SMED30014423

Overview
NameSMED30014423
Smed IDSMED30014423
Length (bp)764
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30014423 (SMED30014423) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30014423 (SMED30014423) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30014423 (SMED30014423) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30014423 (SMED30014423) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014423

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014423SMESG000081182.1 SMESG000080940.1 SMESG000078992.1 SMESG000078983.1 SMESG000077287.1 SMESG000075210.1 SMESG000074911.1 SMESG000074028.1 SMESG000072039.1 SMESG000071706.1 SMESG000068337.1 SMESG000068123.1 SMESG000065077.1 SMESG000064823.1 SMESG000064822.1 SMESG000064680.1 SMESG000063141.1 SMESG000061023.1 SMESG000059899.1 SMESG000059678.1 SMESG000059068.1 SMESG000058904.1 SMESG000057509.1 SMESG000056948.1 SMESG000056946.1 SMESG000055464.1 SMESG000053941.1 SMESG000052810.1 SMESG000051827.1 SMESG000050002.1 SMESG000049686.1 SMESG000048129.1 SMESG000043961.1 SMESG000043940.1 SMESG000043581.1 SMESG000042799.1 SMESG000040860.1 SMESG000039943.1 SMESG000039785.1 SMESG000039436.1 SMESG000037686.1 SMESG000036786.1 SMESG000035410.1 SMESG000035332.1 SMESG000035314.1 SMESG000034988.1 SMESG000031376.1 SMESG000030178.1 SMESG000029692.1 SMESG000029268.1 SMESG000028769.1 SMESG000021640.1 SMESG000016998.1 SMESG000016572.1 SMESG000016077.1 SMESG000015785.1 SMESG000014693.1 SMESG000013977.1 SMESG000010932.1 SMESG000009343.1 SMESG000008912.1 SMESG000008886.1 SMESG000008709.1 SMESG000007885.1 SMESG000007620.1 SMESG000005720.1 SMESG000002803.1 SMESG000001438.1 SMESG000000930.1 SMESG000000690.1 SMESG000000374.1 dd_Smed_v4_7997_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014423SMESG000081182.1 SMESG000080940.1 SMESG000078992.1 SMESG000078983.1 SMESG000077287.1 SMESG000075210.1 SMESG000074911.1 SMESG000074028.1 SMESG000072039.1 SMESG000071706.1 SMESG000068337.1 SMESG000068123.1 SMESG000065077.1 SMESG000064823.1 SMESG000064822.1 SMESG000064680.1 SMESG000063141.1 SMESG000061023.1 SMESG000059899.1 SMESG000059678.1 SMESG000059068.1 SMESG000058904.1 SMESG000057509.1 SMESG000056948.1 SMESG000056946.1 SMESG000055464.1 SMESG000053941.1 SMESG000052810.1 SMESG000051827.1 SMESG000050002.1 SMESG000049686.1 SMESG000048129.1 SMESG000043961.1 SMESG000043940.1 SMESG000043581.1 SMESG000042799.1 SMESG000040860.1 SMESG000039943.1 SMESG000039785.1 SMESG000039436.1 SMESG000037686.1 SMESG000036786.1 SMESG000035410.1 SMESG000035332.1 SMESG000035314.1 SMESG000034988.1 SMESG000031376.1 SMESG000030178.1 SMESG000029692.1 SMESG000029268.1 SMESG000028769.1 SMESG000021640.1 SMESG000016998.1 SMESG000016572.1 SMESG000016077.1 SMESG000015785.1 SMESG000014693.1 SMESG000013977.1 SMESG000010932.1 SMESG000009343.1 SMESG000008912.1 SMESG000008886.1 SMESG000008709.1 SMESG000007885.1 SMESG000007620.1 SMESG000005720.1 SMESG000002803.1 SMESG000001438.1 SMESG000000930.1 SMESG000000690.1 SMESG000000374.1 dd_Smed_v4_7997_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014423SMESG000081182.1 SMESG000080940.1 SMESG000078992.1 SMESG000078983.1 SMESG000077287.1 SMESG000075210.1 SMESG000074911.1 SMESG000074028.1 SMESG000072039.1 SMESG000071706.1 SMESG000068337.1 SMESG000068123.1 SMESG000065077.1 SMESG000064823.1 SMESG000064822.1 SMESG000064680.1 SMESG000063141.1 SMESG000061023.1 SMESG000059899.1 SMESG000059678.1 SMESG000059068.1 SMESG000058904.1 SMESG000057509.1 SMESG000056948.1 SMESG000056946.1 SMESG000055464.1 SMESG000053941.1 SMESG000052810.1 SMESG000051827.1 SMESG000050002.1 SMESG000049686.1 SMESG000048129.1 SMESG000043961.1 SMESG000043940.1 SMESG000043581.1 SMESG000042799.1 SMESG000040860.1 SMESG000039943.1 SMESG000039785.1 SMESG000039436.1 SMESG000037686.1 SMESG000036786.1 SMESG000035410.1 SMESG000035332.1 SMESG000035314.1 SMESG000034988.1 SMESG000031376.1 SMESG000030178.1 SMESG000029692.1 SMESG000029268.1 SMESG000028769.1 SMESG000021640.1 SMESG000016998.1 SMESG000016572.1 SMESG000016077.1 SMESG000015785.1 SMESG000014693.1 SMESG000013977.1 SMESG000010932.1 