASKLG-IIEATTIVRVQALPRPPSKVKISE----VTPTSVRLSWSYPGSPTEVQYYVIQYKPKLASWDYKEISGAITTFYDIRGLTPYTE-YEFVVLAVNNVGRGDKSMPVVTTTGETAPG----------YAPRNVSVRPLSSSTMVIQWNEPQAQNGPVTGYKVYYTTNPGLSLSQWESQFVD---------NNKLTTISDLTPHTIYTIRVEAYTAIGPGPPSAPVQVKTQQGVP-SQPSNLRVSEARATSVRLSWEQPAHSGENIVSYELYWNDT---------------FTPDFENHRSLPVSKEYYLEGLYPNTLYHIWLAAKSKRGEGATTPPIAVRTEQYVPGAPPDLVKAYPESSTSIRVVWQPPPENKRNGKITYYKIYHVPNSRTDSDAT---MIEINDSDRQEFIIDELRKWTEYRIWMLAGTQIGDGPISYPVIIKTDEDVPGEPQNVAAQPLNSSSVEVTWDPPSDKDRNGVIRGYQIYVQPKNTESLYYQMPLRFNTGSSDVTSFNVTNLQPDTRYVVQVA--ALTRKGDGTRSQPVKVKTPGGVPTRPNIDLKIVKKDPTITMDIEWTKPMETYGELKGYRVRYG--------HRGQKLTEIRITDPEVQHQEISNLEKGIEYEFRVAGMNKVGAGQEAIKAFLTPEGVPSDSPKN--ITTRFQTPDVIEISYDPPPEIAQNGQITMYDIQFWKAVTPEEKRMRSTTEKKTVFANLEDNTEYKFSVRANTRKGYGPWSTQVSFRTDRNIIRAPQHVQAMATSDSSIEVWWE-------------AVPLRTKVIGYELFYTMTEVDDLDKWQRKSVGLTTSAELINLERDARYAIAVAARTHDGL-----GRLSQRINEKVKPQDVVLNLRATEVTTHTMTLSWGQPIRLTPI-NYKISYNAYKEFVDAQG--ITQSAQVQPITILVSPKTQEYK--IKDLSPFTTYHVNVSAI--PSDRSYRPPAKITVTTQMAAPQPMVKPDFYGVRAHDRGELTVFLPQASEEYGPISHYYLVVIPHSNSSGVKYPDQFNTADLVSNSKA--------SLANKEEDEDK---PYIAAKFLQRSIP--------YTFVLGNSQNYEGF-INNKLNKGILYKIFVRAYVDTPQKHLYTSSPFSPELSLDMMQEPPGPPPQRPKPGR--GLYNGDDPKGLPNPKQASMMWIVGPILAVILFFFFV-LLICVLK------RRRQNPNQPL----------EQG---AVHTPLMAGFEMPTSMGGTGGHVTLVAPSDPVELRRLNFQT-PGMI--SHPP---------------------IPVSEMDAHIDDLKSNDNLKFSQEYESIEPGQQFTWDNSSMEINKPKNRYANVIAYDHSRVVLQPA----------DGVLGSDYINANYCDGYRKQNAYIATQGPLPETFADFWRMVWEQRSSTIVMLTKLEERARIKCDQYWP--TRGTE-SYGVMSVTLTDTQELASYVIRTFQLQRVSQAPMGMNIGYTDRREVKQFQYTAWPDHGVPEHPAPFLQFLRRITAMNPMDAGPVITHCSAGVGRTGAFIVIDSMLERVRHEKTIDVYGHVTCLRSQRNYMVQTEDQYIFIHDALLEAVNCGFTEVPARSLHHHIQQLMQMELGD----NITAMEIEFKKL-----------------------ASIQTEPD----KFLSANLPCNKFKNRLVNILPYESSRVCLEPIRGIEGSDYINASYIDGYRYRNAYIATQGPLAETVEDFWRMIWEHNSTIIVMLTKQREMGREKCAQYWPSDRSARYQCFVVDPLAEYNMPQYLLREFKVTDARDGQSRTIRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQEGPITVHCSAGVGRTGVFISMSIVLERMQYEGVVDVFQTVRALRTQRPAMVQTEDQYQFCYRAALEYLSAF 2003          

HSP 2 Score: 190.274 bits (482), Expect = 3.103e-44
Identity = 151/510 (29.61%), Postives = 231/510 (45.29%), Query Frame = 1
Query:  316 ISEGNPKPKVTWLYNGK--PQLPERYNIIR---DSVLHLSSARSEDNGAIVSCVCRNVMGSE-DKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLD-GK---NLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQF-IRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPT-VMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWK 1809
            ++ G+P P +TW  NG   P    RY+I+     SVL +   R ++      CV  N +G     S  +++++D  ++P GFP+     ++ V +K  N  L C   G  +  + W KD   L+    RY + + GK   +L I  + E+D GKY+C+A N  G+  S +  L +RV R  P F      ++ +  GS + L C   GSP PHV W  G+  +T      G    IG   + L +I E+ N TCVA +K      T  + V+ LP  P+ V+ISE++  S  L+W Y  +             PT V   + Q   K      KEI         I  L PYT Y   ++     G  + S      T ET P  APR+VS+   S +++ ++W  P   NG +T Y+V+YT +    L+QW    +       +N+K   I  L  +T+Y   V +  + G GP S  VQ         Q  NL +   ++ S  + W+
Sbjct:    1 MATGDPTPHITWRKNGNKIPSTVLRYSILEFTGGSVLRIEPIRKKETQ--FECVAENGVGDPVSASIELEIFDD-KSLPPGFPRIIQSPAMKVEEKGRNALLVCQATGNPQPNIYWVKDGMRLNPNP-RYIITEQGKLRGSLQIKDSQETDQGKYECVAENAVGTEYSYSAQLYVRVRRVPPQFTIPPESEYEVMVGSGINLTCVANGSPMPHVKWRRGSQDVT-----PGMAPPIGMNVLQLHNIQETENYTCVAASKLGIIEATTIVRVQALPRPPSKVKISEVTPTSVRLSWSYPGS-------------PTEVQYYVIQYKPKLASWDYKEISGAITTFYDIRGLTPYTEYEFVVLAVNNVGRGDKSMPVVTTTGETAPGYAPRNVSVRPLSSSTMVIQWNEPQAQNGPVTGYKVYYTTNPGLSLSQWESQFV-------DNNKLTTISDLTPHTIYTIRVEAYTAIGPGPPSAPVQVKTQQGVPSQPSNLRVSEARATSVRLSWE 481          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. TrEMBL
Match: A0A267DSI9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig026250g3 PE=4 SV=1)

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 458/1353 (33.85%), Postives = 689/1353 (50.92%), Query Frame = 1
Query: 2524 VMGSTVQFSIRAIFNFQTSEPVQSKIKFPEGVPKDYPKSFKVHSKFSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRN-TTENQIEFSKNLT-NKKLQCRMRSRTKAGAGPWSPFVLI----DFNHSEIEPPTQISILKISSCCFKISWKWQKEXXXXXXXXXXXXTR----------NDQINHENFQFRTRYASSLFYVAKQNEFDWNKNYSVTMQTVTKSGA-LSSMSGEVFPRKYSNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSAL-----YDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPK-NDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMRETS--HGRFFKFPLGSKISQTNF-----PLNKPLAKGVNYRAALIACISPIFNEIS---IRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPIAICILLFLYTVIARRSNSNIK------------------LLIPCFK---LRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQ----ISTTPDLLVQS---------SPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTH-FTYGGIMVTVNLVQ--EFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLY 6357
            + G+   FS+ A  N    + +  +    E  P   P+SF V++K        +  PI    +NG +T++E+  +     +    +N + EN     ++L  +++   ++R+   AG GPWS  + +            PP  I + ++S    +I W                 +           +     E FQ + +    L         D +  Y++  Q +   G+ +  +S     R ++   P      + C       + ++W   +    L  F  N+T    F  + G+E   +R  +    +     +D    E++  ++ + PN  Y I +   + PN +  +E   V C T   PP++++     + + ++ +I L + + S   G +  Y +VV        + D     S++ET+     I  S               +PY AA   A    + +S     + +F LG+K+           LNKPL    +Y++ L AC+SP  +      +   CS   WS    T   +P      S +  T +S      +  V S + +T++      CI L  + V  R+     +                  L+ P  K   +  S QN      +      +  ++ SA +      Q     +    Q    + T P L ++S          P+   + +++      +      VP+A L +++++LK ++N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRVVLQ           LD    +DYINANY++GYR+QNAYIATQGPL +TI DFWRMIWEQ++  +VM+T L ERSRVKC+ YWP  N+G+  F Y    +TV+L+   E AY+  R+F + + G+ EKREI HFQFTAWPDHGVP+   P LMF  R++   P D+GP+VVHCSAGVGRTG +I +DAMLE+MK EK++DVY +VT +R+QRNYMVQTE+QYIFIHD LL+     NT++    L S +++LS  E    G    TG +LE+R      SL   + P+                     + + ++ L  N+ KNR    LP ++NRV L PIRGVEGSDY NASWIDG++ R  YIATQ PL +T EDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M ++++REFK+TDARDGQSR +RQF  T+W +   +P S E  +E I QV KTKEQFGQ GP+TVHC+ G  RTG+FL LS++LE+++ +  V++++T + L+ QR +++++++QYQFC+ A LEYL+ +
Sbjct:  122 LFGAVYNFSLSAKNNEGYGDVISCQATVREAPPSMKPESFSVNTKSDTSVEVFALKPI-LTGRNGHITNTEVAYWPKNAIDGYGSKNFSVENSSAVIRHLNPSREYLFKVRAWNSAGPGPWSDVMPVRTRQQPPPQSPSPPAGIVLSRVSPTRARIDWSLPPPPPPQQPPVSAAQSAIADLRILFSPDPGAPVEAFQ-QLQAGGVLDRPFILENLDSSAEYTLRFQWIGADGSPVGPVSEPHLLRLFNREAP----RELRCFDRRPDSLGLRWLRPHDSAGLESFEYNYTATGRFIDDSGQE---QRSRRLSPVMPVPLSWDAQPAEFQHVLKGLDPNKLYTIRLT-ARFPNREASAE---VACPTASAPPRSLQAPIAIDKDVDRRLITLRLRRASDRLGVVQRYLLVVAPEAQSATSQDLLFQRSDLETVSVDARIASS--------------KEPYIAACFTAQRFRQLSSPQSAGYIEFQLGTKLPTETCDSRQQALNKPLLSDASYKSFLAACLSPAGSGPVGSLVGAGCSYSPWSEAFGTHIALP------SRSLGTAESGYFTLIVVLVTSALGLTAVVCISVGCIALGCF-VCGRKGTERGRNFRNGSGGHSNNRQPMQVLVEPSLKQPLIPASQQNSTSFCATAATGGTLQSVVGSATLQRQQQQQQQQQQQFGTLQSSSHVGTLPTLSIRSASSSAAFHQGPTDPVELRRINFQTPALTS-HPPVPVAQLIDHVASLKASDNLKFSAEYESIDPGQQFTWENSNLDVNKPKNRYANVIAYDHSRVVLQP----------LDGLPGSDYINANYMDGYRRQNAYIATQGPLPDTIGDFWRMIWEQKTSTVVMMTRLEERSRVKCDMYWP--NKGSEVFDY----MTVSLLDTLELAYYTIRTFALHRAGATEKREIHHFQFTAWPDHGVPEHCAPLLMFARRVRASNPPDAGPIVVHCSAGVGRTGAFIVIDAMLERMKQEKTLDVYGHVTCLRAQRNYMVQTEDQYIFIHDCLLEAVICGNTEVPARALASQVQRLSIPEPAAGGA---TGMELEFR------SLAHTVKPT-------------------PAHKFTSASLPANKLKNRLVNILPFESNRVCLQPIRGVEGSDYINASWIDGYRQRSCYIATQGPLPDTAEDFWRMLWEHNSTIVVNLTKLREQGRDKCHQYWPGERSARYQYFVVDPMAEYNMPNYILREFKVTDARDGQSRTVRQFHCTDWPEQG-VPKSGEGFIEFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFLALSVVLERMRYEGVVDMYQTVRTLRTQRSAMVQTDEQYQFCYGAALEYLSSF 1394          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. TrEMBL
Match: A0A401NLH7 (Uncharacterized protein (Fragment) OS=Scyliorhinus torazame OX=75743 GN=scyTo_0009388 PE=4 SV=1)

HSP 1 Score: 683.715 bits (1763), Expect = 0.000e+0
Identity = 334/613 (54.49%), Postives = 429/613 (69.98%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PIA L E+  +LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L     +  I  S       DYINANYI+GYRKQNAYIATQGPL ET  DFWRM+WEQRS  IVM+T L E+SRVKC+QYWP   RGT  TYG I VT+    E A F  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GPVVVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +RSQRNYMVQTE+QYIFIHD LL+      T++    LFS+I+KL+++E  +      TG +LE++RL    +                            T+ + ++ L  N+ KNR    +P +T RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +   +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++ED+YQFC+ A LEYL
Sbjct: 1091 IPIAELAEHTEHLKANDNLKFSQEYESIDPGQQFTWEHSNMEVNKPKNRYANVIAYDHSRVILAP---IEGIAGS-------DYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTKLEEKSRVKCDQYWP--GRGTE-TYGMIQVTLLDTIELATFCVRNFCLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYIFIHDALLEAVACGTTEVMARNLFSYIQKLTQVETGE----HVTGMELEFKRLANSKA---------------------------HTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQG-VPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1658          

HSP 2 Score: 225.713 bits (574), Expect = 3.558e-55
Identity = 122/292 (41.78%), Postives = 174/292 (59.59%), Query Frame = 1
Query: 4552 ISNLKTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            ++ ++T E+  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE++Y F +   L+Y  S +
Sbjct: 1386 LTQVETGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1662          

HSP 3 Score: 171.4 bits (433), Expect = 1.279e-38
Identity = 130/443 (29.35%), Postives = 197/443 (44.47%), Query Frame = 1
Query:  523 NAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD-LRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSP-DQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNAFKI 1845
            + +P GFP       + V ++    T+ C   G     + WFKDF P+D   S R + L    L I  + E+D GKY+C+A N  G   SP  +L +RV R  P F    P  Q I  G SV + C   GSP P+V W+ G   LT  +        +G   + L+ I ES N TCVA +          IIVK LP  P    + E +  S  LTW   S     I  +I+ Y P           K+ D+  + I     +   I  L PY++Y   +      G  +PS+    +T E  P+S+PRSV   + S T++ ++W+ P E NG+I  Y+V+YT   + P++ W  ++L       ++     +  L   T Y   V +  S G+GP S  +Q         Q  N         S ++LW+     K+ ++++
Sbjct:    3 DQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSSSTRIKQLRSGALQIENSEETDQGKYECVASNNAGVRYSPPANLYVRVRRVPPRFSISPPLSQEIVPGGSVNITCVAVGSPMPYVKWMLGTEDLTPED-----DMPVGRNVLELNSIRESANYTCVAMSSLGVIETVSQIIVKALPKPPGTPIVVETTATSVTLTWD--SGNPDHINYYIIEYRP-----------KNTDVLYQTIDGIQTLRYSIGGLSPYSDYEFRISAVNSIGQGQPSETVETRTGEQVPSSSPRSVQARMLSATTMLIQWEEPEEPNGQIRGYRVYYTMEPQQPVSNWQKHNL-------DDSLLTTVANLIPQTTYSVKVLAFTSVGDGPLSAEIQVKTQQGVPGQPINFNATPKSETSIELLWRAPREEKIISYEL 420          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. TrEMBL
Match: G1KDG8 (Protein tyrosine phosphatase receptor type D OS=Anolis carolinensis OX=28377 GN=PTPRD PE=4 SV=2)

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 397/949 (41.83%), Postives = 558/949 (58.80%), Query Frame = 1
Query: 3535 YTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPKNDSEIETIEKSQ-DIIFSFLTRHNRS-HLSDQIS-QPYFAAELNATSVMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNEISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPIAICILLFLYTVIARR--SNSNIKLLIPCFKLRHSSQNYYPASNSEIKE-NLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            + VT  T P+  +  + L ID+ N +  I   + + P+  N  I  Y+IV+    P+ +  D K     E+ ++ + D +   + R  RS  L  ++  +PY AA                 +F LG K     F  NK L  G  Y   ++A +             +M   S    T+ +V     +L+P   T + +     +  V+  ++     I I I ILL+  +   R+     + K  IP  K      +++P    E++  N   P + S +V        + SL      I +   L  Q++  + + +  L    +        +PI  L ++I  LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L +          ++    +DYIN+NYI+GYRKQNAYIATQG L ET  DFWRMIWEQR   +VM+T L ERSRVKC+QYWP  +RGT  TYG I VT+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QYIFIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P ++ R+ L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQFC+ A LEYL
Sbjct: 1103 HRVTAKTAPDVLRT-QPLFIDKTNLDGMITVKLPEVPA--NKSIKGYYIVIV---PLIKKSDGKFMKPRESPDEMELDELLKEIARKRRSIRLGREVDLKPYIAAHFEVLPT----------EFTLGDKKLYGGFE-NKQLQNGQEYVVFILAVME--------HSESTMYATSPYSETVVSV-----DLNPQPITEEEEG----LIWVVGPVLAVVFIICIVIAILLYKSSKPDRKRAETDSRKSSIPNNK---EIPSHHPTDPVELRRLNFQTPALSSNSV-------PYASL------IGSVSSLSSQTTTQSLYDNNSLPRFARKGMASHPPIPILELADHIERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVLLTA----------IEGIPGSDYINSNYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRGATVVMMTKLEERSRVKCDQYWP--SRGTE-TYGLIQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKTCNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIEAGE----NVTGMELEFKRL---ASSKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRICLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYL 1956          

HSP 2 Score: 229.95 bits (585), Expect = 2.112e-56
Identity = 128/305 (41.97%), Postives = 177/305 (58.03%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +  EN  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +R+ LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++ K  E+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1671 EVPARNLYAYIQKLTQIEAGENVTGMELEFKRLASSKAHTSRFISANLPCNKFKNRLVNIMPYESTRICLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAALEYLGSFD 1960          

HSP 3 Score: 197.978 bits (502), Expect = 1.447e-46
Identity = 146/510 (28.63%), Postives = 223/510 (43.73%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD------LRSIRYQMLDG----KNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIR----VSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            PK   AP + + ++     FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G       + V  + + +P+GFP       + V ++    T+ C   G     + WFKDF P+D      ++ +R + + G      L I  + ESD GKY+C+A N  G+  S   +L +R    V R  P F     +  I  G SV + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P    ++E +  S  LTW             + +YI     +I + L K+ID  +            +  L PY+ Y   +V     G   PS+  S +T E  P+SAPR+V   + S T++ V+W+ P E NG+I  Y+V+YT      +  W       +     +     I  L     Y   V +  S G+GP S  +Q
Sbjct:   31 PKFTRAPVDQTGVSGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNSVGEISVPTRLTVLRE-DQIPRGFPTIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDTSNNGRIKQLRSESIGGTPIRGALQIESSEESDQGKYECVATNSAGTRYSAPANLYVRELREVRRVPPRFSIPPTNHEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELNDVRQSANYTCVAMSTLGVIEAIAQITVKALPKPPGTPVVTETTATSITLTWD------SGNPEPVSYYIIQHKPKISEELYKEIDGVA-------TTRYSVAGLSPYSEYEFRVVAVNNIGRGPPSEPVSTRTSEQAPSSAPRNVQARMLSSTTILVQWEEPEEPNGQIQGYRVYYTMDPSQHVNSW-------LKHNVADSHITTIGNLIPQKTYSVKVLAFTSVGDGPLSSDIQ 514          

HSP 4 Score: 175.637 bits (444), Expect = 7.092e-40
Identity = 92/251 (36.65%), Postives = 142/251 (56.57%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I G+ GSDY N+++IDG++ + AYIATQ  L ET  DFWRM+WEQ    V+ +  + E     C+QYWP+  +  Y    V  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1424 WEHSNLEVNKPKNRYANVIAYDHSRVLLTAIEGIPGSDYINSNYIDGYRKQNAYIATQGSLPETFGDFWRMIWEQRGATVVMMTKLEERSRVKCDQYWPSRGTETYGLIQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKTCNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYIFIHDALLEAVTCGNTE 1671          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. TrEMBL
Match: A0A401SN35 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0010266 PE=4 SV=1)

HSP 1 Score: 683.33 bits (1762), Expect = 0.000e+0
Identity = 333/613 (54.32%), Postives = 429/613 (69.98%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PIA L E+  +LK N+N  FS E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L     +  I  S       DYINANYI+GYRKQNAYIATQGPL ET  DFWRM+WEQRS  IVM+T L E+SRVKC+QYWP  +RG   TYG I VT+    E A F  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GPVVVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +RSQRNYMVQTE+QYIFIHD LL+      T++    LFS+I+KL+++E  +      TG +LE++RL    +                            T+ + ++ L  N+ KNR    +P +T RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++ED+YQFC+ A LEYL
Sbjct: 1327 IPIAELAEHTEHLKANDNLKFSQEYESIDPGQQFTWEHSNMEVNKPKNRYANVIAYDHSRVILAP---IEGIAGS-------DYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTKLEEKSRVKCDQYWP--SRGAD-TYGMIQVTLLDTIELATFCVRNFCLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPVVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRSQRNYMVQTEDQYIFIHDALLEAVACGTTEVMARNLFSYIQKLTQVETGE----HVTGMELEFKRLANSKA---------------------------HTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1894          