SMESG000009343.1 SMESG000008912.1 SMESG000008886.1 SMESG000008709.1 SMESG000007885.1 SMESG000007620.1 SMESG000005720.1 SMESG000002803.1 SMESG000001438.1 SMESG000000930.1 SMESG000000690.1 SMESG000000374.1 dd_Smed_v4_7997_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014423SMESG000081182.1 SMESG000080940.1 SMESG000078992.1 SMESG000078983.1 SMESG000077287.1 SMESG000075210.1 SMESG000074911.1 SMESG000074028.1 SMESG000072039.1 SMESG000071706.1 SMESG000068337.1 SMESG000068123.1 SMESG000065077.1 SMESG000064823.1 SMESG000064822.1 SMESG000064680.1 SMESG000063141.1 SMESG000061023.1 SMESG000059899.1 SMESG000059678.1 SMESG000059068.1 SMESG000058904.1 SMESG000057509.1 SMESG000056948.1 SMESG000056946.1 SMESG000055464.1 SMESG000053941.1 SMESG000052810.1 SMESG000051827.1 SMESG000050002.1 SMESG000049686.1 SMESG000048129.1 SMESG000043961.1 SMESG000043940.1 SMESG000043581.1 SMESG000042799.1 SMESG000040860.1 SMESG000039943.1 SMESG000039785.1 SMESG000039436.1 SMESG000037686.1 SMESG000036786.1 SMESG000035410.1 SMESG000035332.1 SMESG000035314.1 SMESG000034988.1 SMESG000031376.1 SMESG000030178.1 SMESG000029692.1 SMESG000029268.1 SMESG000028769.1 SMESG000021640.1 SMESG000016998.1 SMESG000016572.1 SMESG000016077.1 SMESG000015785.1 SMESG000014693.1 SMESG000013977.1 SMESG000010932.1 SMESG000009343.1 SMESG000008912.1 SMESG000008886.1 SMESG000008709.1 SMESG000007885.1 SMESG000007620.1 SMESG000005720.1 SMESG000002803.1 SMESG000001438.1 SMESG000000930.1 SMESG000000690.1 SMESG000000374.1 dd_Smed_v4_7997_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30014423SMESG000081182.1 SMESG000080940.1 SMESG000078992.1 SMESG000078983.1 SMESG000077287.1 SMESG000075210.1 SMESG000074911.1 SMESG000074028.1 SMESG000072039.1 SMESG000071706.1 SMESG000068337.1 SMESG000068123.1 SMESG000065077.1 SMESG000064823.1 SMESG000064822.1 SMESG000064680.1 SMESG000063141.1 SMESG000061023.1 SMESG000059899.1 SMESG000059678.1 SMESG000059068.1 SMESG000058904.1 SMESG000057509.1 SMESG000056948.1 SMESG000056946.1 SMESG000055464.1 SMESG000053941.1 SMESG000052810.1 SMESG000051827.1 SMESG000050002.1 SMESG000049686.1 SMESG000048129.1 SMESG000043961.1 SMESG000043940.1 SMESG000043581.1 SMESG000042799.1 SMESG000040860.1 SMESG000039943.1 SMESG000039785.1 SMESG000039436.1 SMESG000037686.1 SMESG000036786.1 SMESG000035410.1 SMESG000035332.1 SMESG000035314.1 SMESG000034988.1 SMESG000031376.1 SMESG000030178.1 SMESG000029692.1 SMESG000029268.1 SMESG000028769.1 SMESG000021640.1 SMESG000016998.1 SMESG000016572.1 SMESG000016077.1 SMESG000015785.1 SMESG000014693.1 SMESG000013977.1 SMESG000010932.1 SMESG000009343.1 SMESG000008912.1 SMESG000008886.1 SMESG000008709.1 SMESG000007885.1 SMESG000007620.1 SMESG000005720.1 SMESG000002803.1 SMESG000001438.1 SMESG000000930.1 SMESG000000690.1 SMESG000000374.1 dd_Smed_v4_7997_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014423SMESG000081182.1 SMESG000080940.1 SMESG000078992.1 SMESG000078983.1 SMESG000077287.1 SMESG000075210.1 SMESG000074911.1 SMESG000074028.1 SMESG000072039.1 SMESG000071706.1 SMESG000068337.1 SMESG000068123.1 SMESG000065077.1 SMESG000064823.1 SMESG000064822.1 SMESG000064680.1 SMESG000063141.1 SMESG000061023.1 SMESG000059899.1 SMESG000059678.1 SMESG000059068.1 SMESG000058904.1 SMESG000057509.1 SMESG000056948.1 SMESG000056946.1 SMESG000055464.1 SMESG000053941.1 SMESG000052810.1 SMESG000051827.1 SMESG000050002.1 SMESG000049686.1 SMESG000048129.1 SMESG000043961.1 SMESG000043940.1 SMESG000043581.1 SMESG000042799.1 SMESG000040860.1 SMESG000039943.1 SMESG000039785.1 SMESG000039436.1 SMESG000037686.1 SMESG000036786.1 SMESG000035410.1 SMESG000035332.1 SMESG000035314.1 SMESG000034988.1 SMESG000031376.1 SMESG000030178.1 SMESG000029692.1 SMESG000029268.1 SMESG000028769.1 SMESG000021640.1 SMESG000016998.1 SMESG000016572.1 SMESG000016077.1 SMESG000015785.1 SMESG000014693.1 SMESG000013977.1 SMESG000010932.1 SMESG000009343.1 SMESG000008912.1 SMESG000008886.1 SMESG000008709.1 SMESG000007885.1 SMESG000007620.1 SMESG000005720.1 SMESG000002803.1 SMESG000001438.1 SMESG000000930.1 SMESG000000690.1 SMESG000000374.1 