HSP 2 Score: 226.098 bits (575), Expect = 3.511e-55
Identity = 122/292 (41.78%), Postives = 174/292 (59.59%), Query Frame = 1
Query: 4552 ISNLKTNEN-RGFSTEF--VSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            ++ ++T E+  G   EF  ++   A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE++Y F +   L+Y  S +
Sbjct: 1622 LTQVETGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1898          

HSP 3 Score: 200.675 bits (509), Expect = 2.103e-47
Identity = 152/531 (28.63%), Postives = 242/531 (45.57%), Query Frame = 1
Query:  151 FMIFTTIFIVDAYVSLEISSNNGYELTYEKIKRPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD-LRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSP-DQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            +++   I +V A +SL + +++  E        P+ +  P +   ++     F+C + G+PKP+VTW   GK    +R+ +I       +VL +   R+  + A+  C   N +     +A + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P+D   S R + L    L I  + E+D GKY+C+A N  G   SP  +L +RV R  P F    P  Q I  G SV + C   GSP P+V W+ G   LT  +        +G   + L+ I ES N TCVA +          IIVK LP  P    + E +  S  LTW   +   I+      +YI      IE    K+ D+  + I     +   I  L PY++Y   +      G   PS+    +T E  P+S+PR+V   + S T++ ++W+ P E NG+I  Y+V+YT   + P++ W  ++L       ++     +  L   T Y   V +  S G+GP S  +Q
Sbjct:    6 YLMMPPIVVVMALLSL-VHADSTIEAP------PRFMKVPSDQIGVSGGVASFVCQATGSPKPRVTWNKKGKRVSSQRFEVIEFDDGAGAVLRIQPLRTPRDEAVYECQATNTLDDVTVTAKLTVLRE-DQLPSGFPNIDMGPQLKVVERTRTATMLCAASGNPDPEITWFKDFLPVDPSSSTRIKQLRSGALQIENSEETDQGKYECVASNNAGVRYSPPANLYVRVRRVPPRFSISPPITQEIVPGGSVNITCVAVGSPMPYVKWMLGTEDLTPED-----DMPVGRNVLELNSIRESANYTCVAMSSLGVIETVSQIIVKALPKPPGTPIVVETTATSVTLTWDSGNPDHIN------YYI------IEY-RPKNTDVLYQTIDGIQTLRYSIGGLSPYSDYEFRISAVNSIGQGPPSETVETRTGEQVPSSSPRNVQARMLSATTMLIQWEEPEEPNGQIRGYRVYYTMEPQQPVSNWQKHNL-------DDSLLTTVANLIPQTTYSVKVLAFTSVGDGPLSPEIQ 503          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Cavefish
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 339/662 (51.21%), Postives = 447/662 (67.52%), Query Frame = 1
Query: 4378 SNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            S+   D +EL+R    T         P  S     L LS          +PI  L +++  LK N+N  FS E+ SID   QF+WE SN   NK+KNRYANV+AYDHSRV+L           ++D    +DYINANYI+GYRKQNAYIATQG L ET  DFWRM+WEQRS  IVM+T L ERSRVKC+QYWP   RGT  TYG I VT+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QY+FIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   ++  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQFC+ A LEYL
Sbjct: 1309 SHHPTDPVELRRLNFQT-------PGPGASGYPSNLHLSSM---ASHPPIPIMDLADHLERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVLL----------SAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWP--TRGTE-TYGLIQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ANTKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYL 1915          

HSP 2 Score: 230.335 bits (586), Expect = 7.225e-60
Identity = 130/305 (42.62%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEFVSIDH--ANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  + +  A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1630 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1919          

HSP 3 Score: 209.92 bits (533), Expect = 1.117e-53
Identity = 147/498 (29.52%), Postives = 222/498 (44.58%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDL--RSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            PK +  P + + +      FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    +  + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P++    + R + L    L I ++ ESD GKY+C+A N  G+  S   +L +RV R  P F     D  I  G SV + C   GSP P+V W+ G+  LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P ++ ++E +  S  LTW   +                V   I Q  SK  + S KEI         +  L PY++Y   +V     G    S+    +T E  P++APR V   + S T+  + W+ P E NG+I  Y+V+YT      + QW    ++       N   + I  L  N  YY  V +  S G+GP S  +Q
Sbjct:   29 PKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKRVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISATTRLTVLRE-DQLPAGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTTNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDSEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPED-----DMPIGRNVLELTDVRQSANYTCVAMSTLGVIEAVAQITVKALPKPPGVLVVTERTATSITLTWDSGNPE-------------PVSYYIIQHKSKYSEDSYKEIDGVATTRYSVGGLSPYSDYEFRVVAVNNIGRGPASEAIEDKTAEQAPSTAPRQVRGRMLSATTAIIHWEEPEEANGQIMGYRVYYTMDPSQHVNQWEKQIVR-------NANFLTIQGLTPNKTYYIKVLAYTSVGDGPLSSDLQ 500          

HSP 4 Score: 174.866 bits (442), Expect = 5.067e-43
Identity = 92/251 (36.65%), Postives = 142/251 (56.57%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN++KNR    +  D +RV+L  I G+ GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ    ++ +  + E     C+QYWP   +  Y    V  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1383 WEHSNLEVNKAKNRYANVIAYDHSRVLLSAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWPTRGTETYGLIQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTE 1630          

HSP 5 Score: 54.6842 bits (130), Expect = 1.572e-6
Identity = 45/171 (26.32%), Postives = 82/171 (47.95%), Query Frame = 1
Query: 1315 IMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWK-PPIE-TNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEK--ENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQL--KNLTMLLVQSKSADILWK 1809
            + +L+P+T YS  L      G+   +   S +T +T+P++ P+ V+ +  S T++ V WK PP+E  NG I  Y + Y  ++ +  T   I+ +   N +   EN        L++ T Y   V +    G GP S + Q    ++++     + + +  V S S  +LW+
Sbjct:  568 LKDLRPFTTYSFQLAARSRHGIGAYTNEISAETPQTQPSAPPQEVTCSSPSSTNILVSWKPPPVELQNGIIIKYTIQYAATEGEDTTTREISEIPPENVQYLLEN--------LEKWTEYRVTVTAHTDVGPGPES-LPQLIRTEEDVPSGPPRKVEVEAVNSSSVKVLWR 729          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Cavefish
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 328/613 (53.51%), Postives = 433/613 (70.64%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L +++  LK N+N  FS E+ SID   QF+WE SN   NK+KNRYANV+AYDHSRV+L           ++D    +DYINANYI+GYRKQNAYIATQG L ET  DFWRM+WEQRS  IVM+T L ERSRVKC+QYWP   RGT  TYG I VT+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QY+FIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   ++  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQFC+ A LEYL
Sbjct: 1337 IPIMDLADHLERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVLL----------SAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWP--TRGTE-TYGLIQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ANTKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYL 1904          

HSP 2 Score: 230.335 bits (586), Expect = 5.757e-60
Identity = 130/305 (42.62%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEFVSIDH--ANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  + +  A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1619 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1908          

HSP 3 Score: 204.142 bits (518), Expect = 7.090e-52
Identity = 147/502 (29.28%), Postives = 222/502 (44.22%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDL--RSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIR----VSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            PK +  P + + +      FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    +  + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P++    + R + L    L I ++ ESD GKY+C+A N  G+  S   +L +R    V R  P F     D  I  G SV + C   GSP P+V W+ G+  LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P ++ ++E +  S  LTW   +                V   I Q  SK  + S KEI         +  L PY++Y   +V     G    S+    +T E  P++APR V   + S T+  + W+ P E NG+I  Y+V+YT      + QW    ++       N   + I  L  N  YY  V +  S G+GP S  +Q
Sbjct:   29 PKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKRVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISATTRLTVLRE-DQLPAGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTTNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRELREVRRVPPRFSIPPTDSEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPEDDMP-----IGRNVLELTDVRQSANYTCVAMSTLGVIEAVAQITVKALPKPPGVLVVTERTATSITLTWDSGNPE-------------PVSYYIIQHKSKYSEDSYKEIDGVATTRYSVGGLSPYSDYEFRVVAVNNIGRGPASEAIEDKTAEQAPSTAPRQVRGRMLSATTAIIHWEEPEEANGQIMGYRVYYTMDPSQHVNQWEKQIVR-------NANFLTIQGLTPNKTYYIKVLAYTSVGDGPLSSDLQ 504          

HSP 4 Score: 174.866 bits (442), Expect = 5.775e-43
Identity = 92/251 (36.65%), Postives = 142/251 (56.57%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN++KNR    +  D +RV+L  I G+ GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ    ++ +  + E     C+QYWP   +  Y    V  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1372 WEHSNLEVNKAKNRYANVIAYDHSRVLLSAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWPTRGTETYGLIQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTE 1619          

HSP 5 Score: 54.6842 bits (130), Expect = 1.584e-6
Identity = 45/171 (26.32%), Postives = 82/171 (47.95%), Query Frame = 1
Query: 1315 IMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWK-PPIE-TNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEK--ENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQL--KNLTMLLVQSKSADILWK 1809
            + +L+P+T YS  L      G+   +   S +T +T+P++ P+ V+ +  S T++ V WK PP+E  NG I  Y + Y  ++ +  T   I+ +   N +   EN        L++ T Y   V +    G GP S + Q    ++++     + + +  V S S  +LW+
Sbjct:  572 LKDLRPFTTYSFQLAARSRHGIGAYTNEISAETPQTQPSAPPQEVTCSSPSSTNILVSWKPPPVELQNGIIIKYTIQYAATEGEDTTTREISEIPPENVQYLLEN--------LEKWTEYRVTVTAHTDVGPGPES-LPQLIRTEEDVPSGPPRKVEVEAVNSSSVKVLWR 733          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Cavefish
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 328/613 (53.51%), Postives = 433/613 (70.64%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L +++  LK N+N  FS E+ SID   QF+WE SN   NK+KNRYANV+AYDHSRV+L           ++D    +DYINANYI+GYRKQNAYIATQG L ET  DFWRM+WEQRS  IVM+T L ERSRVKC+QYWP   RGT  TYG I VT+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QY+FIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   ++  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQFC+ A LEYL
Sbjct: 1334 IPIMDLADHLERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVLL----------SAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWP--TRGTE-TYGLIQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ANTKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYL 1901          

HSP 2 Score: 230.335 bits (586), Expect = 5.746e-60
Identity = 130/305 (42.62%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEFVSIDH--ANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  + +  A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1616 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1905          

HSP 3 Score: 209.534 bits (532), Expect = 1.270e-53
Identity = 147/498 (29.52%), Postives = 222/498 (44.58%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDL--RSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            PK +  P + + +      FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    +  + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P++    + R + L    L I ++ ESD GKY+C+A N  G+  S   +L +RV R  P F     D  I  G SV + C   GSP P+V W+ G+  LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P ++ ++E +  S  LTW   +                V   I Q  SK  + S KEI         +  L PY++Y   +V     G    S+    +T E  P++APR V   + S T+  + W+ P E NG+I  Y+V+YT      + QW    ++       N   + I  L  N  YY  V +  S G+GP S  +Q
Sbjct:   29 PKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKRVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISATTRLTVLRE-DQLPAGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTTNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDSEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPED-----DMPIGRNVLELTDVRQSANYTCVAMSTLGVIEAVAQITVKALPKPPGVLVVTERTATSITLTWDSGNPE-------------PVSYYIIQHKSKYSEDSYKEIDGVATTRYSVGGLSPYSDYEFRVVAVNNIGRGPASEAIEDKTAEQAPSTAPRQVRGRMLSATTAIIHWEEPEEANGQIMGYRVYYTMDPSQHVNQWEKQIVR-------NANFLTIQGLTPNKTYYIKVLAYTSVGDGPLSSDLQ 500          

HSP 4 Score: 174.866 bits (442), Expect = 5.577e-43
Identity = 92/251 (36.65%), Postives = 142/251 (56.57%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN++KNR    +  D +RV+L  I G+ GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ    ++ +  + E     C+QYWP   +  Y    V  +   +++ + +R F L      + R +RQFQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct: 1369 WEHSNLEVNKAKNRYANVIAYDHSRVLLSAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWPTRGTETYGLIQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAW-PDHGVPEHPTPFLAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTE 1616          

HSP 5 Score: 54.6842 bits (130), Expect = 1.570e-6
Identity = 45/171 (26.32%), Postives = 82/171 (47.95%), Query Frame = 1
Query: 1315 IMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWK-PPIE-TNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEK--ENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQL--KNLTMLLVQSKSADILWK 1809
            + +L+P+T YS  L      G+   +   S +T +T+P++ P+ V+ +  S T++ V WK PP+E  NG I  Y + Y  ++ +  T   I+ +   N +   EN        L++ T Y   V +    G GP S + Q    ++++     + + +  V S S  +LW+
Sbjct:  568 LKDLRPFTTYSFQLAARSRHGIGAYTNEISAETPQTQPSAPPQEVTCSSPSSTNILVSWKPPPVELQNGIIIKYTIQYAATEGEDTTTREISEIPPENVQYLLEN--------LEKWTEYRVTVTAHTDVGPGPES-LPQLIRTEEDVPSGPPRKVEVEAVNSSSVKVLWR 729          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Cavefish
Match: PTPRD (protein tyrosine phosphatase receptor type D [Source:HGNC Symbol;Acc:HGNC:9668])

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 328/613 (53.51%), Postives = 433/613 (70.64%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI  L +++  LK N+N  FS E+ SID   QF+WE SN   NK+KNRYANV+AYDHSRV+L           ++D    +DYINANYI+GYRKQNAYIATQG L ET  DFWRM+WEQRS  IVM+T L ERSRVKC+QYWP   RGT  TYG I VT+    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QY+FIHD LL+     NT++    L+++I+KL++IE  +      TG +LE++RL   ++  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +   +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQFC+ A LEYL
Sbjct:  907 IPIMDLADHLERLKANDNLKFSQEYESIDPGQQFTWEHSNLEVNKAKNRYANVIAYDHSRVLL----------SAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWP--TRGTE-TYGLIQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTEVPARNLYAYIQKLTQIETGE----NVTGMELEFKRL---ANTKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQG-VPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYL 1474          

HSP 2 Score: 230.335 bits (586), Expect = 3.740e-60
Identity = 130/305 (42.62%), Postives = 178/305 (58.36%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEFVSIDH--ANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +T EN  G   EF  + +  A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1189 EVPARNLYAYIQKLTQIETGENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1478          

HSP 3 Score: 209.534 bits (532), Expect = 9.238e-54
Identity = 147/498 (29.52%), Postives = 222/498 (44.58%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDL--RSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            PK +  P + + +      FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    +  + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P++    + R + L    L I ++ ESD GKY+C+A N  G+  S   +L +RV R  P F     D  I  G SV + C   GSP P+V W+ G+  LT  +        IG   + L+D+ +S N TCVA +          I VK LP  P ++ ++E +  S  LTW   +                V   I Q  SK  + S KEI         +  L PY++Y   +V     G    S+    +T E  P++APR V   + S T+  + W+ P E NG+I  Y+V+YT      + QW    ++       N   + I  L  N  YY  V +  S G+GP S  +Q
Sbjct:   14 PKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKRVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISATTRLTVLRE-DQLPAGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTTNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDSEIMPGGSVNITCVAVGSPMPYVKWMLGSEDLTPED-----DMPIGRNVLELTDVRQSANYTCVAMSTLGVIEAVAQITVKALPKPPGVLVVTERTATSITLTWDSGNPE-------------PVSYYIIQHKSKYSEDSYKEIDGVATTRYSVGGLSPYSDYEFRVVAVNNIGRGPASEAIEDKTAEQAPSTAPRQVRGRMLSATTAIIHWEEPEEANGQIMGYRVYYTMDPSQHVNQWEKQIVR-------NANFLTIQGLTPNKTYYIKVLAYTSVGDGPLSSDLQ 485          

HSP 4 Score: 174.866 bits (442), Expect = 3.956e-43
Identity = 92/251 (36.65%), Postives = 142/251 (56.57%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN++KNR    +  D +RV+L  I G+ GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ    ++ +  + E     C+QYWP   +  Y    V  +   +++ + +R F L      + R +RQFQFT W D   +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE++K +  V+++    L++ QR  ++++EDQY F   ALLE +T  + E
Sbjct:  942 WEHSNLEVNKAKNRYANVIAYDHSRVLLSAIDGIPGSDYINANYIDGYRKQNAYIATQGSLPETFGDFWRMVWEQRSANIVMMTKLEERSRVKCDQYWPTRGTETYGLIQVTLLDTVELATYCVRTFALYKNGSSEKREVRQFQFTAWPDHG-VPEHPTPFLAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVTCGNTE 1189          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Cavefish
Match: ptprsa (protein tyrosine phosphatase receptor type S [Source:NCBI gene;Acc:103028538])

HSP 1 Score: 674.085 bits (1738), Expect = 0.000e+0
Identity = 332/657 (50.53%), Postives = 444/657 (67.58%), Query Frame = 1
Query: 4393 DSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            D +E++R    T PD  + S  S +  D + +++   I       PI  L E+   LK N+N   S E+ SID   QF+WE SN   NK KNRYANV+AYDHSRV+L   + +            +DYINANYI+GYRKQNAYIATQGPL ET  DFWRM+WEQRS  +VM+T L E+SR+KC+QYWP  +RGT  TYG   VT+    E A F  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP++ HCSAGVGRTG +I +DAMLE++KHEK+VD+Y +VT +R+QRNYMVQTE+QY FIHD LL+     NT++A   LFS+I+KL+++E  +      TG +LE++RL    +                            T+ + ++ L  N+ KNR    +P +T RV L PIRG+EGSDY N+S+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +   +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++ED+YQFC+ A LEYL
Sbjct: 1329 DPVEVRRINFQT-PDSGLSSPLSEAAFDYESMMNHPPI-------PITELAEHTELLKANDNLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANVIAYDHSRVILAPIEGIT----------GSDYINANYIDGYRKQNAYIATQGPLPETFGDFWRMVWEQRSATVVMMTRLEEKSRIKCDQYWP--SRGTE-TYGMTQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVKTCNPPDAGPIIAHCSAGVGRTGCFIVIDAMLERIKHEKTVDIYGHVTLMRAQRNYMVQTEDQYSFIHDALLEAVACGNTEVAARSLFSYIQKLAQVEPGE----HVTGMELEFKRLANSKA---------------------------HTSRFISANLPCNKFKNRLVNIMPYETTRVCLQPIRGLEGSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQG-VPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYL 1932          

HSP 2 Score: 223.402 bits (568), Expect = 9.763e-58
Identity = 114/260 (43.85%), Postives = 159/260 (61.15%), Query Frame = 1
Query: 4639 SNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +N P NK KNR  N++ Y+ +RV LQ  + +            +DYIN+++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE++Y F +   L+Y  S +
Sbjct: 1692 ANLPCNKFKNRLVNIMPYETTRVCLQPIRGLE----------GSDYINSSFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFD 1936          

HSP 3 Score: 172.17 bits (435), Expect = 3.047e-42
Identity = 137/522 (26.25%), Postives = 221/522 (42.34%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSI--RYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIR----VSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSS-----QIVQKFINDDEIYQLKNLT 1767
            PK    P +   ++   + F+C + G+PKP+V+W   GK    +R   I       +VL +   R+  +  I  CV  N  G     A + +  + + +P GFP       + V ++     + C   G     + WFKDF P+D  +   R + L    L I  T E+D GKY+C+A N  G   S   +L +R    V R  P F  +     I  G SV + C   GSP P+V W+  +  LT  +        +G   + L+ + ES N TCVA +          IIVK+LP  P    ++E +  S  +TW   +                V   I Q  +K +D   + +         I  L P T Y + +      G    S+    +T E  P S PR++   + S++++ V+W+ P E NG+I  Y+VF+T     P++ W I+++        +     I  L  +  Y   V +  S G+GP S     +++Q        +Q+  +T
Sbjct:   34 PKFTKVPVDMIGVSGGVVSFVCQATGDPKPRVSWNKKGKRVNSQRIETIEFDEGAGAVLRIQPLRAPRDENIYECVAENSEGEVSVQAKLTIIRE-DLLPPGFPNIDMGPQLKVVERTRTANMLCAASGNPDPEITWFKDFLPIDPSASNGRIKQLRSGALQIENTEETDQGKYECVASNVEGVRYSSPANLYVRELREVRRVPPRFSILPASHEIMPGGSVNITCVAVGSPMPYVKWMLNSEDLTPED-----DMPVGRNVLELNSVRESANYTCVAMSSLGIIEAVSQIIVKSLPKPPGTPIVTETTATSITITWDSGNPE-------------PVSHYIIQYRAKTLDSKFETMDSITTTRYSIGGLSPNTEYEIRVAAFNTIGQGPASEPVEARTGEQAPASPPRNIQARIISQSTMMVRWEEPEEPNGQIKGYRVFFTMDPSQPVSMWQIHNV-------HDSVITTIQNLVASETYTIRVLAFTSVGDGPFSDPIHVKVLQGVPGQPSKFQIGEVT 529          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Sea Lamprey
Match: ptpra (protein tyrosine phosphatase receptor type A [Source:ZFIN;Acc:ZDB-GENE-020107-1])