dd_Smed_v4_7997_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30014423SMESG000081182.1 SMESG000080940.1 SMESG000078992.1 SMESG000078983.1 SMESG000077287.1 SMESG000075210.1 SMESG000074911.1 SMESG000074028.1 SMESG000072039.1 SMESG000071706.1 SMESG000068337.1 SMESG000068123.1 SMESG000065077.1 SMESG000064823.1 SMESG000064822.1 SMESG000064680.1 SMESG000063141.1 SMESG000061023.1 SMESG000059899.1 SMESG000059678.1 SMESG000059068.1 SMESG000058904.1 SMESG000057509.1 SMESG000056948.1 SMESG000056946.1 SMESG000055464.1 SMESG000053941.1 SMESG000052810.1 SMESG000051827.1 SMESG000050002.1 SMESG000049686.1 SMESG000048129.1 SMESG000043961.1 SMESG000043940.1 SMESG000043581.1 SMESG000042799.1 SMESG000040860.1 SMESG000039943.1 SMESG000039785.1 SMESG000039436.1 SMESG000037686.1 SMESG000036786.1 SMESG000035410.1 SMESG000035332.1 SMESG000035314.1 SMESG000034988.1 SMESG000031376.1 SMESG000030178.1 SMESG000029692.1 SMESG000029268.1 SMESG000028769.1 SMESG000021640.1 SMESG000016998.1 SMESG000016572.1 SMESG000016077.1 SMESG000015785.1 SMESG000014693.1 SMESG000013977.1 SMESG000010932.1 SMESG000009343.1 SMESG000008912.1 SMESG000008886.1 SMESG000008709.1 SMESG000007885.1 SMESG000007620.1 SMESG000005720.1 SMESG000002803.1 SMESG000001438.1 SMESG000000930.1 SMESG000000690.1 SMESG000000374.1 dd_Smed_v4_7997_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014423SMESG000081182.1 SMESG000080940.1 SMESG000078992.1 SMESG000078983.1 SMESG000077287.1 SMESG000075210.1 SMESG000074911.1 SMESG000074028.1 SMESG000072039.1 SMESG000071706.1 SMESG000068337.1 SMESG000068123.1 SMESG000065077.1 SMESG000064823.1 SMESG000064822.1 SMESG000064680.1 SMESG000063141.1 SMESG000061023.1 SMESG000059899.1 SMESG000059765.1 SMESG000059761.1 SMESG000059678.1 SMESG000058904.1 SMESG000058773.1 SMESG000057509.1 SMESG000056948.1 SMESG000056946.1 SMESG000055464.1 SMESG000053941.1 SMESG000052810.1 SMESG000051827.1 SMESG000050002.1 SMESG000049686.1 SMESG000048129.1 SMESG000043961.1 SMESG000043940.1 SMESG000043581.1 SMESG000040860.1 SMESG000040455.1 SMESG000039943.1 SMESG000039785.1 SMESG000039436.1 SMESG000037686.1 SMESG000036786.1 SMESG000035410.1 SMESG000035332.1 SMESG000035314.1 SMESG000030178.1 SMESG000029692.1 SMESG000029268.1 SMESG000028769.1 SMESG000021640.1 SMESG000016998.1 SMESG000016572.1 SMESG000016077.1 SMESG000015785.1 SMESG000014693.1 SMESG000014273.1 SMESG000013977.1 SMESG000010932.1 SMESG000009343.1 SMESG000008912.1 SMESG000008886.1 SMESG000008709.1 SMESG000007885.1 SMESG000007620.1 SMESG000005720.1 SMESG000002803.1 SMESG000002488.1 SMESG000001438.1 SMESG000000690.1 SMESG000000374.1 Contig36656newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014423SMESG000081182.1 SMESG000080940.1 SMESG000078992.1 SMESG000078983.1 SMESG000077287.1 SMESG000075210.1 SMESG000074911.1 SMESG000074028.1 SMESG000072039.1 SMESG000071706.1 SMESG000068337.1 SMESG000068123.1 SMESG000065077.1 SMESG000064823.1 SMESG000064822.1 SMESG000064680.1 SMESG000063141.1 SMESG000061023.1 SMESG000059899.1 SMESG000059765.1 SMESG000059761.1 SMESG000059678.1 SMESG000058904.1 SMESG000058773.1 SMESG000057509.1 SMESG000056948.1 SMESG000056946.1 SMESG000055464.1 SMESG000053941.1 SMESG000052810.1 SMESG000051827.1 SMESG000050002.1 SMESG000049686.1 SMESG000048129.1 SMESG000043961.1 SMESG000043940.1 SMESG000043581.1 SMESG000040860.1 SMESG000040455.1 SMESG000039943.1 SMESG000039785.1 SMESG000039436.1 SMESG000037686.1 SMESG000036786.1 SMESG000035410.1 SMESG000035332.1 SMESG000035314.1 SMESG000030178.1 SMESG000029692.1 SMESG000029268.1 SMESG000028769.1 SMESG000021640.1 SMESG000016998.1 SMESG000016572.1 SMESG000016077.1 SMESG000015785.1 SMESG000014693.1 SMESG000014273.1 SMESG000013977.1 SMESG000010932.1 SMESG000009343.1 SMESG000008912.1 SMESG000008886.1 SMESG000008709.1 SMESG000007885.1 SMESG000007620.1 SMESG000005720.1 SMESG000002803.1 SMESG000002488.1 SMESG000001438.1 SMESG000000690.1 SMESG000000374.1 Contig36656uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30014423 vs. Ensembl Nematostella
Match: EDO40301 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7U5])

HSP 1 Score: 46.9802 bits (110), Expect = 4.211e-6
Identity = 21/45 (46.67%), Postives = 28/45 (62.22%), Query Frame = 1
Query:    1 VRMGTDGCGWVRMGADGYGWVWIGMDLCGWVRMGADGCGSVRMGV 135
            V +G  G GWV +G  GYGWVW+G+   GWV +G  G   V +G+
Sbjct:  790 VSLGIAGYGWVSLGIAGYGWVWLGIAGYGWVSLGMVGYRWVWLGI 834          
BLAST of SMED30014423 vs. Planmine SMEST
Match: SMESG000046838.1 (SMESG000046838.1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.996e-11
Identity = 31/45 (68.89%), Postives = 36/45 (80.00%), Query Frame = 1
Query:    1 VRMGTDGCGWVRMGADGYGWVWIGMDLCGWVRMGADGCGSVRMGV 135
            +RMGTDG GW+RMG DGYGW+ +G D  GWVRMG+DG G VRMG 
Sbjct:   57 IRMGTDGYGWIRMGTDGYGWIRMGTDGYGWVRMGSDGYGWVRMGT 101          

HSP 2 Score: 62.003 bits (149), Expect = 8.086e-11
Identity = 30/45 (66.67%), Postives = 35/45 (77.78%), Query Frame = 1
Query:    1 VRMGTDGCGWVRMGADGYGWVWIGMDLCGWVRMGADGCGSVRMGV 135
            +RMGTDG GWVRMG+DGYGWV +G D  GW+RM  DG G +RMG 
Sbjct:   77 IRMGTDGYGWVRMGSDGYGWVRMGTDGYGWIRMNTDGYGWIRMGT 121          