HSP 1 Score: 429.483 bits (1103), Expect = 7.106e-131
Identity = 244/669 (36.47%), Postives = 379/669 (56.65%), Query Frame = 1
Query: 4399 LELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIAL--LQEYISNLKTNENRGFSTEFVSIDHAN-QFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQG--PLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGS-PEK---REIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWE-QNCGIVITLHYV----PECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSD 6363
            L  ++Y+ + T  L + +      + + + L  ++    +   P+A+  L+E  +    ++N+ F  EF S+     Q + E ++K  NK KNRY N++ YD+ RV L S + V D          +DYINA+Y+NGY+++N +IA QG  P  ET+ND+WRMIWE  +  IVM+T L ER   KC QYWP  ++G  +TYG + V+V  V     +  R F++Q +G  P K   R I  F FT+WPD GVP   I  L F+ ++K   P  +GP+VVHCSAGVGRTG +I +DAML+ ++ E+ VDV+ +VT IR+QR  MVQT+ QY+FI+  LL++    +T++  + L SH++KL    Y K      TG + E+++L                                      T  L  N  KNR    +P D NRVI+   RG E +DY N S+IDG++ + A++A Q PL++T EDFWRM+WE ++C IV+          +C +YWP + +  Y   +++   E     + +R+F +++ R+ +SR +RQF F  W +   IP   + ++ LI  VQK ++  G   P+TVHC+ G+ RTG F  L  +LE++KT+  ++VF+T K L+ QRP ++++ +QY+FC+  + EY+  +SD
Sbjct:  123 LRFRKYKHNGTNSLRLANGRGEDAEMQSMPLLARSPSTNRKYPPLAVDRLEEEFNRRSADDNKLFREEFNSLPSCPIQATCEAASKEENKEKNRYVNILPYDNFRVHLTSLEGVPD----------SDYINASYVNGYQEKNKFIAAQGKGPKEETLNDYWRMIWELNTATIVMVTNLKERKECKCAQYWP--DQGC-WTYGNLRVSVEDVTVLVDYTIRKFLIQVVGDIPNKKPPRLITQFHFTSWPDFGVPFAPIGMLKFLKKVKTCNPPYAGPIVVHCSAGVGRTGTFIVIDAMLDMIQTERKVDVFGFVTRIRAQRCQMVQTDMQYVFIYQALLEFQLYGDTELEVTSLESHLQKL----YNKNTPTGCTGLEDEFKKLTTVK---------------------------IQNEKMRTGNLPANMKKNRVLQIIPYDFNRVIIPMKRGEEFTDYINGSFIDGYRQKDAFLAGQGPLQQTVEDFWRMVWEWRSCSIVMLTELEERGQEKCARYWPTEGTITYGDIIIELKQENSHDSYTVRDFSVSNTRENKSRQIRQFHFHGWPEIG-IPEDGKGMISLIAAVQKQQQHTGNH-PITVHCSAGAGRTGTFCALCTILERVKTEGILDVFQTVKSLRTQRPHMVQTLEQYEFCYKVVQEYIEAFSD 745          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Sea Lamprey
Match: ptprsa (protein tyrosine phosphatase receptor type Sa [Source:ZFIN;Acc:ZDB-GENE-020107-3])

HSP 1 Score: 387.497 bits (994), Expect = 2.822e-118
Identity = 206/455 (45.27%), Postives = 277/455 (60.88%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKE--EPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSK-IEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQ-AYIATQCPLKETTEDFWRMLWEQNCGIVITL 5877
            +P++    ++  LK N+N  FS E+ SID   QF+W+ SN   NK KNRYANVVAYDHSRV+L +          +D    +DYINANYI+GYR+ NAYIA+QGPL +T+ DFWRM+WEQRS  IVM+T L ER+RVKC+QYWP  NRG+  +YG + VT+    E A +  RSF + + G  E+R+++ FQFTAWPDHGVP+   P L F+ R++       D GP++VHC       G +     M E      +V +Y  VT +R+QRNYMVQTEEQY F+H  L++   S  T+     L +H+++LS+ + + +    + TG  LE++RL + S L     P                          +  L  N+ KNR    +PPD++RV L  IRG +GSDY NAS+IDG++S+Q AYIATQ PL ETTED WRMLWEQN  IV+ L
Sbjct:  180 IPVSEFAGHVERLKANDNMLFSQEYESIDPGQQFTWDHSNLEINKHKNRYANVVAYDHSRVILHT----------IDGVPGSDYINANYIDGYRRHNAYIASQGPLADTVADFWRMVWEQRSSTIVMMTKLEERARVKCDQYWP--NRGSE-SYGLVQVTLTDTVELATYSTRSFTLTRSGCTERRDVRQFQFTAWPDHGVPEFPTPVLAFLRRVRAAWGSSADGGPLIVHCRQRSDVCGCFFVGLFMQEGHYGCITVSLYLQVTCMRAQRNYMVQTEEQYAFVHTALVEAVSSGCTETPARSLHAHLQRLSQSVSHTEP---RTTGLHLEFQRL-QMSKLRVSTAP--------------------------SGALPCNKLKNRLLTVIPPDSSRVALQAIRGTQGSDYINASYIDGYRSQQRAYIATQGPLPETTEDLWRMLWEQNSTIVVML 591          

HSP 2 Score: 151.754 bits (382), Expect = 4.608e-38
Identity = 86/247 (34.82%), Postives = 130/247 (52.63%), Query Frame = 1
Query: 5626 NYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLT 6351
             ++ S L +N+ KNR    +  D +RVIL  I GV GSDY NA++IDG++   AYIA+Q PL +T  DFWRM+WEQ    ++ +  + E     C+QYWPN  S  Y    V      +++ +  R F LT +   + R +RQFQFT W D   +P     +L  + +V+         GPL VHC   S   G F V   + E       V+++     ++ QR  ++++E+QY F   AL+E ++
Sbjct:  214 TWDHSNLEINKHKNRYANVVAYDHSRVILHTIDGVPGSDYINANYIDGYRRHNAYIASQGPLADTVADFWRMVWEQRSSTIVMMTKLEERARVKCDQYWPNRGSESYGLVQVTLTDTVELATYSTRSFTLTRSGCTERRDVRQFQFTAWPDHG-VPEFPTPVLAFLRRVRAAWGSSADGGPLIVHCRQRSDVCGCFFVGLFMQEGHYGCITVSLYLQVTCMRAQRNYMVQTEEQYAFVHTALVEAVS 459          

HSP 3 Score: 96.6709 bits (239), Expect = 2.168e-20
Identity = 51/96 (53.12%), Postives = 61/96 (63.54%), Query Frame = 1
Query: 4648 PTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYR-KQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSR 4932
            P NK KNR   V+  D SRV LQ+ +            + +DYINA+YI+GYR +Q AYIATQGPL ET  D WRM+WEQ S I+VMLT L E  R
Sbjct:  514 PCNKLKNRLLTVIPPDSSRVALQAIRGT----------QGSDYINASYIDGYRSQQRAYIATQGPLPETTEDLWRMLWEQNSTIVVMLTKLREMGR 599          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Sea Lamprey
Match: ca16b (carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE-080818-1])

HSP 1 Score: 354.369 bits (908), Expect = 1.165e-105
Identity = 215/653 (32.92%), Postives = 325/653 (49.77%), Query Frame = 1
Query: 4504 IKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQ---FSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKI-------------GSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHC--SAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKL-----SKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITL----HYVPECNQYWPNDRSA-RYQFFVVDPIIEYQM-----SHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSD 6363
            I +    +P+ L   ++  +       FS EF  +         + E SN P NK KNRY N+VAYDHSRV L+     +         + +DYINANY++GY +Q AYIA QGPL  T  DFWRM+WEQ + IIVM+T L+E+ R KC+QYWP     ++  YG I+VT+   +  A +  R F ++               G   +R +  F +T WPD G P   +P L F+ +         GPVVVHC  SAGVGRTG YI +D+ML+Q++   +V+V  ++ HIR+QRNY+VQ +EQY FIH+ LL+   +  T++A  QL ++   +     + +        + T  + ++R + + S   S                       FS   +       N+ KNR+   +P + +RV L  + G+EG+DY NAS+I G+     +I TQ PL  TT DFWRM+W+ N  I++ L        + + YWP    A     F V  I E ++        V+ +F L   +D     +R +Q   W D    P+S  +  E+I+ ++  +E   + GP  +H   G +  G F  L+ LL +L+    V+VF+  K++   RP +    +QY F + A L  +    D
Sbjct:   64 IPEDGEALPVKLFARHVGEMHEGALHSFSQEFEEVQRCTADLGITAEHSNHPENKHKNRYVNIVAYDHSRVRLRPLPGKDS--------KHSDYINANYVDGYNRQKAYIAAQGPLKATFADFWRMVWEQNTGIIVMITNLVEKGRRKCDQYWPSE---SNEEYGNILVTLKSTRTLACYTVRHFTIRNTKLRKGTSQKSSARGRQNERLVVQFHYTQWPDMGTPDYALPVLTFVRKSSATRTDLMGPVVVHCRRSAGVGRTGTYIVLDSMLQQIRDSGTVNVLGFLKHIRTQRNYLVQPQEQYTFIHESLLEAVLTGETEVAPGQLHAYYTSILSPAATDVTRPVVTATENTHLEKQFRLVTQCSVRQSEF---------------------FSATKH------CNKEKNRNSSIVPVERSRVGLSSLSGLEGTDYINASYITGYYRSNEFIVTQHPLPHTTRDFWRMIWDHNAQIIVMLPDGQGLAEDESVYWPGREEAMNCDDFTVTLINEDRLCLANEEQLVIHDFILECLQDDYVLEVRHYQCPRWPDTEG-PLS--NAFEIINVIR--EEATTRDGPTILHDEFGGVSAGTFCALTTLLHQLEEQESVDVFQVCKMVNLMRPGVFTDIEQYHFVYRAALSLIGTRED 673          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Sea Lamprey
Match: ptprk (protein tyrosine phosphatase receptor type K [Source:ZFIN;Acc:ZDB-GENE-030131-9834])

HSP 1 Score: 359.377 bits (921), Expect = 2.002e-101
Identity = 207/620 (33.39%), Postives = 318/620 (51.29%), Query Frame = 1
Query: 4510 QFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWS--SLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE---CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQS--RVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +    V +A L E+I  +KT E  GF  E+ S        W+ + +  N++KNRY N++AYDHSRV+L          + LD  +++DYINANY++GY + + YIATQGPL +T+  FWRMIW++RS  I+M+T L+E  R+KC +YWP  +      YG I VT+   +  + +I R+F V++ G  + RE++ F FT WPDHGVP      L FI RIK  +P  +GP+VVHCSAG GRTG Y+ +D ML+  + E  +D+Y+ V  +R++R  MVQTEEQY+FIHD +L+     +T I                           F+  Y  +LR    S  +H+    ++             P     +   + L  N  KNR    LPPD     L  I G + S+Y NA+ +D ++   A+I TQ PL  T +DFWR++++ +C  ++ L+ +     C QYWP +    +    V+ +        + R F++ +    Q   R++ QF +  W     +P S    L L+   ++ +E++G  G   VHC     R     +LS++         + + E  + +      L+  + QYQFC+   LEYL
Sbjct:  893 RLHPAVRVADLLEHIGQMKTGEGYGFKEEYESFFEGQSAPWDVAKRDENRAKNRYGNIIAYDHSRVML----------NVLDEEQNSDYINANYVDGYYRTHHYIATQGPLPDTVGGFWRMIWQERSASIIMVTNLVEVGRIKCCKYWPDGSD----VYGDIKVTLADTEMLSEYIIRTFRVERAGQEDIREVRQFHFTGWPDHGVPYHATGLLAFIRRIKALDPPHAGPLVVHCSAGAGRTGCYMVIDIMLDMAESEGVIDIYNCVRELRTRRVNMVQTEEQYVFIHDAMLEACLCGDTCIPAGD-----------------------FRAAYAEMLRPDPQSSSNHIKDEFQTLNM--------VTPPLRVEDCSIALLPRNHEKNRYHDVLPPDRCLPFLITING-DSSNYINAALMDSYRQPSAFIVTQHPLPNTVKDFWRLVFDYHCTSIVMLNELDSNKYCPQYWPEEGMLCHGPIQVEFVAFNMEGDIITRTFRICNVARPQDGCRMVEQFHYLGWPAGREVPTSRHSFLRLVLAAERWREEYGMDGRTVVHCLNPPPRLLSLPLLSLMATANNHMYQIIITELVEKIMAIYKGLVNLQSQYQFCYDVALEYL 1466          

HSP 2 Score: 98.5969 bits (244), Expect = 1.412e-20
Identity = 77/258 (29.84%), Postives = 115/258 (44.57%), Query Frame = 1
Query: 4648 PTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEK--REIKHFQFTAWP-DHGVPQCTIPFLMFI---NRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSV 5403
            P N  KNRY +V+  D     L +   +N          S++YINA  ++ YR+ +A+I TQ PL  T+ DFWR++++     IVML  L   S   C QYWP+     H   G I V           I R+F +  +  P+   R ++ F +  WP    VP     FL  +    R ++E  +D G  VVHC     R      +  M     H   + +   V  I +    +V  + QY F +DV L+Y ++V
Sbjct: 1229 PRNHEKNRYHDVLPPDRCLPFLIT---ING--------DSSNYINAALMDSYRQPSAFIVTQHPLPNTVKDFWRLVFDYHCTSIVMLNEL--DSNKYCPQYWPEEGMLCH---GPIQVEFVAFNMEGDIITRTFRICNVARPQDGCRMVEQFHYLGWPAGREVPTSRHSFLRLVLAAERWREEYGMD-GRTVVHCLNPPPRLLSLPLLSLMATANNHMYQIIITELVEKIMAIYKGLVNLQSQYQFCYDVALEYLETV 1469          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002738.1 (pep scaffold:Pmarinus_7.0:GL477626:22501:55781:-1 gene:ENSPMAG00000002497.1 transcript:ENSPMAT00000002738.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 336.265 bits (861), Expect = 5.119e-101
Identity = 199/605 (32.89%), Postives = 312/605 (51.57%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYI--NGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHC--SAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYV---PECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFK---LTDARDGQSRV--MRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFG-QKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIE 6300
            + +A L ++I  +K+ E  GF  E+ S        W+ + K  N+ +NRY N++A  HS+ +    + V           S DY  A Y+  +GY+KQ  YIATQGPL ET  DFWRM+W+++S  IVM+T L+E  RVKC +YWP   +      G I VT+   +  A ++ R+F V++ G  +  E++ F FT WPDHGVP      L F+ R+K   P ++GP++ HC  SAG GRTG Y+ +D MLE    E  +DVY+ V  +R QR  MVQTEEQY+FIHDVLL+     +T I  +   S   +L++++ +                        +H TP  +   +  +       P     +   + L  N SKNR   +LPPD     L  + G + S+Y NA+ +D +    A+I TQ PL  T +DFWR++++ +C  VI L+ +     C QYWP + S +Y    V+ +   +    + R F+   ++  +DG   V  ++  Q+  W      P S    L +  +V++   +   ++G   VHC +G  R+G +  +S+L + +K  + V+VF   K L+  +P ++E
Sbjct:    3 IRVADLLQHIGQMKSTEGCGFKEEYESFLDGQSAPWQVAKKDENRGRNRYGNIIALKHSQKLKVRKQRV----------LSQDYTEA-YVEQHGYQKQRQYIATQGPLQETAVDFWRMVWQEKSSSIVMVTNLVEVGRVKCFKYWPDDTQ----QLGDIAVTLLHTELLAEYVIRTFSVKRKGYFDALEVRQFHFTGWPDHGVPAFATGLLSFVRRVKASNPPEAGPIITHCRDSAGAGRTGCYVVIDVMLEMAGREGVIDVYNCVRELRLQRVNMVQTEEQYVFIHDVLLEACLCGDTAIPAANFRSAYLELTRLDPQ------------------------THSTPLKEEFMTLNTVT-----PALRAEDCSIALLPRNSSKNRVKEALPPDRCLPFLLTLEG-DSSNYINAALLDSYHRPSAFIVTQHPLPNTVKDFWRLVFDYHCTSVIMLNEMRPSETCPQYWPEEGSLQYGAVHVETLSCCRDGDIISRIFRIHNISRPQDGHREVQHVQHLQYLGWPSHRDAPASPLSFLRVAGRVRRWHAELAEEEGRTLVHCLSGGGRSGTYCAVSVLCDMVKGQSVVDVFTAVKTLRNNKPDMVE 562          

HSP 2 Score: 110.538 bits (275), Expect = 8.869e-25
Identity = 62/199 (31.16%), Postives = 111/199 (55.78%), Query Frame = 1
Query: 5767 GFKSRQAYIATQCPLKETTEDFWRMLW-EQNCGIVITLHYVP----ECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHC--NTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLE 6342
            G++ ++ YIATQ PL+ET  DFWRM+W E++  IV+  + V     +C +YWP+D + +     V  +    ++ +V+R F +       +  +RQF FT W D   +P     LL  + +V+ +     + GP+  HC  + G+ RTG ++V+ ++LE    +  ++V+   + L+ QR +++++E+QY F    LLE
Sbjct:   85 GYQKQRQYIATQGPLQETAVDFWRMVWQEKSSSIVMVTNLVEVGRVKCFKYWPDD-TQQLGDIAVTLLHTELLAEYVIRTFSVKRKGYFDALEVRQFHFTGWPDHG-VPAFATGLLSFVRRVKASNPP--EAGPIITHCRDSAGAGRTGCYVVIDVMLEMAGREGVIDVYNCVRELRLQRVNMVQTEEQYVFIHDVLLE 279          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Yeast
Match: PTP1 (Phosphotyrosine-specific protein phosphatase; dephosphorylates a broad range of substrates in vivo, including Fpr3p; localized to the cytoplasm and the mitochondria; proposed to be a negative regulator of filamentation [Source:SGD;Acc:S000002389])

HSP 1 Score: 120.939 bits (302), Expect = 7.924e-30
Identity = 92/305 (30.16%), Postives = 148/305 (48.52%), Query Frame = 1
Query: 4618 NQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYIN----------GYRKQNAYIATQGPLLETINDFWRMIWEQ---RSVIIVMLTLLMERSRVKCEQYWPK------------------SNRGTHFTYGGIMVTVNLVQEFAYFICRSFVV---QKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDS--GPVVVHCSAGVGRTGVYIAVDAML----------EQMKH-EKSVDVYS------YVTHIRSQRNYMVQTEEQYIFIH 5373
            +++S   S +P N ++NRY N++ Y+ +RV L++                NDYINA+Y+           GY     YIATQGP  +T + FW+M +      +++IVM+T L+E +R KC QYWP+                  +N  T F     +  VN+ +   Y+      +     +  P K  + HF F  W D   P+  +P +           L+S   P++VHCSAGVGRTG +IA+D ++          E+ +H +++ + Y+       V  +RSQR  MVQT++Q++FI+
Sbjct:   40 SRWSLGVSIEPRNDARNRYVNIMPYERNRVHLKT-------------LSGNDYINASYVKVNVPGQSIEPGY-----YIATQGPTRKTWDQFWQMCYHNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVK-TVHHFYFDLWKDMNKPEEVVPIMEL---CAHSHSLNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIY 322          

HSP 2 Score: 70.0922 bits (170), Expect = 9.349e-13
Identity = 69/281 (24.56%), Postives = 121/281 (43.06%), Query Frame = 1
Query: 5653 NQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQA-----YIATQCPLKETTEDFWRMLWEQNCGI--VITLHYVP-------ECNQYWPN---DRSARYQF-------------FVVDPIIEYQMSHFVMREFKLTDAR-------DGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILL----------------EKLKTDNCVNVFETFKL-LKWQRPSLIESEDQYQFCFAA 6333
            N ++NR    +P + NRV L   + + G+DY NAS++      Q+     YIATQ P ++T + FW+M +  NC +  ++ +   P       +C QYWP    D + R                F  D  IE+   H V   + +TD +        G  + +  F F  W D +      E ++ +++    +     +  P+ VHC+ G  RTG F+ L  L+                ++   +   ++ E   L L+ QR  +++++DQ+ F + A
Sbjct:   52 NDARNRYVNIMPYERNRVHL---KTLSGNDYINASYVKVNVPGQSIEPGYYIATQGPTRKTWDQFWQMCY-HNCPLDNIVIVMVTPLVEYNREKCYQYWPRGGVDDTVRIASKWESPGGANDMTQFPSDLKIEFVNVHKVKDYYTVTDIKLTPTDPLVGPVKTVHHFYFDLWKDMN----KPEEVVPIMELCAHSHSLNSRGNPIIVHCSAGVGRTGTFIALDHLMHDTLDFKNITERSRHSDRATEEYTRDLIEQIVLQLRSQRMKMVQTKDQFLFIYHA 324          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Yeast
Match: PTP2 (Nuclear phosphotyrosine-specific phosphatase involved in osmosensing; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; with Msg5p co-regulates the calcium signaling pathway [Source:SGD;Acc:S000005734])

HSP 1 Score: 92.4337 bits (228), Expect = 3.922e-19
Identity = 89/332 (26.81%), Postives = 135/332 (40.66%), Query Frame = 1
Query: 4660 SKNRYANVVAYDHSRVVL------------QSSKLVNDICDSLDPY-------RSNDYINANYIN--GYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIK-------------------------HFQFTAWPDH-GVPQCTIPFL------------MFINRIKKE----------------EPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQM----KHEKSVDVYSY--------VTHIRSQRNYMVQTEEQYIFIHDVLLDYF 5394
            +KNRY+N++ Y+HSRV L             +++   D    + P        + NDYINANY+          YIATQ PL  T++DFW++I   +  +I+ L    E +  K + YW   +   H     +  T   +      + R F V+K   P+   I                            Q+  W D  GV    I  L             FI  ++K+                +  +S P++VHCSAG GRTGV++ +D +L  +     H   +DV++         V  +R QR  MVQ   QYI  ++ LL+YF
Sbjct:  410 TKNRYSNILPYEHSRVKLPHSPKPPAVSEASTTETKTDKSYPMCPVDAKNHSCKPNDYINANYLKLTQINPDFKYIATQAPLPSTMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYWNNLSYSNHTI--KLQNTWENICNINGCVLRVFQVKKTA-PQNDNISQDCDLPHNGDLTSITMAVSEPFIVYQLQYKNWLDSCGVDMNDIIKLHKVKNSLLFNPQSFITSLEKDVCKPDLIDDNNSELHLDTANSSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACYEALLNYF 738          

HSP 2 Score: 63.5438 bits (153), Expect = 3.045e-10
Identity = 68/289 (23.53%), Postives = 111/289 (38.41%), Query Frame = 1
Query: 5710 LCPIRGVEGS----DYFNASWID--GFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQ-----YWPNDRSARYQFFVVDPIIEY-QMSHFVMREF---KLTDARDGQSR---------------------VMRQFQFTNWIDDSCIPI----------------------SIEHLLELIDQVQKTKEQF----GQKGPLTVHCNTGSIRTGIFLVLSILLEKLK-TDNCVNVFETFKL-----------LKWQRPSLIESEDQYQFCFAALLEYLTL 6354
            +CP+     S    DY NA+++          YIATQ PL  T +DFW+++      ++I+L+   E N      YW N   + +   + +       ++  V+R F   K     D  S+                     ++ Q Q+ NW+D   + +                      S+E  +   D +     +         PL VHC+ G  RTG+F+ L  LL  L  T N  N  + + +           L+ QR S++++  QY  C+ ALL Y  L
Sbjct:  452 MCPVDAKNHSCKPNDYINANYLKLTQINPDFKYIATQAPLPSTMDDFWKVITLNKVKVIISLNSDDELNLRKWDIYWNNLSYSNHTIKLQNTWENICNINGCVLRVFQVKKTAPQNDNISQDCDLPHNGDLTSITMAVSEPFIVYQLQYKNWLDSCGVDMNDIIKLHKVKNSLLFNPQSFITSLEKDVCKPDLIDDNNSELHLDTANSSPLLVHCSAGCGRTGVFVTLDFLLSILSPTTNHSNKIDVWNMTQDLIFIIVNELRKQRISMVQNLTQYIACYEALLNYFAL 740          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Yeast
Match: PTP3 (Phosphotyrosine-specific protein phosphatase; involved in the inactivation of mitogen-activated protein kinase (MAPK) during osmolarity sensing; dephosporylates Hog1p MAPK and regulates its localization; localized to the cytoplasm [Source:SGD;Acc:S000000877])

HSP 1 Score: 73.559 bits (179), Expect = 2.862e-13
Identity = 100/386 (25.91%), Postives = 148/386 (38.34%), Query Frame = 1
Query: 4660 SKNRYANVVAYDHSRVVL----QSSKLVNDICDSLDPYRSNDYINANYINGYR---KQNA-------------YIATQGPL-------------------LETINDFWRMI------WEQRSVIIVMLTLLMER-SRVKCEQYWPKSNRGTH----FTYG--------------------------GIMVTVNLVQEFAYFICRSFVVQKI-----GSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDS------------GPVVVHCSAGVGRTGVYIAVDA------MLEQMKHE--------KSVDVYSYVTHI-RSQRNYMVQTEEQYIFIHDVLLDYFQ--------------SVNTDIACSQLFSHIEKL 5451
            +KNRY ++  Y+HSRV+L    QSSK +     + D    ++YINANY++  R   +QN+             YIATQ P+                   L   NDF   I      W++ +   + + LL ++  ++       K+  GT     ++ G                           I VT     +       + +++KI        +  E+   Q   WPD G     I  L  IN   K   +D+              ++VHCSAG GRTG    +D+      M E ++ E        K  D  S+  +I R QR  MVQ   Q+IFI+D LL YF+              S   +I+ S L   IEKL
Sbjct:  529 AKNRYKDIFPYEHSRVILKKGLQSSKGIKHSHSTSDGGILDNYINANYLSLPRFSVEQNSSFQTTTTTTRRVRYIATQAPMPSTVHDFYTCILNNGVPLVLSLTNDFENGIEKCYRYWQEGNYNGIHVKLLEKKILKMPSTTSMRKNTMGTQNSSLYSAGVQGNSSNYSTDNDNDNDNNNNNNNNSNIAVTAAACDDDDDDDDDAILIRKILLTYHDQEKPYELLQIQVKNWPDLGTLLNPISILQAINV--KNHIIDTLFARNYYQNDQLPTILVHCSAGCGRTGTLCTIDSILSNFEMFEMLQKEFVKLKYPAKLFDPISWTINIFRKQRISMVQNINQFIFIYDCLLFYFRLRLDDITERTDGDGSNKDNISLSALIEQIEKL 912          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Nematostella
Match: EDO46961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP0])

HSP 1 Score: 559.681 bits (1441), Expect = 2.472e-165
Identity = 279/614 (45.44%), Postives = 396/614 (64.50%), Query Frame = 1
Query: 4528 PIALLQ--EYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            PI++L   ++I+ LK + N  F+ E+ SI+    F+ + S    NK KNRY N+ AYDHSRV L     +N I         +DYINAN+ +GYRK+ AYIATQGP+  T  DFWRM+WEQR+  IVMLT   ER RVKC+QYWP    GT   Y GI V++    E A +   +  + K G+ + RE+KHFQFT WPDHGVP    PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +D+MLE+++HE++VD+Y +VT +R+QRNYMVQT+EQYIF HD +L+     NT++    L  HI+KL+++     G  + TG + E+ +++  S    H                           Y  + L +N+ KNR    LP +T RV + P+RGVEGSDY NAS+IDG++ R  +IATQ PL++T +DFWRML EQN  I++ L  + E     C +YWP DRSAR+Q+++VDPI E++   FV+R+FK+ DAR    R ++QF F  W  ++ +P S E +++LI QVQ+  EQ  ++GP+TVHC+ G  RTG+F  L I+LE+++++  V++F+T KLL+ QRP++++S++QY FC+   LEYL
Sbjct: 1299 PISVLDLPKHIAILKADNNSQFTQEYESIEPGQTFTADSSQMECNKGKNRYPNIHAYDHSRVRLS---YINGI-------EGSDYINANFCDGYRKERAYIATQGPMQHTAADFWRMVWEQRTFTIVMLTREEERGRVKCDQYWPTD--GTD-VYEGIEVSLVDWVELANYTISTLQICKEGASQPREVKHFQFTGWPDHGVPAHPTPFLAFLRRVKFYNPPDAGPIVVHCSAGVGRTGCFIVIDSMLERLRHEETVDIYGHVTVLRTQRNYMVQTQEQYIFSHDAILEAVSCGNTEVHARNLLHHIKKLTEL-----GKGEVTGLEEEF-KVVDPSQAKKH--------------------------KYGAATLAINRPKNRLANILPYETTRVHISPVRGVEGSDYINASFIDGYRQRGLFIATQGPLQDTVDDFWRMLMEQNSNIIVMLTQLHEGEWEKCYKYWPTDRSARHQYYIVDPIAEHEYPQFVIRDFKVKDARSDTVRNIKQFHFLGW-PETGVPKSGEGIIDLIGQVQRAYEQQEEEGPITVHCSDGVGRTGVFTALFIVLERMRSEGVVDLFQTVKLLRTQRPAMVQSQEQYLFCYKTALEYL 1866          

HSP 2 Score: 205.682 bits (522), Expect = 7.026e-53
Identity = 110/289 (38.06%), Postives = 164/289 (56.75%), Query Frame = 1
Query: 4552 ISNLKTNENRGFSTEFVSID--HANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK--EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            ++ L   E  G   EF  +D   A +  +  +    N+ KNR AN++ Y+ +RV +   + V            +DYINA++I+GYR++  +IATQGPL +T++DFWRM+ EQ S IIVMLT L E    KC +YWP      H  Y   +V      E+  F+ R F V+   S   R IK F F  WP+ GVP+     +  I ++++  E+  + GP+ VHCS GVGRTGV+ A+  +LE+M+ E  VD++  V  +R+QR  MVQ++EQY+F +   L+Y  S +
Sbjct: 1595 LTELGKGEVTGLEEEFKVVDPSQAKKHKYGAATLAINRPKNRLANILPYETTRVHISPVRGVE----------GSDYINASFIDGYRQRGLFIATQGPLQDTVDDFWRMLMEQNSNIIVMLTQLHEGEWEKCYKYWPTDRSARHQYY---IVDPIAEHEYPQFVIRDFKVKDARSDTVRNIKQFHFLGWPETGVPKSGEGIIDLIGQVQRAYEQQEEEGPITVHCSDGVGRTGVFTALFIVLERMRSEGVVDLFQTVKLLRTQRPAMVQSQEQYLFCYKTALEYLGSFD 1870          

HSP 3 Score: 196.823 bits (499), Expect = 4.277e-50
Identity = 136/538 (25.28%), Postives = 231/538 (42.94%), Query Frame = 1
Query:  268 PRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR---DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQML-DGKNLFILKTMESDTGKYQCMAINEFGSMIS----PAK---SLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIME--------------LKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILW 1806
            P++ + +    +  IC   G+P P +TW  NG      R  I       ++ +   R++ + A   C   N +G   + +S  + +  +  P GFP+     S    +   +VT  C   G     + WFKD  P+ L   R  +L DG+ L I    ESD GKY C+A N  G + S    PA+    L + V R  P F     D+ +   + V+LKCS  GSPTP + W    ++++G NG           E+++  I  S N +C+A +         ++ V+ LP AP+    + I+  +  +TW                           P    + ++S E+Q      T+  E              L+P+++Y   +      G S PS +  + T ET+P SAPR++     S+TS +  W PPI  NG I  Y+++Y+    + ++QW   +         +  S  +  L R T ++F + + N AG+GP S++V          Q +++ + ++ S +  + W
Sbjct:    7 PKDFAGVTRGFVYMICNVTGSPMPTLTWYKNGSVIRNSRIQIFTMPYGGLIRIGPLRAKIHKATYECEADNGVGPPLRDSSTLIVHTASTKPAGFPRIAKHPSFKQRRSGDDVTFTCAAVGTPTPNITWFKDRLPIVLNDPRVSVLSDGRKLRITDLRESDNGKYSCVARNALGMVFSSQAMPARLFIYLTLSVVRSKPEFTLRPQDKTVDPDTDVELKCSARGSPTPSIVWEVDGSRISGQNG-----------ELIIRGIQRSGNYSCIADSNMGRVQAYAYVTVRLLPFAPSRPNAASITSDAIKITW--------------------------HPRGAHV-VTSYEVQYRLKGKTEWQEITNVRGMQSLVVSGLRPFSSYEFRVFAVNSLGRSRPSLMAEYTTSETKPGSAPRNIEAMGVSDTSFKAGWLPPISANGRIRGYRLYYSLDLLEDISQWRFMA--------SSTNSTTVTGLTRQTTHFFRILAYNIAGDGPLSEVVAVKTQKGVPGQPRSVQLSVLSSTAIRVTW 498          

HSP 4 Score: 160.999 bits (406), Expect = 2.887e-39
Identity = 84/256 (32.81%), Postives = 142/256 (55.47%), Query Frame = 1
Query: 5614 FSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            F+ ++ +  C   N+ KNR P     D +RV L  I G+EGSDY NA++ DG++  +AYIATQ P++ T  DFWRM+WEQ    ++ L    E     C+QYWP D +  Y+   V  +   +++++ +   ++      Q R ++ FQFT W  D  +P      L  + +V+         GP+ VHC+ G  RTG F+V+  +LE+L+ +  V+++    +L+ QR  ++++++QY F   A+LE ++  + E
Sbjct: 1333 FTADSSQMEC---NKGKNRYPNIHAYDHSRVRLSYINGIEGSDYINANFCDGYRKERAYIATQGPMQHTAADFWRMVWEQRTFTIVMLTREEERGRVKCDQYWPTDGTDVYEGIEVSLVDWVELANYTISTLQICKEGASQPREVKHFQFTGW-PDHGVPAHPTPFLAFLRRVKFYNPP--DAGPIVVHCSAGVGRTGCFIVIDSMLERLRHEETVDIYGHVTVLRTQRNYMVQTQEQYIFSHDAILEAVSCGNTE 1582          

HSP 5 Score: 60.4622 bits (145), Expect = 9.373e-9
Identity = 53/208 (25.48%), Postives = 92/208 (44.23%), Query Frame = 1
Query: 1096 KNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTK-IMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPI--ETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSS 1710
            K +P  P  V++S +S  +  +TW         I  + V+Y  +          +D+D     +   F +NTK IM L PYT Y + +     +GV   S + + +T E  P+ AP+++       T++ + W PP     NG IT + + Y    +      ++++ K          SV ++ LD+ T Y+  V +    G+GP S
Sbjct:  475 KGVPGQPRSVQLSVLSSTAIRVTWSPPRYPGDGIFGYDVYYNKS---------KQDMDT----VIGAFQMNTKEIMGLTPYTVYKVAVAAKSDKGVGPMSFVLTARTDEDRPSDAPQNIQGRSRDSTTLEISWDPPRPEHRNGLITHFTIKYRAKGQRGAKYLTVDATKT---------SVVLHNLDKFTNYFIWVQASTKQGDGPFS 660          

HSP 6 Score: 57.7658 bits (138), Expect = 7.799e-8
Identity = 51/204 (25.00%), Postives = 88/204 (43.14%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSV------LHLSSARSEDNGAIVSCVCRNVMG----SEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSP 831
            P+I   P      +   + F C + G P P +TW    K +LP   N  R SV      L ++  R  DNG   SCV RN +G    S+   A + +Y  ++ V +  P++  +        +++V L+C   G    ++VW  D             + G+N  ++      +G Y C+A +  G + + A  + +R+  F+P
Sbjct:  102 PRIAKHPSFKQRRSGDDVTFTCAAVGTPTPNITWF---KDRLPIVLNDPRVSVLSDGRKLRITDLRESDNGKY-SCVARNALGMVFSSQAMPARLFIYLTLSVV-RSKPEFTLRPQDKTVDPDTDVELKCSARGSPTPSIVWEVDG----------SRISGQNGELIIRGIQRSGNYSCIADSNMGRVQAYA-YVTVRLLPFAP 289          

HSP 7 Score: 56.9954 bits (136), Expect = 1.336e-7
Identity = 41/139 (29.50%), Postives = 63/139 (45.32%), Query Frame = 1
Query: 1315 IMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPP-IETNGEITLYQVFYTKSKED------PLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSS 1710
            +  L  +TNY +W+  +  +G    S  H+  T E  P  APR V I + + T++ VKW PP  + +G+I  Y VFYT+  +       P    S +S+       E +  V +  L   T Y   V +    G+G  S
Sbjct:  635 LHNLDKFTNYFIWVQASTKQGDGPFSDKHTVSTAEDVPNGAPRDVRIRVHNSTTMTVKWNPPTTKQDGKILGYMVFYTRVDDQGNQLRPPAQPESKDSM------SEENHKVHLTGLAPETTYQIEVAAYTIKGDGARS 767          

HSP 8 Score: 53.5286 bits (127), Expect = 1.504e-6
Identity = 43/159 (27.04%), Postives = 72/159 (45.28%), Query Frame = 1
Query: 1267 DISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDE 1743
            DIS          +T +  L   T +   ++   + G    S++ + +T +  P   PRSV +++ S T++RV W PP      I  Y V+Y KSK+D  T        ++   + N K  EI  L   T+Y   V +++  G GP S ++    ++D 
Sbjct:  425 DISQWRFMASSTNSTTVTGLTRQTTHFFRILAYNIAGDGPLSEVVAVKTQKGVP-GQPRSVQLSVLSSTAIRVTWSPPRYPGDGIFGYDVYYNKSKQDMDT--------VIGAFQMNTK--EIMGLTPYTVYKVAVAAKSDKGVGPMSFVLTARTDEDR 572          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Nematostella
Match: EDO48187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK45])

HSP 1 Score: 477.633 bits (1228), Expect = 8.781e-150
Identity = 254/618 (41.10%), Postives = 363/618 (58.74%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIE--HLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLY 6357
            + I   +++++ ++ + +  F+TE+  I      +   S  P N+ KNRY N+VAYDHSRV LQ            +    +DYINAN++ GYR+ NAYIA QGPL ET  DFWRM+WEQ S  I+MLT L ER R KC QYWP  +RG+  +Y  I VT++ V E   +I R+  VQ+ G  + R++K F FT+WPDHGVP      L F+    + +P  +GP+VVHCSAGVGRTG +I +D ML+Q+  EK+VD+  +V+ +R  RN MVQTE+QYIFIHD LLD   S  T+ + S L SHI +L + + E      FT FQ   R +    SL +   P                               VN+ KNR    LP D  RV L    GVEGSDY NA++IDG+ +++ +IATQ P+ ET  DFWRM+WEQNC  ++TL    E      ++YWP  +   +   VV+   + +  H V+R FKLT+     SR +RQF +T+W +++ +   +    L++LI QVQ  + + G + P+ VHC+ G  RTG+F  +SIL+E+LK +  V+VF+T K L+ QRP++++++ QY FC+  +LEYL  +
Sbjct:    1 ISIDDFEQHVARMRRSGDLFFTTEYERIPVPEHVTATHSLDPVNQHKNRYINIVAYDHSRVKLQD----------FEDEPGSDYINANFLPGYRRDNAYIAAQGPLAETCRDFWRMVWEQNSRTIIMLTNLKERCRDKCAQYWP--SRGS-LSYEDITVTLDSVTELTPYIVRTLSVQREGCDDVRQVKQFHFTSWPDHGVPTSVCNLLAFVRDSTRADPPGAGPMVVHCSAGVGRTGTFIVIDVMLQQIHEEKTVDILGFVSTLRRHRNLMVQTEQQYIFIHDALLDAIISGETETSASDLRSHIRRLQEQDPESGYTPMFTEFQKLSRCINSSLSLNAATHP-------------------------------VNKRKNRYANVLPYDVTRVRLSMQVGVEGSDYINANYIDGYMAKRTFIATQAPIPETIPDFWRMVWEQNCCTIVTLAQEVEQAKAKMHRYWPGKQPITFGSLVVEMQDKVKSGHLVVRIFKLTNTEVSASRDVRQFHYTSWTEENPLEDGLSRCQLIDLIGQVQYWQAESG-RHPIIVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKGQYDFCYQVVLEYLASF 573          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Nematostella
Match: EDO43854 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI9])

HSP 1 Score: 477.633 bits (1228), Expect = 1.324e-149
Identity = 248/615 (40.33%), Postives = 369/615 (60.00%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQ-FSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEK-REIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +P+     ++  +  + + GFS E+  +   ++ F+W  S  P NK KNRYAN+VAYDHSRV+L            L+    +DYINANYI+GY +  A+IA+QGPL ET +DFWRM+WEQ S IIVMLT L ER R KC+QYWP  +RGT   YG + VT N     +Y++ R+F+V  +   E+ R+++ + +T+WPDHGVP    P L  +  +    P  +GP++VHCSAGVGRTG +I +D+ML++   E ++DV+ +V  +R++RN MVQTE QY+FIHD L++      T++  ++L S I +L +++      +  T   LE+ RL R                            +     ++++ L  N +KNR    LP +  RV L    G  GSDY NAS+IDG    +AYIATQ P+  T EDFWRMLWEQ   +++ L    E     C++YWP+D S  Y   +V+   E   S +V+R+F LT   +  SR++RQFQ T+W  DS +P S   L++LI QV+K ++Q G    +TVHC+ G  RTG+F  +SIL+E++K +  ++VF+T + L+ QRP++++++DQY+FC+  + EYL
Sbjct:    2 IPVEAFAMHVRRMHMDGDIGFSEEYEMVQPNDETFTWHHSLHPANKYKNRYANIVAYDHSRVLLTP----------LEGVLESDYINANYIDGYNRSGAFIASQGPLPETFDDFWRMVWEQGSAIIVMLTQLEERGRRKCDQYWP--DRGTR-NYGALRVTANETFHMSYYVLRTFLVSHMQEEEEPRQVRQYHYTSWPDHGVPAHPAPLLSMVRTVSSANPPTAGPMIVHCSAGVGRTGTFITLDSMLQRAAQEGTIDVFGFVRQMRNKRNLMVQTESQYVFIHDALVEAVICGVTEVDANKLASRIRELREVDPN----IGTTYMDLEFERLTR---------------------------DERHPTQFKSAMLSCNAAKNRYANILPYERTRVALHMRPGEVGSDYINASFIDGNHRLKAYIATQAPVPRTFEDFWRMLWEQESAVIVMLTREEEAGKLKCHRYWPSDGSRLYDKILVELTEELTYSDYVLRQFSLTHTEEKSSRIVRQFQCTDW-PDSGLPESGVGLIDLIGQVEKWQQQSGNTC-ITVHCSGGVGRTGVFCAVSILIERVKAEGLIDVFQTVQHLRLQRPAMVQTKDQYEFCYTTIQEYL 570          