HSP 3 Score: 61.2326 bits (147), Expect = 1.491e-10
Identity = 30/45 (66.67%), Postives = 34/45 (75.56%), Query Frame = 1
Query:    1 VRMGTDGCGWVRMGADGYGWVWIGMDLCGWVRMGADGCGSVRMGV 135
            +RMGTDG GW+RMG DGYGWV +G D  GWVRMG DG G +RM  
Sbjct:   67 IRMGTDGYGWIRMGTDGYGWVRMGSDGYGWVRMGTDGYGWIRMNT 111          

HSP 4 Score: 58.5362 bits (140), Expect = 1.172e-9
Identity = 28/43 (65.12%), Postives = 33/43 (76.74%), Query Frame = 1
Query:    1 VRMGTDGCGWVRMGADGYGWVWIGMDLCGWVRMGADGCGSVRM 129
            VRMG+DG GWVRMG DGYGW+ +  D  GW+RMG DG G +RM
Sbjct:   87 VRMGSDGYGWVRMGTDGYGWIRMNTDGYGWIRMGTDGYGWIRM 129          

HSP 5 Score: 58.151 bits (139), Expect = 1.633e-9
Identity = 28/44 (63.64%), Postives = 33/44 (75.00%), Query Frame = 2
Query:    2 YGWVRMGADGCEWVRMGMDGYGSVWICVDGCGWVRMGADLCGWV 133
            YGWVRMG+DG  WVRMG DGYG + +  DG GW+RMG D  GW+
Sbjct:   84 YGWVRMGSDGYGWVRMGTDGYGWIRMNTDGYGWIRMGTDGYGWI 127          

HSP 6 Score: 57.7658 bits (138), Expect = 2.134e-9
Identity = 29/44 (65.91%), Postives = 33/44 (75.00%), Query Frame = 1
Query:    1 VRMGTDGCGWVRMGADGYGWVWIGMDLCGWVRMGADGCGSVRMG 132
            VRM T G GW+RMG DGYGW+ +G D  GW+RMG DG G VRMG
Sbjct:   47 VRMSTVGYGWIRMGTDGYGWIRMGTDGYGWIRMGTDGYGWVRMG 90          