HSP 2 Score: 187.963 bits (476), Expect = 5.634e-50
Identity = 99/255 (38.82%), Postives = 150/255 (58.82%), Query Frame = 1
Query: 4654 NKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYR-SNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAY--FICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK-EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            N +KNRYAN++ Y+ +RV L            + P    +DYINA++I+G  +  AYIATQ P+  T  DFWRM+WEQ S +IVMLT   E  ++KC +YWP    G+   Y  I+  V L +E  Y  ++ R F +        R ++ FQ T WPD G+P+  +  +  I +++K ++   +  + VHCS GVGRTGV+ AV  ++E++K E  +DV+  V H+R QR  MVQT++QY F +  + +Y +S +
Sbjct:  336 NAAKNRYANILPYERTRVALH-----------MRPGEVGSDYINASFIDGNHRLKAYIATQAPVPRTFEDFWRMLWEQESAVIVMLTREEEAGKLKCHRYWPSD--GSRL-YDKIL--VELTEELTYSDYVLRQFSLTHTEEKSSRIVRQFQCTDWPDSGLPESGVGLIDLIGQVEKWQQQSGNTCITVHCSGGVGRTGVFCAVSILIERVKAEGLIDVFQTVQHLRLQRPAMVQTKDQYEFCYTTIQEYLESFD 574          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Nematostella
Match: EDO45382 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT25])

HSP 1 Score: 458.759 bits (1179), Expect = 4.968e-143
Identity = 248/614 (40.39%), Postives = 362/614 (58.96%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEE-PLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +P+   +E++  L  N    FS E+ +    +  +   S    N+ KNRY N+ A+DH RV+LQ  +         DP  ++DYINANY++GYRKQ  YIA QGPL ET +DFWRM+WEQ S +IVM+T   ER R+KC QYWP S  G+   YG I V +    E + +  RSF V++ GSPE+R +  + +TAWPDHGVP      L F+ +        D GP+VVHCSAGVGRTG Y+ +DA L++++ E +VDVY+YV  +R QRN MVQ E+QY+ IHDVLL+     +T+I    L   I++L +   +       T    E++RL R  +                             + ++++ L VN+ KNR    LP D  RV L      EGSDY NA++IDG+ S++A+IATQ P+ +T  DFWRM+WEQ+C  ++ L    E      ++YWP  +       VV+ + + Q   ++MREFK+T+ ++  SRV+RQ+QFT W D    P S   L++LI QVQ+ +++ G +    VHC+ G  RTG+F  +SIL+E+LK +  V+VF+T K L+ QRP+++++++QY+FC+  L EYL
Sbjct:    1 MPVDEFEEHVRRLHANGELLFSQEYGAFRSPDTVTSHHSLNQANRFKNRYNNITAFDHCRVLLQPIEG--------DP--TSDYINANYLDGYRKQREYIAAQGPLPETCHDFWRMVWEQNSRVIVMVTNCEERGRIKCHQYWPSS--GSQ-NYGVIHVNMMSTVELSDYTIRSFGVKRSGSPEERMVLQYHYTAWPDHGVPNSVTSVLNFVRKSSAVNLTEDYGPMVVHCSAGVGRTGTYVVIDAQLKRIQAEATVDVYNYVMMLRGQRNLMVQVEDQYVLIHDVLLEAIACGDTEIQARDLRQRIKELMRPSTDTGQ----TEMDAEFQRLSRNKA---------------------------PPSKFQSANLPVNKHKNRYANVLPYDDTRVRLTMQAVTEGSDYINANYIDGYMSKKAFIATQAPIPDTIPDFWRMIWEQDCCTIVMLSQEMESGKVKVHRYWPGKQPTSIGNLVVEMLHDKQFDDYIMREFKVTNTKESASRVVRQYQFTAWPDIGS-PDSGGGLIDLIGQVQRWQQKCGVQ-LTAVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKEQYEFCYQTLGEYL 568          

HSP 2 Score: 202.216 bits (513), Expect = 1.059e-54
Identity = 107/260 (41.15%), Postives = 150/260 (57.69%), Query Frame = 1
Query: 4630 WEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKK-EEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            ++ +N P NK KNRYANV+ YD +RV L    +             +DYINANYI+GY  + A+IATQ P+ +TI DFWRMIWEQ    IVML+  ME  +VK  +YWP        + G ++V +   ++F  +I R F V        R ++ +QFTAWPD G P      +  I ++++ ++        VHCSAGVGRTGV+ AV  ++E++K E  VDV+  V  +R QR  MVQT+EQY F +  L +Y  S +
Sbjct:  326 FQSANLPVNKHKNRYANVLPYDDTRVRLTMQAVTE----------GSDYINANYIDGYMSKKAFIATQAPIPDTIPDFWRMIWEQDCCTIVMLSQEMESGKVKVHRYWPGKQPT---SIGNLVVEMLHDKQFDDYIMREFKVTNTKESASRVVRQYQFTAWPDIGSPDSGGGLIDLIGQVQRWQQKCGVQLTAVHCSAGVGRTGVFCAVSILIERLKAEAMVDVFQTVKQLREQRPAMVQTKEQYEFCYQTLGEYLHSFD 572          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Nematostella
Match: EDO31736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX30])

HSP 1 Score: 432.95 bits (1112), Expect = 5.256e-134
Identity = 231/618 (37.38%), Postives = 345/618 (55.83%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQ-NAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQ----YWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSD 6363
            +PIAL  EY++ ++ N      TE+   D+  QF WE + KP NK+KNRYAN+VAYDHSRVVL+    VN   DS       DYINA++I+GY     ++IA+QGPL     DFWRM+WEQ S  IVMLT L+E  + KC +YWP        TYGG+ VT++  + FA +  R+F++ K      R ++ F FT WPD GVPQ     L F  +++   P D+GPV+VHCSAGVGRTG YI +DAMLEQ K  ++VD+ +Y+  +R  R +MVQT+EQY FIH  +L+     NT+I        ++KL+ +  +     Q TG+ LE+++                                     +E +    N++KNR    +  D +R++L  + G E SDY NAS+I   + R A+IATQ PL ET EDFWRM+ + + G ++ L+ + E +Q    YWP+    +Y    V  + + +    +  + K+T  +  ++  +R     +W  D CIP     +L+L+D+ Q +++Q G   P+ V C+ G  R+G F  +S +LE+LKT+  ++VF+  K ++   P  +ES  QY FC+  + +YL  +SD
Sbjct:    2 IPIALFPEYVAKMQANGGIRLETEYKKFDNGQQFPWEAARKPANKNKNRYANIVAYDHSRVVLER---VNGDEDS-------DYINASFIHGYDGTPRSFIASQGPLPPAFEDFWRMVWEQNSQSIVMLTNLVELGKTKCHKYWPDKTE----TYGGVTVTLHQSEIFAEYEIRTFILSKAKQSGSRMVRQFHFTVWPDKGVPQYATAVLAFRRKVRALNPRDAGPVIVHCSAGVGRTGAYIVIDAMLEQAKKSRTVDIRNYLIALRKDRPHMVQTKEQYSFIHSAVLEALTCGNTEIQSENCNQAMQKLASVNRK----FQMTGYALEFQKFDNGQQF-----------------------------PWEAARKPANKNKNRYANIVAYDHSRLVLERVNGNEDSDYINASFIHAHRGRNAFIATQHPLLETVEDFWRMVTDYDIGTIVMLNNLHELDQEYPKYWPDHGPTKYGHIGVSVLSKQEQGDVICTKLKVTRKKVRRTHEVRHLHHVSW-PDKCIPEVACSVLDLLDEAQTSQQQCG-NAPVLVQCSNGVGRSGTFCAISSVLERLKTEQVIDVFQVIKRIRVNLPGAVESPTQYMFCYQIIQKYLDSFSD 570          

HSP 2 Score: 145.976 bits (367), Expect = 4.849e-36
Identity = 85/252 (33.73%), Postives = 138/252 (54.76%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSR-QAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E +    N++KNR    +  D +RV+L  + G E SDY NAS+I G+    +++IA+Q PL    EDFWRM+WEQN   ++ L  + E     C++YWP D++  Y    V        + + +R F L+ A+   SR++RQF FT W D   +P     +L    +V+    +    GP+ VHC+ G  RTG ++V+  +LE+ K    V++      L+  RP ++++++QY F  +A+LE LT  + E
Sbjct:   37 WEAARKPANKNKNRYANIVAYDHSRVVLERVNGDEDSDYINASFIHGYDGTPRSFIASQGPLPPAFEDFWRMVWEQNSQSIVMLTNLVELGKTKCHKYWP-DKTETYGGVTVTLHQSEIFAEYEIRTFILSKAKQSGSRMVRQFHFTVWPDKG-VPQYATAVLAFRRKVRALNPR--DAGPVIVHCSAGVGRTGAYIVIDAMLEQAKKSRTVDIRNYLIALRKDRPHMVQTKEQYSFIHSAVLEALTCGNTE 284          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165843])

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 327/613 (53.34%), Postives = 434/613 (70.80%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI+ L +++  LK N+N  FS E+ SID A QF+WE SN   NK KNRYANV+AYDHSR++L           ++D    +DYINANYI+GYRKQNAYIATQGPL ET  +FWRMIWEQRS ++VM+T L ERSRVKC+QYWP   RGT  TYG I V++    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE+ KHEK+VD+Y +VT +R+QRNYMVQTE+QY+FIHD LL+      T++    L+++I+KL++IE    G    TG +LE++RL   ++  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +   +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQFC+ A LEYL
Sbjct: 1207 IPISELADHLERLKANDNLKFSQEYESIDPAQQFTWEHSNLEVNKPKNRYANVIAYDHSRILL----------SAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWP--TRGTE-TYGLIQVSLLDTVELATYCVRTFSLFKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQIE----GGENVTGMELEFKRL---ANTKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQG-VPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYL 1774          

HSP 2 Score: 228.409 bits (581), Expect = 2.287e-59
Identity = 129/305 (42.30%), Postives = 177/305 (58.03%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEFVSIDH--ANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +  EN  G   EF  + +  A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1489 EVPARNLYAYIQKLTQIEGGENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1778          

HSP 3 Score: 209.149 bits (531), Expect = 1.942e-53
Identity = 155/502 (30.88%), Postives = 224/502 (44.62%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDL--RSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSS---QIVQK 1725
            PK +  P + + +      FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    S  + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P++    + R + L    L I ++ ESD GKY+C+A N  G+  S   +L +RV R  P F     D  I  G SV + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP AP I  ++E +  S  LTW   +                V   I Q  SK  D   KEI         +  L PY++Y   +V     G   PS+    +T E  P++APR V   + S T+  ++W  P E NG+I  Y+V+YT    DP    +I   +IV         V I+ L  N  Y   V +  S G+GP S   QI+ K
Sbjct:   16 PKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISASTRLTVLRE-DQLPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELTDVQQSANYTCVAMSTLGVIEAVAQITVKALPKAPGIPVVTERTATSITLTWDSGNPE-------------PVTYYIIQHKSKYSDDLYKEINGVATTRYSVGGLSPYSDYEFRVVAVNNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTM---DPTQHVNIWEKQIVR----GSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAK 491          

HSP 4 Score: 64.6994 bits (156), Expect = 1.618e-9
Identity = 117/529 (22.12%), Postives = 207/529 (39.13%), Query Frame = 1
Query:  232 YEKIKR--PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKIT--VVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTG-------KYQCMAINEFGSMISPAKSLMIRVSRFSPHFV--YVSPDQFIRTGSSVKLKCSGEGS-------------PTPHV-FW---ICGNTKLTGLNG-DKGQTENIGSIEMV-LSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKY--QXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWK-PPIE-TNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSS 1710
            Y +++R  P+    P +  ++    +   C++ G+P P V W+   +   PE    I  +VL L+  +   N    +CV  + +G  +  A I V        K  PK  G   +T  +  +++TL         +T  ++  K  +  DL    Y+ ++G    +  T  S  G       +++ +A+N  G    P++S+  + +  +P     +V       T + ++     E +             PT HV  W   I   +    ++G    +T NI  +    + D   S +   +AKT               +P  PT  +    S  S LL+W    Q+     +T + + Y             K  D   K+I  +      + +LKP+T Y+  L      GV   +   S +T +T+P   P  V  +  S T + V W+ PP+E  NG IT Y V Y  ++ +        + +I N   E+ + + +  L++ T Y   V +    G GP S
Sbjct:  207 YVRVRRVPPRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNVLELTDVQQSAN---YTCVAMSTLGVIEAVAQITV--------KALPKAPGIPVVT-ERTATSITLTWDSGNPEPVTYYIIQHKSKYSDDL----YKEING----VATTRYSVGGLSPYSDYEFRVVAVNNIGRG-PPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTMDPTQHVNIWEKQIVRGSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKT--------------GVPSQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYELIY------------RKRDDKEEKQISFEPTTTYLLKDLKPFTTYTFRLAARSKHGVGAYTSEISAETPQTQPAGPPEEVKCSSPSSTKILVSWRAPPVELRNGIITQYTVSYAPTEGE-----DTAARQISNIPPESSQYL-LENLEKWTEYRVTVTAHTDVGAGPES 682          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165843])

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 327/613 (53.34%), Postives = 434/613 (70.80%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI+ L +++  LK N+N  FS E+ SID A QF+WE SN   NK KNRYANV+AYDHSR++L           ++D    +DYINANYI+GYRKQNAYIATQGPL ET  +FWRMIWEQRS ++VM+T L ERSRVKC+QYWP   RGT  TYG I V++    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE+ KHEK+VD+Y +VT +R+QRNYMVQTE+QY+FIHD LL+      T++    L+++I+KL++IE    G    TG +LE++RL   ++  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQFC+ A LEYL
Sbjct: 1346 IPISELADHLERLKANDNLKFSQEYESIDPAQQFTWEHSNLEVNKPKNRYANVIAYDHSRILL----------SAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWP--TRGTE-TYGLIQVSLLDTVELATYCVRTFSLFKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQIE----GGENVTGMELEFKRL---ANTKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYL 1913          

HSP 2 Score: 228.024 bits (580), Expect = 3.150e-59
Identity = 129/305 (42.30%), Postives = 177/305 (58.03%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEFVSIDH--ANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +  EN  G   EF  + +  A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1628 EVPARNLYAYIQKLTQIEGGENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1917          

HSP 3 Score: 209.149 bits (531), Expect = 2.090e-53
Identity = 155/502 (30.88%), Postives = 224/502 (44.62%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDL--RSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSS---QIVQK 1725
            PK +  P + + +      FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    S  + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P++    + R + L    L I ++ ESD GKY+C+A N  G+  S   +L +RV R  P F     D  I  G SV + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP AP I  ++E +  S  LTW   +                V   I Q  SK  D   KEI         +  L PY++Y   +V     G   PS+    +T E  P++APR V   + S T+  ++W  P E NG+I  Y+V+YT    DP    +I   +IV         V I+ L  N  Y   V +  S G+GP S   QI+ K
Sbjct:   40 PKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISASTRLTVLRE-DQLPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELTDVQQSANYTCVAMSTLGVIEAVAQITVKALPKAPGIPVVTERTATSITLTWDSGNPE-------------PVTYYIIQHKSKYSDDLYKEINGVATTRYSVGGLSPYSDYEFRVVAVNNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTM---DPTQHVNIWEKQIVR----GSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAK 515          

HSP 4 Score: 61.2326 bits (147), Expect = 1.892e-8
Identity = 118/530 (22.26%), Postives = 207/530 (39.06%), Query Frame = 1
Query:  232 YEKIKR--PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKIT--VVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTG-------KYQCMAINEFGSMISPAKSLMIRVSRFSPHFV--YVSPDQFIRTGSSVKLKCSGEGS-------------PTPHV-FW---ICGNTKLTGLNG-DKGQTENIGSIEMV-LSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKY--QXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLET-EPTSAPRSVSIALTSETSVRVKWK-PPIE-TNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSS 1710
            Y +++R  P+    P +  ++    +   C++ G+P P V W+   +   PE    I  +VL L+  +   N    +CV  + +G  +  A I V        K  PK  G   +T  +  +++TL         +T  ++  K  +  DL    Y+ ++G    +  T  S  G       +++ +A+N  G    P++S+  + +  +P     +V       T + ++     E +             PT HV  W   I   +    ++G    +T NI  +    + D   S +   +AKT               +P  PT  +    S  S LL+W    Q+     +T + + Y             K  D   K+I  +      + +LKP+T Y+  L      GV   +   S +T +T EP   P  V  +  S T + V W+ PP+E  NG IT Y V Y  ++ +        + +I N   E+ + + +  L++ T Y   V +    G GP S
Sbjct:  231 YVRVRRVPPRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNVLELTDVQQSAN---YTCVAMSTLGVIEAVAQITV--------KALPKAPGIPVVT-ERTATSITLTWDSGNPEPVTYYIIQHKSKYSDDL----YKEING----VATTRYSVGGLSPYSDYEFRVVAVNNIGRG-PPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTMDPTQHVNIWEKQIVRGSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKT--------------GVPSQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYELIY------------RKRDDKEEKQISFEPTTTYLLKDLKPFTTYTFRLAARSKHGVGAYTSEISAETPQTPEPAGPPEEVKCSSPSSTKILVSWRAPPVELRNGIITQYTVSYAPTEGE-----DTAARQISNIPPESSQYL-LENLEKWTEYRVTVTAHTDVGAGPES 707          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165843])

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 327/613 (53.34%), Postives = 434/613 (70.80%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            +PI+ L +++  LK N+N  FS E+ SID A QF+WE SN   NK KNRYANV+AYDHSR++L           ++D    +DYINANYI+GYRKQNAYIATQGPL ET  +FWRMIWEQRS ++VM+T L ERSRVKC+QYWP   RGT  TYG I V++    E A +  R+F + K GS EKRE++ FQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAMLE+ KHEK+VD+Y +VT +R+QRNYMVQTE+QY+FIHD LL+      T++    L+++I+KL++IE    G    TG +LE++RL   ++  +H                        T+ + ++ L  N+ KNR    +P ++ RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTEDFWRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W  +  +P S E  ++ I QV KTKEQFGQ GP++VHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+++++EDQYQFC+ A LEYL
Sbjct: 1360 IPISELADHLERLKANDNLKFSQEYESIDPAQQFTWEHSNLEVNKPKNRYANVIAYDHSRILL----------SAIDGIPGSDYINANYIDGYRKQNAYIATQGPLPETFGEFWRMIWEQRSAVVVMMTKLEERSRVKCDQYWP--TRGTE-TYGLIQVSLLDTVELATYCVRTFSLFKNGSSEKREVRQFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMLERNKHEKTVDIYGHVTLMRAQRNYMVQTEDQYVFIHDALLEAVNCGTTEVPARNLYAYIQKLTQIE----GGENVTGMELEFKRL---ANTKAH------------------------TSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDW-PEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYL 1927          

HSP 2 Score: 228.024 bits (580), Expect = 3.316e-59
Identity = 129/305 (42.30%), Postives = 177/305 (58.03%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEFVSIDH--ANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +  EN  G   EF  + +  A+   +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  DFWRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR  MVQTE+QY F +   L+Y  S +
Sbjct: 1642 EVPARNLYAYIQKLTQIEGGENVTGMELEFKRLANTKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQPIRGVE----------GSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDQYQFCYRAGLEYLGSFD 1931          

HSP 3 Score: 209.149 bits (531), Expect = 2.036e-53
Identity = 155/502 (30.88%), Postives = 224/502 (44.62%), Query Frame = 1
Query:  250 PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIR-----DSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDL--RSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSS---QIVQK 1725
            PK +  P + + +      FIC + G+P+PK+ W   GK    +R+ +I       SVL +   R+  + AI  CV  N +G    S  + V  + + +P GFP       + V ++    T+ C   G     + WFKDF P++    + R + L    L I ++ ESD GKY+C+A N  G+  S   +L +RV R  P F     D  I  G SV + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP AP I  ++E +  S  LTW   +                V   I Q  SK  D   KEI         +  L PY++Y   +V     G   PS+    +T E  P++APR V   + S T+  ++W  P E NG+I  Y+V+YT    DP    +I   +IV         V I+ L  N  Y   V +  S G+GP S   QI+ K
Sbjct:   40 PKFLRTPNDQTGVQGGVASFICQATGDPRPKIVWNKKGKKVSNQRFEVIEFDDGSGSVLRIQPLRTPRDEAIYECVASNTVGEISASTRLTVLRE-DQLPPGFPTIDMGPQLKVVERTRTATMLCAASGNPDPDISWFKDFLPVNTSNNNGRIKQLRSGALQIEQSEESDQGKYECVATNNDGTRYSAPANLYVRVRRVPPRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELTDVQQSANYTCVAMSTLGVIEAVAQITVKALPKAPGIPVVTERTATSITLTWDSGNPE-------------PVTYYIIQHKSKYSDDLYKEINGVATTRYSVGGLSPYSDYEFRVVAVNNIGRGPPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTM---DPTQHVNIWEKQIVR----GSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAK 515          