HSP 7 Score: 56.9954 bits (136), Expect = 3.322e-9
Identity = 28/44 (63.64%), Postives = 33/44 (75.00%), Query Frame = 2
Query:    2 YGWVRMGADGCEWVRMGMDGYGSVWICVDGCGWVRMGADLCGWV 133
            YGW+RMG DG  W+RMG DGYG + +  DG GWVRMG+D  GWV
Sbjct:   54 YGWIRMGTDGYGWIRMGTDGYGWIRMGTDGYGWVRMGSDGYGWV 97          

HSP 8 Score: 56.9954 bits (136), Expect = 4.420e-9
Identity = 28/45 (62.22%), Postives = 33/45 (73.33%), Query Frame = 1
Query:    1 VRMGTDGCGWVRMGADGYGWVWIGMDLCGWVRMGADGCGSVRMGV 135
            +RMGTDG GWVRM   GYGW+ +G D  GW+RMG DG G +RMG 
Sbjct:   37 LRMGTDGYGWVRMSTVGYGWIRMGTDGYGWIRMGTDGYGWIRMGT 81          

HSP 9 Score: 56.225 bits (134), Expect = 7.678e-9
Identity = 28/44 (63.64%), Postives = 32/44 (72.73%), Query Frame = 2
Query:    2 YGWVRMGADGCEWVRMGMDGYGSVWICVDGCGWVRMGADLCGWV 133
            YGW+RMG DG  W+RMG DGYG V +  DG GWVRMG D  GW+
Sbjct:   64 YGWIRMGTDGYGWIRMGTDGYGWVRMGSDGYGWVRMGTDGYGWI 107          

HSP 10 Score: 55.8398 bits (133), Expect = 9.574e-9
Identity = 28/45 (62.22%), Postives = 33/45 (73.33%), Query Frame = 1
Query:    1 VRMGTDGCGWVRMGADGYGWVWIGMDLCGWVRMGADGCGSVRMGV 135
            VR+GTDG GW+RMG DGYGWV +     GW+RMG DG G +RMG 
Sbjct:   27 VRIGTDGYGWLRMGTDGYGWVRMSTVGYGWIRMGTDGYGWIRMGT 71          

HSP 11 Score: 55.4546 bits (132), Expect = 1.205e-8
Identity = 28/43 (65.12%), Postives = 32/43 (74.42%), Query Frame = 3
Query:    3 TDGYGWVRMGANGCGWVWMGMDRYGSVWMGADGCGWVRICADG 131
            TDGYGW+RMG +G GWV MG D YG V MG DG GW+R+  DG
Sbjct:   71 TDGYGWIRMGTDGYGWVRMGSDGYGWVRMGTDGYGWIRMNTDG 113          

HSP 12 Score: 55.4546 bits (132), Expect = 1.309e-8
Identity = 28/43 (65.12%), Postives = 33/43 (76.74%), Query Frame = 3
Query:    3 TDGYGWVRMGANGCGWVWMGMDRYGSVWMGADGCGWVRICADG 131
            TDGYGW+RMG +G GW+ MG D YG V MG+DG GWVR+  DG
Sbjct:   61 TDGYGWIRMGTDGYGWIRMGTDGYGWVRMGSDGYGWVRMGTDG 103          

HSP 13 Score: 55.0694 bits (131), Expect = 1.805e-8
Identity = 27/44 (61.36%), Postives = 31/44 (70.45%), Query Frame = 2
Query:    2 YGWVRMGADGCEWVRMGMDGYGSVWICVDGCGWVRMGADLCGWV 133
            YGW+RMG DG  WVRMG DGYG V +  DG GW+RM  D  GW+
Sbjct:   74 YGWIRMGTDGYGWVRMGSDGYGWVRMGTDGYGWIRMNTDGYGWI 117          

HSP 14 Score: 53.9138 bits (128), Expect = 3.937e-8
Identity = 27/43 (62.79%), Postives = 32/43 (74.42%), Query Frame = 3
Query:    3 TDGYGWVRMGANGCGWVWMGMDRYGSVWMGADGCGWVRICADG 131
            TDGYGWVRMG++G GWV MG D YG + M  DG GW+R+  DG
Sbjct:   81 TDGYGWVRMGSDGYGWVRMGTDGYGWIRMNTDGYGWIRMGTDG 123          