HSP 4 Score: 61.2326 bits (147), Expect = 1.756e-8
Identity = 118/530 (22.26%), Postives = 207/530 (39.06%), Query Frame = 1
Query:  232 YEKIKR--PKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKIT--VVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTG-------KYQCMAINEFGSMISPAKSLMIRVSRFSPHFV--YVSPDQFIRTGSSVKLKCSGEGS-------------PTPHV-FW---ICGNTKLTGLNG-DKGQTENIGSIEMV-LSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKY--QXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLET-EPTSAPRSVSIALTSETSVRVKWK-PPIE-TNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSS 1710
            Y +++R  P+    P +  ++    +   C++ G+P P V W+   +   PE    I  +VL L+  +   N    +CV  + +G  +  A I V        K  PK  G   +T  +  +++TL         +T  ++  K  +  DL    Y+ ++G    +  T  S  G       +++ +A+N  G    P++S+  + +  +P     +V       T + ++     E +             PT HV  W   I   +    ++G    +T NI  +    + D   S +   +AKT               +P  PT  +    S  S LL+W    Q+     +T + + Y             K  D   K+I  +      + +LKP+T Y+  L      GV   +   S +T +T EP   P  V  +  S T + V W+ PP+E  NG IT Y V Y  ++ +        + +I N   E+ + + +  L++ T Y   V +    G GP S
Sbjct:  231 YVRVRRVPPRFSIPPTDNEIMPGGSVNITCVAVGSPMPYVKWMLGAEDLTPEDDMPIGRNVLELTDVQQSAN---YTCVAMSTLGVIEAVAQITV--------KALPKAPGIPVVT-ERTATSITLTWDSGNPEPVTYYIIQHKSKYSDDL----YKEING----VATTRYSVGGLSPYSDYEFRVVAVNNIGRG-PPSESIEAKTAEQAPSTAPRHVRGHMMSATTAVIQWDEPEEANGQIMGYRVYYTMDPTQHVNIWEKQIVRGSNFVTIHGLIPNKTYNIKVLAYTSVGDGPLSPDLQIIAKT--------------GVPSQPTDFKGEAKSETSVLLSWNTPSQTGQENQVTGYELIY------------RKRDDKEEKQISFEPTTTYLLKDLKPFTTYTFRLAARSKHGVGAYTSEISAETPQTPEPAGPPEEVKCSSPSSTKILVSWRAPPVELRNGIITQYTVSYAPTEGE-----DTAARQISNIPPESSQYL-LENLEKWTEYRVTVTAHTDVGAGPES 707          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165944])

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 330/613 (53.83%), Postives = 431/613 (70.31%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            VPI+ L ++I  LK N+N  FS E+ S+D   QF+WE SN   NK KNRYANV+AYDHSRVVL S + V            +DYINANYI+GYR+QNAYIATQG L ET  DFWRM+WEQ S  I+M+T L E+SRVKC+QYWP   RGT  TYG I VT+    E A +  R+F + K GS EKRE++HFQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAM E++KHEK++DVY +VT +RSQRNYMVQTE+QYIFIHD +L+     NT++    L+S+I++L++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P +T RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTED+WRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +   +P S E  ++ I QV KTKEQFGQ GP+TVHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+ +++EDQYQFC+ A LEYL
Sbjct: 1242 VPISELTDHIERLKANDNLKFSQEYESVDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLSSIEGVP----------GSDYINANYIDGYRRQNAYIATQGALPETFGDFWRMVWEQHSANIIMMTKLEEKSRVKCDQYWP--TRGTE-TYGLIQVTLLDTVELATYSVRTFALYKSGSNEKREVRHFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMTERIKHEKTIDVYGHVTLMRSQRNYMVQTEDQYIFIHDAVLEAVTCGNTEVPARNLYSYIQRLTQIEPGE----NVTGMELEFKRL---ASAKAH------------------------TSRFVSANLPCNKFKNRLVNIMPYETTRVCLQPIRGVEGSDYINASFIDGYRQQRAYIATQGPLAETTEDYWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQG-VPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPATVQTEDQYQFCYRASLEYL 1809          

HSP 2 Score: 225.713 bits (574), Expect = 1.403e-58
Identity = 127/305 (41.64%), Postives = 175/305 (57.38%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEFVSIDHANQFS--WEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +  EN  G   EF  +  A   +  +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  D+WRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR   VQTE+QY F +   L+Y  S +
Sbjct: 1524 EVPARNLYSYIQRLTQIEPGENVTGMELEFKRLASAKAHTSRFVSANLPCNKFKNRLVNIMPYETTRVCLQPIRGVE----------GSDYINASFIDGYRQQRAYIATQGPLAETTEDYWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPATVQTEDQYQFCYRASLEYLGSFD 1813          

HSP 3 Score: 171.785 bits (434), Expect = 4.632e-42
Identity = 91/251 (36.25%), Postives = 141/251 (56.18%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I GV GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ+   +I +  + E     C+QYWP   +  Y    V  +   +++ + +R F L  +   + R +R FQFT W D   +P      L  + +V+         GP+ VHC+ G  RTG F+V+  + E++K +  ++V+    L++ QR  ++++EDQY F   A+LE +T  + E
Sbjct: 1277 WENSNLEVNKPKNRYANVIAYDHSRVVLSSIEGVPGSDYINANYIDGYRRQNAYIATQGALPETFGDFWRMVWEQHSANIIMMTKLEEKSRVKCDQYWPTRGTETYGLIQVTLLDTVELATYSVRTFALYKSGSNEKREVRHFQFTAWPDHG-VPEHPTPFLAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMTERIKHEKTIDVYGHVTLMRSQRNYMVQTEDQYIFIHDAVLEAVTCGNTE 1524          

HSP 4 Score: 159.844 bits (403), Expect = 1.980e-38
Identity = 117/415 (28.19%), Postives = 178/415 (42.89%), Query Frame = 1
Query:  523 NAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLD-------LRSIRYQMLDG----KNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIR----VSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            + +P GFP       + V +++   T+ C   G     + WFKDF P++       ++ +R +   G      L I  + ESD GKY+C+A N  G+  S   +L +R    V R  P F     D  I  G ++ + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP AP +  ++E +  S  LTW   +                V   + Q   K  +   KEI         +  L PY++Y   +      G   PS++   +T E  P+S PR V   + S T+  + W  P E NG++  Y+V+YT     P+ QW    ++       +   + I  L  N  YY  V +  S G+GP SQ +Q
Sbjct:   12 DQLPAGFPTIDMGPQLKVVERSRTATMLCAASGNPDPEISWFKDFLPVNTSSNNGRIKQLRSESFGGTPIRGALQIEMSEESDQGKYECVATNSDGTRYSTPANLYVRELREVRRVPPRFSIPPADSEIMPGGNINITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELTDVRQSNNYTCVAMSTLGVIEAMAQITVKALPKAPGMPMVTERTATSITLTWDSGNPE-------------PVSYYVIQYRGKGSEDPFKEIDGIATTRYSVGGLSPYSHYDFRVAAFNTIGQGPPSEVVEARTAEQAPSSPPRQVIGRMLSATTAMIHWDEPEEPNGQVVGYRVYYTSDNMLPVNQWDKQMVR-------STSFITIQDLTPNKTYYIRVLAFTSVGDGPLSQDLQ 401          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Medaka
Match: PTPRD (receptor-type tyrosine-protein phosphatase delta [Source:NCBI gene;Acc:101165944])

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 330/613 (53.83%), Postives = 431/613 (70.31%), Query Frame = 1
Query: 4525 VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYL 6348
            VPI+ L ++I  LK N+N  FS E+ S+D   QF+WE SN   NK KNRYANV+AYDHSRVVL S + V            +DYINANYI+GYR+QNAYIATQG L ET  DFWRM+WEQ S  I+M+T L E+SRVKC+QYWP   RGT  TYG I VT+    E A +  R+F + K GS EKRE++HFQFTAWPDHGVP+   PFL F+ R+K   P D+GP+VVHCSAGVGRTG +I +DAM E++KHEK++DVY +VT +RSQRNYMVQTE+QYIFIHD +L+     NT++    L+S+I++L++IE  +      TG +LE++RL   +S  +H                        T+ + ++ L  N+ KNR    +P +T RV L PIRGVEGSDY NAS+IDG++ ++AYIATQ PL ETTED+WRMLWE N  IV+ L  + E     C+QYWP +RSARYQ+FVVDP+ EY M  +++REFK+TDARDGQSR +RQFQFT+W +   +P S E  ++ I QV KTKEQFGQ GP+TVHC+ G  RTG+F+ LSI+LE+++ +  V++F+T K+L+ QRP+ +++EDQYQFC+ A LEYL
Sbjct: 1247 VPISELTDHIERLKANDNLKFSQEYESVDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVVLSSIEGVP----------GSDYINANYIDGYRRQNAYIATQGALPETFGDFWRMVWEQHSANIIMMTKLEEKSRVKCDQYWP--TRGTE-TYGLIQVTLLDTVELATYSVRTFALYKSGSNEKREVRHFQFTAWPDHGVPEHPTPFLAFLRRVKACNPPDAGPMVVHCSAGVGRTGCFIVIDAMTERIKHEKTIDVYGHVTLMRSQRNYMVQTEDQYIFIHDAVLEAVTCGNTEVPARNLYSYIQRLTQIEPGE----NVTGMELEFKRL---ASAKAH------------------------TSRFVSANLPCNKFKNRLVNIMPYETTRVCLQPIRGVEGSDYINASFIDGYRQQRAYIATQGPLAETTEDYWRMLWEHNSTIVVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQG-VPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPATVQTEDQYQFCYRASLEYL 1814          

HSP 2 Score: 225.713 bits (574), Expect = 1.696e-58
Identity = 127/305 (41.64%), Postives = 175/305 (57.38%), Query Frame = 1
Query: 4522 KVPIALLQEYISNL---KTNEN-RGFSTEFVSIDHANQFS--WEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGI--MVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRI--KKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVN 5406
            +VP   L  YI  L   +  EN  G   EF  +  A   +  +  +N P NK KNR  N++ Y+ +RV LQ  + V            +DYINA++I+GYR+Q AYIATQGPL ET  D+WRM+WE  S I+VMLT L E  R KC QYWP + R   + Y  +  M   N+ Q    +I R F V      + R ++ FQFT WP+ GVP+    F+ FI ++   KE+    GP+ VHCSAGVGRTGV+I +  +LE+M++E  VD++  V  +R+QR   VQTE+QY F +   L+Y  S +
Sbjct: 1529 EVPARNLYSYIQRLTQIEPGENVTGMELEFKRLASAKAHTSRFVSANLPCNKFKNRLVNIMPYETTRVCLQPIRGVE----------GSDYINASFIDGYRQQRAYIATQGPLAETTEDYWRMLWEHNSTIVVMLTKLREMGREKCHQYWP-AERSARYQYFVVDPMAEYNMPQ----YILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPATVQTEDQYQFCYRASLEYLGSFD 1818          

HSP 3 Score: 171.4 bits (433), Expect = 5.684e-42
Identity = 91/251 (36.25%), Postives = 141/251 (56.18%), Query Frame = 1
Query: 5629 YETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPE-----CNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDE 6366
            +E S L VN+ KNR    +  D +RV+L  I GV GSDY NA++IDG++ + AYIATQ  L ET  DFWRM+WEQ+   +I +  + E     C+QYWP   +  Y    V  +   +++ + +R F L  +   + R +R FQFT W D   +P      L  + +V+         GP+ VHC+ G  RTG F+V+  + E++K +  ++V+    L++ QR  ++++EDQY F   A+LE +T  + E
Sbjct: 1282 WENSNLEVNKPKNRYANVIAYDHSRVVLSSIEGVPGSDYINANYIDGYRRQNAYIATQGALPETFGDFWRMVWEQHSANIIMMTKLEEKSRVKCDQYWPTRGTETYGLIQVTLLDTVELATYSVRTFALYKSGSNEKREVRHFQFTAWPDHG-VPEHPTPFLAFLRRVKACNPP--DAGPMVVHCSAGVGRTGCFIVIDAMTERIKHEKTIDVYGHVTLMRSQRNYMVQTEDQYIFIHDAVLEAVTCGNTE 1529          

HSP 4 Score: 163.31 bits (412), Expect = 1.427e-39
Identity = 118/406 (29.06%), Postives = 176/406 (43.35%), Query Frame = 1
Query:  523 NAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRS--IRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIR----VSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQ 1722
            + +P GFP       + V +++   T+ C   G     + WFKDF P++  S   R + L    L I  + ESD GKY+C+A N  G+  S   +L +R    V R  P F     D  I  G ++ + C   GSP P+V W+ G   LT  +        IG   + L+D+ +S N TCVA +          I VK LP AP +  ++E +  S  LTW   +                V   + Q   K  +   KEI         +  L PY++Y   +      G   PS++   +T E  P+S PR V   + S T+  + W  P E NG++  Y+V+YT     P+ QW    ++       +   + I  L  N  YY  V +  S G+GP SQ +Q
Sbjct:   12 DQLPAGFPTIDMGPQLKVVERSRTATMLCAASGNPDPEISWFKDFLPVNTSSNNGRIKQLRSGALQIEMSEESDQGKYECVATNSDGTRYSTPANLYVRELREVRRVPPRFSIPPADSEIMPGGNINITCVAVGSPMPYVKWMLGAEDLTPED-----DMPIGRNVLELTDVRQSNNYTCVAMSTLGVIEAMAQITVKALPKAPGMPMVTERTATSITLTWDSGNPE-------------PVSYYVIQYRGKGSEDPFKEIDGIATTRYSVGGLSPYSHYDFRVAAFNTIGQGPPSEVVEARTAEQAPSSPPRQVIGRMLSATTAMIHWDEPEEPNGQVVGYRVYYTSDNMLPVNQWDKQMVR-------STSFITIQDLTPNKTYYIRVLAFTSVGDGPLSQDLQ 392          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Planmine SMEST
Match: SMESG000025325.1 (SMESG000025325.1)

HSP 1 Score: 4077.71 bits (10574), Expect = 0.000e+0
Identity = 2038/2066 (98.64%), Postives = 2046/2066 (99.03%), Query Frame = 1
Query:  181 DAYVSLEISSNNGYELTYEKIKRPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEIIPIFNNTAKSSMKIRFTTRYHDEKELIKAXXXXXXXXXXXXXXXXXXXXXRIVVGYFPYTEGNKSLTKSCFLKTDNSCHLTNLVPETLYQLNIAYNGMTVKRYVETWAKDPDPVQDFKLELINPKSQPYIKATWKYLTGPLPIFEITYSPLDAPVNSNFSKYAKTINITDLKYETDPATHVMGSTVQFSIRAIFNFQTSEPVQSKIKFPEGVPKDYPKSFKVHSKFSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEFSKNLTNKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISSCCFKISWKWQKEXXXXXXXXXXXXTRNDQINHENFQFRTRYASSLFYVAKQNEFDWNKNYSVTMQTVTKSGALSSMSGEVFPRKYSNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSALYDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNEISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPIAICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTNL 6378
            D  ++   S  N       K +RPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQSTTTISITSFIVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIV EEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEIIPIFNNTAKSSMKIRFTTRYH+EKELIKAISISQESIMISIPHSSMIISPRIVVGYFPYTEGNKSLTKSCFLKTDNSCHLTNLVPETLYQLNIAYNGMTVKRYVETWAKDPDPVQDFKLELINPKSQPYIKATWKYLTGPLPIFEITYSPL+APVNSNFSKYAKTINITDLKYET+PATHVMGSTVQFSIRAIFNFQTSEPVQSKIKFPEGVPKDYPKSFKVHSKFSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEFSKNLTNKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISSCCFKISWKWQKEFLNFYNYFLIFFT N +INHENFQFRTRYASSLFYVAKQNEFDWNKNYSVTMQ+VTKSGALSSMSGEVFPRKYSNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSALYDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNEISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPI ICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEF SIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPSTKSECSTKSSESIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTNL
Sbjct:   18 DHSIAFLFSDLNDLSNVINKKERPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQSTTTISITSFIVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVTEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEIIPIFNNTAKSSMKIRFTTRYHNEKELIKAISISQESIMISIPHSSMIISPRIVVGYFPYTEGNKSLTKSCFLKTDNSCHLTNLVPETLYQLNIAYNGMTVKRYVETWAKDPDPVQDFKLELINPKSQPYIKATWKYLTGPLPIFEITYSPLNAPVNSNFSKYAKTINITDLKYETNPATHVMGSTVQFSIRAIFNFQTSEPVQSKIKFPEGVPKDYPKSFKVHSKFSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEFSKNLTNKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISSCCFKISWKWQKEFLNFYNYFLIFFTINHRINHENFQFRTRYASSLFYVAKQNEFDWNKNYSVTMQSVTKSGALSSMSGEVFPRKYSNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSALYDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNEISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPITICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFESIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPSTKSECSTKSSESIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTNL 2083          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Planmine SMEST
Match: SMESG000025325.1 (SMESG000025325.1)

HSP 1 Score: 4033.03 bits (10458), Expect = 0.000e+0
Identity = 2021/2067 (97.77%), Postives = 2031/2067 (98.26%), Query Frame = 1
Query:  181 DAYVSLEISSNNGYELTYEKIKRPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEIIPIFNNTAKSSMKIRFTTRYHDEKELIKAXXXXXXXXXXXXXXXXXXXXXRIVVGYFPYTEGNKSLTKSCFLKTDNSCHLTNLVPETLYQLNIAYNGMTVKRYVETWAKDPDPVQDFKLELINPKSQPYIKATWKYLTGPLPIFEITYSPLDAPVNSNFSKYAKTINITDLKYETDPATHVMGSTVQFSIRAIFN-FQTSEPVQSKIKFPEGVPKDYPKSFKVHSKFSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEFSKNLTNKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISSCCFKISWKWQKEXXXXXXXXXXXXTRNDQINHENFQFRTRYASSLFYVAKQNEFDWNKNYSVTMQTVTKSGALSSMSGEVFPRKYSNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSALYDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNEISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPIAICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTNL 6378
            D  ++   S  N       K +RPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQSTTTISITSFIVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIV EEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEIIPIFNNTAKSSMKIRFTTRYH+EKELIKAISISQESIMISIPHSSMIISPRIVVGYFPYTEGNKSLTKSCFLKTDNSCHLTNLVPETLYQLNIAYNGMTVKRYVETWAKDPDPVQDFKLELINPKSQPYIKATWKYLTGPLPIFEITYSPL+APVNSNFSKYAKTINITDLKYET+PATH            IFN +   +PVQSKIKFPEGVPKDYPKSFKVHSKFSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEFSKNLTNKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISSCCFKISWKWQKEFLNFYNYFLIFFT N +INHENFQFRTRYASSLFYVAKQNEFDWNKNYSVTMQ+VTKSGALSSMSGEVFPRKYSNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSALYDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNEISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPI ICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEF SIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPSTKSECSTKSSESIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTNL
Sbjct:   18 DHSIAFLFSDLNDLSNVINKKERPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQSTTTISITSFIVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVTEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEIIPIFNNTAKSSMKIRFTTRYHNEKELIKAISISQESIMISIPHSSMIISPRIVVGYFPYTEGNKSLTKSCFLKTDNSCHLTNLVPETLYQLNIAYNGMTVKRYVETWAKDPDPVQDFKLELINPKSQPYIKATWKYLTGPLPIFEITYSPLNAPVNSNFSKYAKTINITDLKYETNPATH-----------GIFNSYGFDKPVQSKIKFPEGVPKDYPKSFKVHSKFSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEFSKNLTNKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISSCCFKISWKWQKEFLNFYNYFLIFFTINHRINHENFQFRTRYASSLFYVAKQNEFDWNKNYSVTMQSVTKSGALSSMSGEVFPRKYSNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSALYDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNEISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPITICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFESIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPSTKSECSTKSSESIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTNL 2073          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Planmine SMEST
Match: SMESG000025325.1 (SMESG000025325.1)

HSP 1 Score: 4028.02 bits (10445), Expect = 0.000e+0
Identity = 2021/2066 (97.82%), Postives = 2030/2066 (98.26%), Query Frame = 1
Query:  181 DAYVSLEISSNNGYELTYEKIKRPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEIIPIFNNTAKSSMKIRFTTRYHDEKELIKAXXXXXXXXXXXXXXXXXXXXXRIVVGYFPYTEGNKSLTKSCFLKTDNSCHLTNLVPETLYQLNIAYNGMTVKRYVETWAKDPDPVQDFKLELINPKSQPYIKATWKYLTGPLPIFEITYSPLDAPVNSNFSKYAKTINITDLKYETDPATHVMGSTVQFSIRAIFNFQTSEPVQSKIKFPEGVPKDYPKSFKVHSKFSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEFSKNLTNKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISSCCFKISWKWQKEXXXXXXXXXXXXTRNDQINHENFQFRTRYASSLFYVAKQNEFDWNKNYSVTMQTVTKSGALSSMSGEVFPRKYSNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSALYDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNEISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPIAICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTNL 6378
            D  ++   S  N       K +RPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQSTTTISITSFIVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIV EEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEIIPIFNNTAKSSMKIRFTTRYH+EKELIKAISISQESIMISIPHSSMIISPRIVVGYFPYTEGNKSLTKSCFLKTDNSCHLTNLVPETLYQLNIAYNGMTVKRYVETWAKDPDPVQDFKLELINPKSQPYIKATWKYLTGPLPIFEITYSPL+APVNSNFSKYAKTINITDLKYET+PATH            IFN    +PVQSKIKFPEGVPKDYPKSFKVHSKFSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEFSKNLTNKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISSCCFKISWKWQKEFLNFYNYFLIFFT N +INHENFQFRTRYASSLFYVAKQNEFDWNKNYSVTMQ+VTKSGALSSMSGEVFPRKYSNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSALYDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNEISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPI ICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEF SIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPSTKSECSTKSSESIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTNL
Sbjct:   18 DHSIAFLFSDLNDLSNVINKKERPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQSTTTISITSFIVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVTEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEIIPIFNNTAKSSMKIRFTTRYHNEKELIKAISISQESIMISIPHSSMIISPRIVVGYFPYTEGNKSLTKSCFLKTDNSCHLTNLVPETLYQLNIAYNGMTVKRYVETWAKDPDPVQDFKLELINPKSQPYIKATWKYLTGPLPIFEITYSPLNAPVNSNFSKYAKTINITDLKYETNPATH-----------GIFN----KPVQSKIKFPEGVPKDYPKSFKVHSKFSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEFSKNLTNKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISSCCFKISWKWQKEFLNFYNYFLIFFTINHRINHENFQFRTRYASSLFYVAKQNEFDWNKNYSVTMQSVTKSGALSSMSGEVFPRKYSNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSALYDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNEISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPITICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFESIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPSTKSECSTKSSESIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTNL 2068          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Planmine SMEST
Match: SMESG000025325.1 (SMESG000025325.1)