HSP 15 Score: 53.1434 bits (126), Expect = 6.761e-8
Identity = 27/45 (60.00%), Postives = 32/45 (71.11%), Query Frame = 1
Query:    1 VRMGTDGCGWVRMGADGYGWVWIGMDLCGWVRMGADGCGSVRMGV 135
            +RM TDG GWVR+G DGYGW+ +G D  GWVRM   G G +RMG 
Sbjct:   17 LRMDTDGYGWVRIGTDGYGWLRMGTDGYGWVRMSTVGYGWIRMGT 61          

HSP 16 Score: 52.373 bits (124), Expect = 1.226e-7
Identity = 26/44 (59.09%), Postives = 31/44 (70.45%), Query Frame = 2
Query:    2 YGWVRMGADGCEWVRMGMDGYGSVWICVDGCGWVRMGADLCGWV 133
            YGWVR+G DG  W+RMG DGYG V +   G GW+RMG D  GW+
Sbjct:   24 YGWVRIGTDGYGWLRMGTDGYGWVRMSTVGYGWIRMGTDGYGWI 67          

HSP 17 Score: 51.6026 bits (122), Expect = 2.367e-7
Identity = 26/43 (60.47%), Postives = 30/43 (69.77%), Query Frame = 3
Query:    3 TDGYGWVRMGANGCGWVWMGMDRYGSVWMGADGCGWVRICADG 131
            TDGYGWVRM   G GW+ MG D YG + MG DG GW+R+  DG
Sbjct:   41 TDGYGWVRMSTVGYGWIRMGTDGYGWIRMGTDGYGWIRMGTDG 83          

HSP 18 Score: 51.6026 bits (122), Expect = 2.389e-7
Identity = 26/44 (59.09%), Postives = 30/44 (68.18%), Query Frame = 2
Query:    2 YGWVRMGADGCEWVRMGMDGYGSVWICVDGCGWVRMGADLCGWV 133
            YGWVRM   G  W+RMG DGYG + +  DG GW+RMG D  GWV
Sbjct:   44 YGWVRMSTVGYGWIRMGTDGYGWIRMGTDGYGWIRMGTDGYGWV 87          

HSP 19 Score: 51.6026 bits (122), Expect = 2.501e-7
Identity = 26/43 (60.47%), Postives = 32/43 (74.42%), Query Frame = 3
Query:    3 TDGYGWVRMGANGCGWVWMGMDRYGSVWMGADGCGWVRICADG 131
            T GYGW+RMG +G GW+ MG D YG + MG DG GWVR+ +DG
Sbjct:   51 TVGYGWIRMGTDGYGWIRMGTDGYGWIRMGTDGYGWVRMGSDG 93          

HSP 20 Score: 50.447 bits (119), Expect = 5.143e-7
Identity = 25/44 (56.82%), Postives = 30/44 (68.18%), Query Frame = 2
Query:    2 YGWVRMGADGCEWVRMGMDGYGSVWICVDGCGWVRMGADLCGWV 133
            YGW+RMG DG  WVRM   GYG + +  DG GW+RMG D  GW+
Sbjct:   34 YGWLRMGTDGYGWVRMSTVGYGWIRMGTDGYGWIRMGTDGYGWI 77          

HSP 21 Score: 49.2914 bits (116), Expect = 1.427e-6
Identity = 28/47 (59.57%), Postives = 31/47 (65.96%), Query Frame = 1
Query:    1 VRMGTDGC-GWVRMGADGYGWVWIGMDLCGWVRMGADGCGSVRMGVC 138
            +RM TDG  G +RM  DGYGWV IG D  GW+RMG DG G VRM   
Sbjct:    6 IRMETDGYDGRLRMDTDGYGWVRIGTDGYGWLRMGTDGYGWVRMSTV 52          