HSP 1 Score: 4015.69 bits (10413), Expect = 0.000e+0
Identity = 2015/2066 (97.53%), Postives = 2025/2066 (98.02%), Query Frame = 1
Query:  181 DAYVSLEISSNNGYELTYEKIKRPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQXXXXXXXXXXXVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEIIPIFNNTAKSSMKIRFTTRYHDEKELIKAXXXXXXXXXXXXXXXXXXXXXRIVVGYFPYTEGNKSLTKSCFLKTDNSCHLTNLVPETLYQLNIAYNGMTVKRYVETWAKDPDPVQDFKLELINPKSQPYIKATWKYLTGPLPIFEITYSPLDAPVNSNFSKYAKTINITDLKYETDPATHVMGSTVQFSIRAIFNFQTSEPVQSKIKFPEGVPKDYPKSFKVHSKFSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEFSKNLTNKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISSCCFKISWKWQKEXXXXXXXXXXXXTRNDQINHENFQFRTRYASSLFYVAKQNEFDWNKNYSVTMQTVTKSGALSSMSGEVFPRKYSNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSALYDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNEISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPIAICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPXXXXXXXXXXXXXIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTNL 6378
            D  ++   S  N       K +RPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQSTTTISITSFIVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIV EEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEIIPIFNNTAKSSMKIRFTTRYH+EKELIKAISISQESIMISIPHSSMIISPRIVVGYFPYTEGNKSLTKSCFLKTDNSCHLTNLVPETLYQLNIAYNGMTVKRYVETWAKDPDPVQDFKLELINPKSQPYIKATWKYLTGPLPIFEITYSPL+AP+               ++Y T     VMGSTVQFSIRAIFNFQTSEPVQSKIKFPEGVPKDYPKSFKVHSKFSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEFSKNLTNKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISSCCFKISWKWQKEFLNFYNYFLIFFT N +INHENFQFRTRYASSLFYVAKQNEFDWNKNYSVTMQ+VTKSGALSSMSGEVFPRKYSNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSALYDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNEISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPI ICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEF SIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPSTKSECSTKSSESIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTNL
Sbjct:   18 DHSIAFLFSDLNDLSNVINKKERPKIIHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSVLHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFGKSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKNLFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQFIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMVLSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCLLTWKYQSTTTISITSFIVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNINTKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIALTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVTEEKENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLKNLTMLLVQSKSADILWKIDPISKVNAFKIVCIPSTSHPSQANEVYKIFLNKLNKQLIYFTKISNLSPNTPYIVEIIPIFNNTAKSSMKIRFTTRYHNEKELIKAISISQESIMISIPHSSMIISPRIVVGYFPYTEGNKSLTKSCFLKTDNSCHLTNLVPETLYQLNIAYNGMTVKRYVETWAKDPDPVQDFKLELINPKSQPYIKATWKYLTGPLPIFEITYSPLNAPL--------------LMEYLT-----VMGSTVQFSIRAIFNFQTSEPVQSKIKFPEGVPKDYPKSFKVHSKFSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEFSKNLTNKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISSCCFKISWKWQKEFLNFYNYFLIFFTINHRINHENFQFRTRYASSLFYVAKQNEFDWNKNYSVTMQSVTKSGALSSMSGEVFPRKYSNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSALYDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNEISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPITICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFESIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLEYRRLLRWSSLFSHMTPSTKSECSTKSSESIGCQPDFSTNNYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECNQYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTNL 2064          
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Planmine SMEST
Match: SMESG000035516.1 (SMESG000035516.1)

HSP 1 Score: 852.818 bits (2202), Expect = 0.000e+0
Identity = 544/1479 (36.78%), Postives = 805/1479 (54.43%), Query Frame = 1
Query: 2146 GYFPYTEGNKSLTKSCFLKTDNSCH----------LTNLVPETLYQLNI-----AYNGMTVKRY-VETWAKDPDPVQDFKLELINPKSQPYIKATWK-------YLTGPLPIFEITYSPLDAPVNSNFSKY-AKTINITDLKYETDPATHVMGSTVQFSIRAIFNFQTSEPVQSKIKFPEGVPKDYPKSFKVH--SKFSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEFSKNLT-NKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISSCCFKISWKWQKEXXXXXXXXXXXXTRNDQINHENFQFRTRYASSLFYVAKQNEFDWNKNYSVTMQTVTKSGALSSMSGEVFPRKY-SNHWPIAAVSSVLCIPLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKEDSAL-------------YDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTLPEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPITETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATSVMR-ETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNEISIRRICSMGKWSAKLNTLTTV------PNF--INNLSPNRFTNDSKTSKPTITSVLSGIIVTSIFIPIAICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPASNSEIKENLVNPLIVSANVGSSYSN----QNHDS--LELKRYQISTTPDLLVQSSPSTSFKDKKLVLSEKNIKQFQHK------VPIALLQEYISNLKTNENRGFSTEFVSIDHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDPYRSN-DYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVMLTLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQKIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVVHCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQYIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIE--YEKAGLLQFTGFQLEYRRLLRWSSLF-SHMTPXXXXXXXXXXXXXIGCQPDFSTN----NYETSCLMVNQSKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCPLKETTEDFWRMLWEQNCGIVITLHYVPECN-----QYWPNDRSARYQFFVVDPIIEYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELIDQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFETFKLLKWQRPSLIESEDQYQFCFAALLEYLTLY 6357
            GYFP  E +    K  ++K   S              NL P++ YQ+ +        GMT K   ++TW K     +   L L      P +   WK       ++ G    + + Y PL   V ++  KY     N+++ K+ET    H  G    F + A   F+  + +  +I   EG P  +P +FK+   S  S  +   +W  +S  + NGK    E+ CF    EN      TT+ +     NL  +    CR+R   +     WS  +      +    P  I  +++S    +I+WKW  +FL  Y++F+I++T  ++    N  +  +  ++ F     +  +   +Y + + +V+  G    MS  +      S++WP   +S + C P++S  I+++W   ++ + L+HFRVNF+G T F+S  G  +S+ R E+E SAL             +      Y  +I  + PNT+Y I IEPI  PN ++   S    CST  E P +++ + + ++N   + I++++ +P+ ENG I  Y++VV+     T      N  +  TI    ++I       N S   ++IS PY A  L    +    T   +  K  +G       F  N  L     Y+  +IACI    ++ +I + C    W+  +N + T+      PNF   NN+S N       T   T   V+ GI++ ++       + + ++ ++ RR     KL      +  S  N      S   E+L+   +V ++V  S S     +NH +  L++ + Q+S+TPDLLV+SS   +       L + + +  Q++      +P+  L E++S LK N+++ F+ E+ SI+   QF+W  SN   N+ KNRYANV+AYDHSRV+LQ      +   S  P  S  DYINAN+I+GY    AYIATQGPL ETI DFWRM+WEQ S +IVM+T L ER R KC+QYWP   +G+  T+  I VT+  + E AY+  R F +QK+     REI  FQFTAWPDHGVP    P LMF+ R+  E   + GP+VVHCSAGVGRTG +I +D MLE++++E +VD+Y+YVT+IRSQRNYMVQTE+QYIFI++ LL+  Q  NT++   +L  HIEKL++IE  ++ A  +Q TG Q+E+  L+  S  F   + P+  +     +  +     +  TN     YET+  + NQ KNR    LPPD +RV +CPIRGVEGSDY NASWIDG+KSR+AYIA Q PL ET EDFWR LWE N  IV+ L  + E N     QYWP  RS+RYQFF+VDP+ EY M+ +++REFKLTD RD QSRV+RQFQFT+W +   IP S +  L+LI+QV KTK Q GQ GP+ VHC+ GS RTGIFL LS ++E++K ++ +++F+T KLL+WQRP+L+++EDQYQFC+ A LEYL  +
Sbjct:   96 GYFPNRENHNKPLKDIYIKKTMSNSENQNITMRYIFANLAPDSEYQIYLNSITRERQGMTFKSEPIKTWPKKLPKPKFIHLRLSCSIENPCVTVEWKEDIKNKKWIKG----YRLRYYPL---VENDEIKYKVLERNVSESKFETSSFDHWQGFRYNFKVAAFNEFEMGDEITDQIDILEGSPSVFPSNFKLKTTSNLSPTSVMFTWNKVSQHSLNGKFNYYEVWCFVLSHENKTSTTYTTKTEFITINNLKEDSNYACRVRVWIQKTFSSWSDAIYFKTRDAHFPAPDAIRFIRLSQSTAQITWKWNPDFLIHYSHFIIYYT--NEKTFLNKIWLMKSTNTTFTKVILDSLNATISYVIRVSSVSNRGIEGPMSDNIKETSLTSSNWPAKFISELSCAPVSSTIIQLRWFISFQIQYLTHFRVNFSGITKFQSENGA-VSLMRDEQEQSALVSNIGDNKTLLSLFSNHKTYYSHQIWKLKPNTRYTIGIEPIFSPNSNMIGVSNHTICSTFKELPSSLETVMLSDINKSSNQIDILLQRPNTENGTIDDYYVVVKVLKEKTRKLRSVNLVDERTI---GNLI------QNSSFNRNEISNPYIAVSLKDELIFPISTPLKQVHKIKIGENNINGQFK-NWKLDPKFYYQFQIIACIRLKESQNTILK-CISSPWTTSINIMHTILSKGNKPNFNVDNNVSQNLLRKGPSTFTTTTVVVILGIVILAV-------LTMSIFLIVKRRRVLKSKL----GSVYGSHCNRILDEKSICMEHLLKEPLVDSSVRISTSGSLRFKNHGANYLDVNKIQLSSTPDLLVRSSVPQTLGS----LVQFHGQHIQNRYLEYAPIPVEALSEHVSLLKENDSKLFNKEYESIEPGQQFTWNCSNMEINRPKNRYANVIAYDHSRVILQPLFDQRNSNFSETPIVSGSDYINANFISGYLNPKAYIATQGPLAETIGDFWRMMWEQNSSVIVMMTRLEERDRTKCDQYWPLGGKGSISTFSYINVTIVDIIELAYYTIRKFHIQKLNDNNVREIFQFQFTAWPDHGVPNHPAPLLMFLRRVHSEISRNCGPIVVHCSAGVGRTGAFIVIDYMLERLRYENTVDIYNYVTNIRSQRNYMVQTEDQYIFIYETLLEAVQCGNTEVPVCELAHHIEKLNQIEINHKTADGIQMTGLQMEFENLVLSSEGFLQGIKPNANNHSHCSTPST--AHANICTNYQPLTYETATQICNQMKNRILQILPPDFSRVNICPIRGVEGSDYINASWIDGYKSRKAYIAAQSPLSETCEDFWRTLWEHNSSIVVMLTQLKENNRERSFQYWPVKRSSRYQFFIVDPVAEYNMTTYIIREFKLTDTRDSQSRVIRQFQFTDWQESESIPHSTQVFLDLINQVHKTKIQLGQDGPIMVHCSAGSGRTGIFLALSNIIERMKNESVIDLFQTVKLLRWQRPALLQTEDQYQFCYVAALEYLKFF 1536          
The following BLAST results are available for this feature:
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRD8.426e-6053.18protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD8.426e-6053.18protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD8.426e-6053.18protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD8.426e-6053.18protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD8.426e-6053.18protein tyrosine phosphatase receptor type D [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptp-32.253e-17745.81Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-35.572e-17645.81Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-38.943e-17645.81Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-34.537e-17445.47Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
ptp-35.140e-17445.47Tyrosine-protein phosphatase Lar-like [Source:Uni... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lar1.667e-4947.55gene:FBgn0000464 transcript:FBtr0331242[more]
Lar1.531e-4847.55gene:FBgn0000464 transcript:FBtr0331240[more]
Lar2.176e-4847.55gene:FBgn0000464 transcript:FBtr0331239[more]
Lar1.497e-4947.63gene:FBgn0000464 transcript:FBtr0331241[more]
Lar9.737e-5147.55gene:FBgn0000464 transcript:FBtr0081260[more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptprsa1.269e-5750.38protein tyrosine phosphatase receptor type Sa [Sou... [more]
ptprsa1.131e-5752.37protein tyrosine phosphatase receptor type Sa [Sou... [more]
ptprfa1.632e-5752.20protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa2.993e-5752.20protein tyrosine phosphatase receptor type Fa [Sou... [more]
ptprfa2.558e-5752.04protein tyrosine phosphatase receptor type Fa [Sou... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
brdt2.373e-5851.75bromodomain, testis-specific [Source:Xenbase;Acc:X... [more]
brdt2.490e-5851.75bromodomain, testis-specific [Source:Xenbase;Acc:X... [more]
sema6d3.253e-5953.18semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
sema6d4.085e-5953.18semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
sema6d3.619e-5953.18semaphorin 6D [Source:Xenbase;Acc:XB-GENE-967070][more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ptprs6.612e-5753.34protein tyrosine phosphatase, receptor type, S [So... [more]
Ptprd7.102e-6053.18protein tyrosine phosphatase, receptor type, D [So... [more]
Ptprs4.679e-5753.34protein tyrosine phosphatase, receptor type, S [So... [more]
Ptprd8.609e-6053.18protein tyrosine phosphatase, receptor type, D [So... [more]
Ptprs5.674e-5753.34protein tyrosine phosphatase, receptor type, S [So... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q64605|PTPRS_RAT4.143e-5653.51Receptor-type tyrosine-protein phosphatase S OS=Ra... [more]
sp|F1NWE3|PTPRS_CHICK8.298e-5851.75Receptor-type tyrosine-protein phosphatase S OS=Ga... [more]
sp|B0V2N1|PTPRS_MOUSE4.625e-5653.34Receptor-type tyrosine-protein phosphatase S OS=Mu... [more]
sp|Q64487|PTPRD_MOUSE6.022e-5953.18Receptor-type tyrosine-protein phosphatase delta O... [more]
sp|P23468|PTPRD_HUMAN4.047e-5953.18Receptor-type tyrosine-protein phosphatase delta O... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A553PDS43.103e-4428.82Uncharacterized protein OS=Tigriopus californicus ... [more]
A0A267DSI90.000e+033.85Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A401NLH73.558e-5554.49Uncharacterized protein (Fragment) OS=Scyliorhinus... [more]
G1KDG82.112e-5641.83Protein tyrosine phosphatase receptor type D OS=An... [more]
A0A401SN353.511e-5554.32Uncharacterized protein OS=Chiloscyllium punctatum... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRD7.225e-6051.21protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD5.757e-6053.51protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD5.746e-6053.51protein tyrosine phosphatase receptor type D [Sour... [more]
PTPRD3.740e-6053.51protein tyrosine phosphatase receptor type D [Sour... [more]
ptprsa9.763e-5850.53protein tyrosine phosphatase receptor type S [Sour... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ptpra7.106e-13136.47protein tyrosine phosphatase receptor type A [Sour... [more]
ptprsa2.822e-11845.27protein tyrosine phosphatase receptor type Sa [Sou... [more]
ca16b1.165e-10532.92carbonic anhydrase XVI b [Source:ZFIN;Acc:ZDB-GENE... [more]
ptprk2.002e-10133.39protein tyrosine phosphatase receptor type K [Sour... [more]
ENSPMAT00000002738.15.119e-10132.89pep scaffold:Pmarinus_7.0:GL477626:22501:55781:-1 ... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
PTP17.924e-3030.16Phosphotyrosine-specific protein phosphatase; deph... [more]
PTP23.922e-1926.81Nuclear phosphotyrosine-specific phosphatase invol... [more]
PTP32.862e-1325.91Phosphotyrosine-specific protein phosphatase; invo... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO469612.472e-16545.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481878.781e-15041.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438541.324e-14940.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453824.968e-14340.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO317365.256e-13437.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PTPRD2.287e-5953.34receptor-type tyrosine-protein phosphatase delta [... [more]
PTPRD3.150e-5953.34receptor-type tyrosine-protein phosphatase delta [... [more]
PTPRD3.316e-5953.34receptor-type tyrosine-protein phosphatase delta [... [more]
PTPRD1.403e-5853.83receptor-type tyrosine-protein phosphatase delta [... [more]
PTPRD1.696e-5853.83receptor-type tyrosine-protein phosphatase delta [... [more]
back to top
BLAST of Receptor-type tyrosine-protein phosphatase F vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000025325.10.000e+098.64SMESG000025325.1[more]
SMESG000025325.10.000e+097.77SMESG000025325.1[more]
SMESG000025325.10.000e+097.82SMESG000025325.1[more]
SMESG000025325.10.000e+097.53SMESG000025325.1[more]
SMESG000035516.10.000e+036.78SMESG000035516.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014428 ID=SMED30014428|Name=Receptor-type tyrosine-protein phosphatase F|organism=Schmidtea mediterranea sexual|type=transcript|length=7024bp
TATTCTTAATTTTGAGGATTGTAAAAAGTGACAAAACACAAAATATTCCG
AAATTGAAAAACTCGTAAAAATTCATCAGGCCTCCAAAAAAGAAAAAAAA
GTAGAAAAATGCCAGATAAAACTTTGGATTTTCCTGTGATTCGATTAGTT
TTTATGATCTTCACAACCATTTTTATCGTCGATGCCTACGTATCATTGGA
GATCTCCTCCAACAATGGTTATGAACTAACCTATGAAAAAATAAAACGGC
CAAAAATTATTCACGCTCCTCGAAATGCCTCGGTTTTGGCAAACCAACAA
ATGCTATTCATTTGCATTTCTGAAGGCAATCCGAAACCGAAAGTAACTTG
GCTTTATAATGGGAAACCTCAGCTACCGGAACGATACAATATCATTCGGG
ATTCAGTTCTTCACTTGAGCTCAGCTCGTTCAGAAGACAATGGAGCGATC
GTTTCTTGTGTTTGTCGAAACGTGATGGGTTCGGAAGACAAATCCGCTTC
CATTAAAGTATACAATGACATTAATGCCGTTCCCAAAGGATTCCCAAAAT
ATTTTGGAAAATCATCTATAACAGTCTCTCAGAAAAACTCAAACGTCACC
CTGGAATGCCTCGTCTTTGGCCAGTCGAAAATCACCGTTGTTTGGTTTAA
AGACTTTTTCCCATTGGATTTGAGGAGCATTAGATATCAAATGCTTGACG
GCAAAAATCTTTTCATTCTAAAAACTATGGAATCCGATACTGGCAAGTAC
CAGTGCATGGCCATCAATGAATTTGGGAGCATGATTTCTCCAGCTAAAAG
TCTAATGATAAGAGTATCTCGTTTTTCTCCTCACTTTGTTTACGTTTCTC
CTGACCAATTTATACGAACTGGATCATCGGTGAAACTGAAATGCTCAGGA
GAAGGCAGTCCAACTCCTCACGTGTTTTGGATTTGCGGGAACACGAAATT
AACTGGACTGAATGGTGACAAAGGTCAAACAGAAAATATTGGCTCTATAG
AAATGGTACTATCCGACATTTCGGAATCACTGAATTGCACTTGTGTTGCT
AAAACCAAACAAGAAACCGCAAATCACACTGTGCATATTATAGTGAAAAA
CCTACCAGTCGCTCCGACAATTGTCAGAATTTCAGAAATCTCCCACAGAT
CGTGCCTCCTAACTTGGAAATACCAATCAACCACAACAATATCAATCACA
AGTTTTATTGTATTCTATATACCGACAGTTATGTTGAGAATCGAACAACC
TCTCTCAAAAGACATTGATATATCGTCAAAGGAAATCCAAAAGGATTTTA
ATATAAATACAAAGATTATGGAGCTAAAACCTTATACAAATTATTCCCTT
TGGCTCGTAACCAATGGAGTCGAAGGTGTTTCGGAACCGTCAAAAATCCA
TTCCTTCCAGACATTAGAAACAGAACCGACGTCCGCACCGAGATCGGTTT
CGATTGCTTTGACGAGTGAAACGAGCGTTCGCGTTAAATGGAAACCACCA
ATCGAAACCAATGGCGAGATCACCTTATATCAAGTATTCTATACAAAATC
AAAAGAAGACCCTTTAACTCAGTGGTCCATAAATTCCTTAAAAATTGTCA
ACGAAGAAAAGGAGAACGATAAAAGCGTCGAAATCTATATGCTCGACAGA
AACACGATGTACTACTTCTGCGTCAATAGCCGAAACTCGGCTGGAGAAGG
CCCTTCCTCACAAATTGTTCAGAAATTCATCAATGATGATGAAATTTATC
AATTGAAAAATCTCACAATGCTTTTGGTGCAATCAAAAAGTGCGGATATC
CTATGGAAAATAGATCCGATATCCAAGGTCAACGCGTTCAAAATTGTTTG
CATACCTTCAACCAGTCACCCTTCACAAGCCAATGAAGTGTACAAAATCT
TTCTCAATAAACTAAACAAACAATTAATATATTTCACGAAAATTTCAAAT
TTGTCCCCGAATACTCCTTATATAGTTGAAATAATTCCTATCTTCAATAA
TACTGCAAAATCCTCAATGAAAATACGATTTACCACTCGTTATCATGATG
AAAAGGAGTTAATCAAAGCAATATCAATTTCACAAGAAAGTATAATGATT
TCAATTCCTCATAGCTCAATGATCATCAGTCCCCGAATCGTAGTTGGCTA
TTTTCCCTACACTGAAGGGAACAAATCTCTCACAAAATCTTGCTTCTTGA
AAACAGATAATTCGTGTCATTTAACAAATCTCGTTCCAGAAACTCTTTAT
CAATTAAATATTGCTTACAATGGTATGACTGTTAAACGGTATGTGGAGAC
ATGGGCAAAAGATCCTGATCCAGTTCAAGACTTTAAACTTGAACTAATAA
ACCCAAAGTCTCAACCATATATCAAAGCAACATGGAAATATTTGACTGGA
CCATTGCCAATATTTGAAATAACCTACAGCCCCCTAGATGCGCCAGTCAA
TTCCAATTTTTCCAAATATGCCAAAACCATTAACATAACAGATTTAAAGT
ACGAAACCGATCCAGCTACTCATGTTATGGGTTCGACAGTGCAATTCTCA
ATAAGAGCGATATTCAATTTCCAAACATCAGAACCGGTCCAATCCAAAAT
CAAATTCCCTGAAGGAGTGCCTAAAGATTACCCCAAGTCATTTAAAGTCC
ATTCGAAATTTAGTGATGAAAATTCTTTCCTTTCATGGACCCCTATATCT
TGGGAAAATCAAAATGGAAAACTCACATCAAGTGAAATGGAATGTTTTGA
TTTTATCAAAGAGAATCTCGTTGTGAAACGAAATACAACAGAAAATCAAA
TTGAATTCTCCAAAAACCTCACAAATAAAAAATTACAATGTCGAATGAGA
TCCCGAACAAAAGCTGGCGCCGGGCCTTGGTCTCCATTTGTTTTAATCGA
TTTCAATCATTCAGAAATTGAACCTCCAACTCAAATCAGCATTTTAAAAA
TATCATCCTGCTGCTTCAAAATTAGCTGGAAATGGCAGAAAGAATTTCTC
AATTTCTATAACTATTTTCTAATATTCTTTACGAGAAACGACCAAATAAA
TCACGAGAATTTCCAATTCCGAACGCGATATGCGTCCTCCTTGTTTTACG
TGGCAAAACAGAACGAGTTTGATTGGAATAAAAATTATTCAGTAACAATG
CAAACAGTGACAAAGTCTGGAGCACTTTCTTCAATGTCCGGTGAAGTTTT
TCCAAGAAAATATTCCAATCATTGGCCCATTGCGGCTGTCTCTTCCGTTT
TATGTATTCCATTGAATAGCAGAAAAATCAAAGTAAAATGGAAATATCTA
TACCGATTCGAAAGTCTTTCACATTTCAGAGTAAATTTTACGGGTGCTAC
GGATTTCAAGTCAAATTTGGGCAAGGAGATTTCAATTAAAAGGAAAGAAA
AAGAAGATTCAGCATTATATGATACAGCAAGTATAGAATATGAAAAGGAA
ATAGAAAATATGTTACCAAATACAAAATATAATATTGACATTGAACCGAT
ACAGTTGCCAAATGTCGACATTTGGTCGGAGTCCTACACAGTTACCTGTA
GCACTCTCCCTGAGCCACCAAAAAACATAAAAGAACTAAAAATCGATGAA
GTCAACACCGAAAAATCAATTATCAATTTAGTGATTGATCAACCAAGCTA
TGAAAATGGAGAAATTAGTACGTATTTTATTGTAGTTGAATCAAATGATC
CAATAACTGAAACTGGTGATCCGAAAAATGATTCCGAAATCGAAACAATC
GAGAAATCCCAAGATATTATATTCAGTTTCTTGACTCGACATAATCGTTC
CCATTTATCCGACCAGATTTCACAGCCGTATTTTGCAGCTGAATTAAATG
CTACTTCAGTCATGAGGGAAACCTCGCACGGAAGATTTTTCAAATTTCCT
CTAGGTAGCAAAATTTCTCAAACAAATTTCCCTCTCAACAAACCACTTGC
AAAAGGAGTCAACTATCGGGCAGCACTTATCGCTTGTATTAGTCCAATCT
TTAACGAGATCTCAATCCGAAGAATTTGTTCTATGGGGAAATGGTCAGCC
AAATTAAACACTTTAACCACGGTTCCAAATTTCATTAATAACCTTTCTCC
GAATAGGTTTACGAACGACTCGAAAACTAGTAAGCCCACAATCACGTCGG
TTTTGTCGGGAATTATTGTTACTTCGATATTTATACCAATCGCAATCTGT
ATTTTATTGTTTTTATATACTGTAATTGCTCGGCGGAGTAACAGCAACAT
CAAACTTTTGATTCCATGTTTTAAATTGAGACATTCTTCTCAAAACTACT
ATCCAGCATCGAATAGCGAAATCAAAGAAAATCTCGTCAATCCTCTTATT
GTCTCTGCAAATGTTGGCTCTTCATACTCAAATCAAAACCACGATTCATT
GGAGCTGAAACGATATCAGATTTCTACGACACCTGACTTATTGGTTCAAT
CTTCACCTTCTACGAGTTTCAAAGACAAAAAATTAGTTTTGAGCGAAAAA
AATATCAAACAGTTTCAGCACAAAGTTCCAATTGCTTTGTTGCAGGAATA
TATTTCTAACTTGAAAACAAATGAAAACAGAGGCTTCTCCACCGAGTTCG
TGTCAATAGATCACGCAAATCAGTTCTCCTGGGAACAATCCAACAAACCC
ACAAACAAATCTAAGAACAGATATGCAAATGTTGTCGCATATGATCACAG
TCGAGTCGTTCTGCAGAGTTCAAAACTGGTGAACGACATTTGTGATTCAT
TAGATCCCTACAGATCAAATGATTACATCAATGCCAACTATATTAATGGC
TATAGAAAACAAAATGCGTATATAGCAACTCAGGGTCCTTTGTTGGAAAC
CATAAATGATTTCTGGAGAATGATTTGGGAGCAAAGATCAGTAATAATAG
TGATGTTAACCTTGTTAATGGAAAGGTCCAGAGTAAAGTGCGAGCAATAT
TGGCCAAAGTCAAATAGAGGGACGCATTTTACATACGGAGGAATCATGGT
TACAGTGAATTTGGTTCAAGAATTTGCTTACTTCATTTGTCGTTCTTTTG
TTGTTCAGAAAATTGGGTCACCGGAAAAGAGAGAAATCAAACATTTTCAA
TTTACCGCATGGCCGGATCATGGAGTACCACAGTGCACAATTCCTTTTTT
AATGTTTATTAATAGAATTAAAAAAGAAGAGCCTTTAGATAGTGGTCCCG
TAGTGGTCCATTGTTCAGCGGGTGTCGGGCGGACCGGAGTCTACATTGCT
GTCGATGCCATGCTTGAACAAATGAAGCACGAGAAATCTGTCGACGTTTA
CTCTTACGTCACACACATCCGAAGCCAACGAAATTATATGGTACAAACCG
AAGAACAGTACATTTTCATCCATGACGTACTGTTGGATTATTTCCAGTCA
GTAAACACAGATATCGCGTGTTCACAACTTTTCTCTCACATAGAAAAGTT
GAGTAAAATTGAATACGAAAAAGCAGGCCTTTTACAATTTACCGGGTTTC
AGTTGGAATACCGAAGGCTTCTCAGATGGTCTTCGTTGTTTTCTCACATG
ACTCCTTCAACCAAATCCGAATGTTCAACCAAATCTTCAGAATCAATTGG
ATGTCAACCAGATTTTTCCACCAACAATTATGAAACTTCATGCTTAATGG
TCAACCAGAGTAAGAATCGTTCCCCTTATAGCCTACCTCCAGACACTAAT
CGAGTAATTCTGTGCCCAATTCGAGGTGTTGAAGGATCAGATTATTTCAA
TGCATCCTGGATAGATGGATTTAAAAGTCGACAGGCGTACATCGCAACGC
AATGTCCACTGAAAGAAACAACAGAGGATTTTTGGAGAATGCTTTGGGAA
CAAAATTGTGGAATAGTGATAACTCTACACTATGTGCCCGAATGCAATCA
ATACTGGCCGAATGACCGATCAGCACGGTATCAGTTTTTTGTCGTTGATC
CAATCATAGAATACCAAATGTCACACTTCGTTATGAGGGAGTTCAAGTTA
ACTGATGCCCGTGACGGCCAATCCCGAGTGATGCGGCAATTCCAATTCAC
CAATTGGATAGACGACTCTTGCATACCAATTTCTATCGAACACTTGTTAG
AGTTAATTGATCAAGTTCAAAAGACGAAAGAACAGTTCGGACAAAAAGGT
CCATTAACAGTTCATTGCAATACTGGATCCATAAGAACTGGGATATTTCT
TGTGTTATCGATTCTTTTGGAAAAATTGAAAACTGATAATTGTGTAAATG
TTTTCGAAACCTTCAAATTATTGAAATGGCAACGGCCGTCCTTGATTGAA
TCAGAAGACCAATATCAATTTTGTTTTGCTGCACTTCTGGAATATTTGAC
ATTGTACTCCGACGAAAATACGAATCTGTAATTCAACGGGAAATTTATCC
AATTGAAAGCATTTATTAACACTTCTAACCGCATTTCAGATGATTTGTAA
ATTTGCATTAATATTGATAAATATTTTTTTTTGATTTTTCAATTGTTTGT
TGTAGATTTTATATATTTTGTATCGATCTACAAGGTGCAATGATTTTGAT
TTGTTCATCATTGCATTATGATCTCTACAGTGAATCCTTGTTTCTTGCAC
CTTGTGGACCGGAATTGAAGATTATTATAAATTGACTGTTATATTTCAAT
TTGGTCAAGCCCAAGAAATTCGCTTCTTCTTTCTCACTGGTGAAACTTTA
TTTTTTTGTCAGCTTTAATAAAGGTCGAAATTTACTTATGTGTTACGGAT
GTGTTTTTTGCAATTAAGATGCCTTTTATTTGTCTGGCCATTTGTTTAAA
GAAATGTTAATGTAATATGAATTTTTATCGAAAAGAATACGAACGTTTGT
TATTTAACAAGTAAAGAATAAGCAATCATATAAGTAGTTCACATGTTTTA
TATACATAAGTCTAAGTAACTGTTAAAATTGTTATTAATATTTCAACTGT
CGTGCAATATCACCTAATGTTACAAGTTGTGTGTAATGTATATCACTATT
GGTGTACAAATTGTCTTATAGCAA
back to top

protein sequence of SMED30014428-orf-1

>SMED30014428-orf-1 ID=SMED30014428-orf-1|Name=SMED30014428-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2091bp
MPDKTLDFPVIRLVFMIFTTIFIVDAYVSLEISSNNGYELTYEKIKRPKI
IHAPRNASVLANQQMLFICISEGNPKPKVTWLYNGKPQLPERYNIIRDSV
LHLSSARSEDNGAIVSCVCRNVMGSEDKSASIKVYNDINAVPKGFPKYFG
KSSITVSQKNSNVTLECLVFGQSKITVVWFKDFFPLDLRSIRYQMLDGKN
LFILKTMESDTGKYQCMAINEFGSMISPAKSLMIRVSRFSPHFVYVSPDQ
FIRTGSSVKLKCSGEGSPTPHVFWICGNTKLTGLNGDKGQTENIGSIEMV
LSDISESLNCTCVAKTKQETANHTVHIIVKNLPVAPTIVRISEISHRSCL
LTWKYQSTTTISITSFIVFYIPTVMLRIEQPLSKDIDISSKEIQKDFNIN
TKIMELKPYTNYSLWLVTNGVEGVSEPSKIHSFQTLETEPTSAPRSVSIA
LTSETSVRVKWKPPIETNGEITLYQVFYTKSKEDPLTQWSINSLKIVNEE
KENDKSVEIYMLDRNTMYYFCVNSRNSAGEGPSSQIVQKFINDDEIYQLK
NLTMLLVQSKSADILWKIDPISKVNAFKIVCIPSTSHPSQANEVYKIFLN
KLNKQLIYFTKISNLSPNTPYIVEIIPIFNNTAKSSMKIRFTTRYHDEKE
LIKAISISQESIMISIPHSSMIISPRIVVGYFPYTEGNKSLTKSCFLKTD
NSCHLTNLVPETLYQLNIAYNGMTVKRYVETWAKDPDPVQDFKLELINPK
SQPYIKATWKYLTGPLPIFEITYSPLDAPVNSNFSKYAKTINITDLKYET
DPATHVMGSTVQFSIRAIFNFQTSEPVQSKIKFPEGVPKDYPKSFKVHSK
FSDENSFLSWTPISWENQNGKLTSSEMECFDFIKENLVVKRNTTENQIEF
SKNLTNKKLQCRMRSRTKAGAGPWSPFVLIDFNHSEIEPPTQISILKISS
CCFKISWKWQKEFLNFYNYFLIFFTRNDQINHENFQFRTRYASSLFYVAK
QNEFDWNKNYSVTMQTVTKSGALSSMSGEVFPRKYSNHWPIAAVSSVLCI
PLNSRKIKVKWKYLYRFESLSHFRVNFTGATDFKSNLGKEISIKRKEKED
SALYDTASIEYEKEIENMLPNTKYNIDIEPIQLPNVDIWSESYTVTCSTL
PEPPKNIKELKIDEVNTEKSIINLVIDQPSYENGEISTYFIVVESNDPIT
ETGDPKNDSEIETIEKSQDIIFSFLTRHNRSHLSDQISQPYFAAELNATS
VMRETSHGRFFKFPLGSKISQTNFPLNKPLAKGVNYRAALIACISPIFNE
ISIRRICSMGKWSAKLNTLTTVPNFINNLSPNRFTNDSKTSKPTITSVLS
GIIVTSIFIPIAICILLFLYTVIARRSNSNIKLLIPCFKLRHSSQNYYPA
SNSEIKENLVNPLIVSANVGSSYSNQNHDSLELKRYQISTTPDLLVQSSP
STSFKDKKLVLSEKNIKQFQHKVPIALLQEYISNLKTNENRGFSTEFVSI
DHANQFSWEQSNKPTNKSKNRYANVVAYDHSRVVLQSSKLVNDICDSLDP
YRSNDYINANYINGYRKQNAYIATQGPLLETINDFWRMIWEQRSVIIVML
TLLMERSRVKCEQYWPKSNRGTHFTYGGIMVTVNLVQEFAYFICRSFVVQ
KIGSPEKREIKHFQFTAWPDHGVPQCTIPFLMFINRIKKEEPLDSGPVVV
HCSAGVGRTGVYIAVDAMLEQMKHEKSVDVYSYVTHIRSQRNYMVQTEEQ
YIFIHDVLLDYFQSVNTDIACSQLFSHIEKLSKIEYEKAGLLQFTGFQLE
YRRLLRWSSLFSHMTPSTKSECSTKSSESIGCQPDFSTNNYETSCLMVNQ
SKNRSPYSLPPDTNRVILCPIRGVEGSDYFNASWIDGFKSRQAYIATQCP
LKETTEDFWRMLWEQNCGIVITLHYVPECNQYWPNDRSARYQFFVVDPII
EYQMSHFVMREFKLTDARDGQSRVMRQFQFTNWIDDSCIPISIEHLLELI
DQVQKTKEQFGQKGPLTVHCNTGSIRTGIFLVLSILLEKLKTDNCVNVFE
TFKLLKWQRPSLIESEDQYQFCFAALLEYLTLYSDENTNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000061enteric musculature
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000231vitelline gland
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR036116FN3_sf
IPR003133T_Ag_DNA-bd
IPR000242PTPase_domain
IPR003961FN3_dom
IPR003599Ig_sub
IPR003598Ig_sub2
IPR003595Tyr_Pase_cat
IPR013783Ig-like_fold
IPR029021Prot-tyrosine_phosphatase-like
IPR013098Ig_I-set
IPR016130Tyr_Pase_AS
IPR000387TYR_PHOSPHATASE_dom
IPR007110Ig-like_dom
IPR000421FA58C
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0048681negative regulation of axon regeneration
GO:0061000negative regulation of dendritic spine development
GO:0007155cell adhesion
GO:0010977negative regulation of neuron projection development
GO:0030517negative regulation of axon extension
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0048671negative regulation of collateral sprouting
Vocabulary: molecular function
TermDefinition
GO:0003688DNA replication origin binding
GO:0004725protein tyrosine phosphatase activity
GO:0005515protein binding
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0008201heparin binding
GO:0016787hydrolase activity
GO:0035374chondroitin sulfate binding
GO:0043395heparan sulfate proteoglycan binding
Vocabulary: cellular component
TermDefinition
GO:0099061integral component of postsynaptic density membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030285integral component of synaptic vesicle membrane
GO:0030424axon
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000242PTP type protein phosphatasePRINTSPR00700PRTYPHPHTASEcoord: 1658..1675
score: 54.54
coord: 1571..1591
score: 67.48
coord: 1728..1743
score: 38.31
coord: 1697..1715
score: 68.82
coord: 1744..1754
score: 69.2
coord: 1555..1562
score: 79.71
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 1824..2081
e-value: 4.1E-76
score: 268.8
coord: 1492..1763
e-value: 1.2E-122
score: 423.4
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 1849..2078
e-value: 1.4E-59
score: 201.5
coord: 1516..1759
e-value: 3.7E-83
score: 278.7
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 1849..2079
score: 45.01
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 1493..1761
score: 58.203
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 158..223
e-value: 1.3E-4
score: 31.3
coord: 253..319
e-value: 1.9
score: 4.4
coord: 60..124
e-value: 0.034
score: 21.2
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 1974..2078
e-value: 2.6E-25
score: 100.1
coord: 1659..1760
e-value: 1.5E-43
score: 160.7
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 247..330
e-value: 2.0
score: 17.4
coord: 152..237
e-value: 7.1E-4
score: 28.9
coord: 54..135
e-value: 0.004
score: 26.4
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 441..531
e-value: 4.0E-8
score: 43.0
coord: 546..636
e-value: 130.0
score: 1.9
coord: 333..425
e-value: 2.3E-4
score: 30.5
IPR003961Fibronectin type IIIPFAMPF00041fn3coord: 442..534
e-value: 4.3E-11
score: 43.0
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 443..544
score: 18.067
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 335..438
score: 13.562
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 939..1037
score: 6.699
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 841..935
score: 8.624
IPR003961Fibronectin type IIICDDcd00063FN3coord: 442..538
e-value: 6.16277E-14
score: 67.1363
IPR003961Fibronectin type IIICDDcd00063FN3coord: 333..435
e-value: 3.1726E-9
score: 54.0395
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 836..935
e-value: 3.6E-7
score: 32.3
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 434..544
e-value: 6.3E-21
score: 76.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 140..237
e-value: 1.9E-14
score: 55.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 334..433
e-value: 1.0E-8
score: 37.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 38..138
e-value: 4.5E-14
score: 54.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 238..333
e-value: 3.1E-10
score: 42.0
NoneNo IPR availablePFAMPF13927Ig_3coord: 47..121
e-value: 3.0E-8
score: 34.2
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 1432..1804
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 161..538
coord: 1843..2079
NoneNo IPR availablePANTHERPTHR19134:SF203RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE Fcoord: 1432..1804
coord: 1843..2079
NoneNo IPR availablePANTHERPTHR19134:SF203RECEPTOR-TYPE TYROSINE-PROTEIN PHOSPHATASE Fcoord: 161..538
NoneNo IPR availableCDDcd14554R-PTP-LAR-2coord: 1846..2077
e-value: 1.33662E-109
score: 346.819
NoneNo IPR availableCDDcd14553R-PTPc-LAR-1coord: 1514..1760
e-value: 2.50162E-137
score: 425.657
NoneNo IPR availableTMHMMTMhelixcoord: 1284..1303
NoneNo IPR availableTMHMMTMhelixcoord: 1352..1374
NoneNo IPR availableTMHMMTMhelixcoord: 13..30
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 155..224
e-value: 3.6E-8
score: 33.4
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 1466..1775
e-value: 2.6E-112
score: 377.0
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 1808..2089
e-value: 2.9E-80
score: 271.7
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 1476..1766
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 1831..2082
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 1700..1710
IPR016130Protein-tyrosine phosphatase, active sitePROSITEPS00383TYR_PHOSPHATASE_1coord: 2018..2028
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 241..322
score: 7.667
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 48..133
score: 10.662
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 146..233
score: 10.426
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 1678..1752
score: 21.576
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 1994..2070
score: 17.549
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 240..337
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 157..231
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 48..135
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 832..929
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 910..1027
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 332..539
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 1045..1198