HSP 22 Score: 48.9062 bits (115), Expect = 1.650e-6
Identity = 25/43 (58.14%), Postives = 30/43 (69.77%), Query Frame = 3
Query:    3 TDGYGWVRMGANGCGWVWMGMDRYGSVWMGADGCGWVRICADG 131
            TDGYGW+RMG +G GWV M    YG + MG DG GW+R+  DG
Sbjct:   31 TDGYGWLRMGTDGYGWVRMSTVGYGWIRMGTDGYGWIRMGTDG 73          

HSP 23 Score: 48.1358 bits (113), Expect = 3.639e-6
Identity = 25/43 (58.14%), Postives = 30/43 (69.77%), Query Frame = 3
Query:    3 TDGYGWVRMGANGCGWVWMGMDRYGSVWMGADGCGWVRICADG 131
            TDGYGWVR+G +G GW+ MG D YG V M   G GW+R+  DG
Sbjct:   21 TDGYGWVRIGTDGYGWLRMGTDGYGWVRMSTVGYGWIRMGTDG 63          
BLAST of SMED30014423 vs. Planmine SMEST
Match: SMESG000038129.1 (SMESG000038129.1)

HSP 1 Score: 62.003 bits (149), Expect = 7.969e-11
Identity = 36/58 (62.07%), Postives = 41/58 (70.69%), Query Frame = -1
Query:    6 EPLVLKHFTHT-----PIRTDPHPSAPIRTHPHRSIPIHTHPYPSAPIRTHPHPSVPI 164
            EPLVLKHFTHT      IRTDPH S PI T P+RSIPI+T P  S P+ T P+ S+PI
Sbjct:  473 EPLVLKHFTHTNQRSIQIRTDPHKSIPIHTDPYRSIPINTGPCRSIPVHTGPYRSIPI 530          

HSP 2 Score: 51.2174 bits (121), Expect = 3.390e-7
Identity = 27/42 (64.29%), Postives = 30/42 (71.43%), Query Frame = -2
Query:    2 SAQIRTHPHPSAPIHTDPYRSIPIHTHPHPFAPIRTHPYPSV 127
            S QIRT PH S PIHTDPYRSIPI+T P    P+ T PY S+
Sbjct:  487 SIQIRTDPHKSIPIHTDPYRSIPINTGPCRSIPVHTGPYRSI 528          

HSP 3 Score: 48.521 bits (114), Expect = 2.820e-6
Identity = 25/39 (64.10%), Postives = 29/39 (74.36%), Query Frame = -2
Query:    2 IRTHPHPSAPIHTDPYRSIPIHTHPHPFAPIRTHPYPSV 118
            I T P+ S PIHTDPYRSIPIHT P+ + PI T PY S+
Sbjct:  530 IHTDPYRSIPIHTDPYRSIPIHTDPYRYIPIHTDPYRSI 568          

HSP 4 Score: 48.521 bits (114), Expect = 2.820e-6
Identity = 25/39 (64.10%), Postives = 29/39 (74.36%), Query Frame = -2
Query:    2 IRTHPHPSAPIHTDPYRSIPIHTHPHPFAPIRTHPYPSV 118
            I T P+ S PIHTDPYRSIPIHT P+ + PI T PY S+
Sbjct:  650 IHTDPYRSIPIHTDPYRSIPIHTDPYRYIPIHTDPYRSI 688          

HSP 5 Score: 48.1358 bits (113), Expect = 3.116e-6
Identity = 26/46 (56.52%), Postives = 32/46 (69.57%), Query Frame = -1
Query:    6 FTHTPIRTDPHPSAPIRTHPHRSIPIHTHPYPSAPIRTHPHPSVPI 143
            + + PI TDP+ S PI T P+RSIPIHT PY   PI T P+ S+PI
Sbjct:  645 YRYIPIHTDPYRSIPIHTDPYRSIPIHTDPYRYIPIHTDPYRSIPI 690          
BLAST of SMED30014423 vs. Planmine SMEST
Match: SMESG000038129.1 (SMESG000038129.1)

HSP 1 Score: 48.521 bits (114), Expect = 2.729e-6
Identity = 25/39 (64.10%), Postives = 29/39 (74.36%), Query Frame = -2
Query:    2 IRTHPHPSAPIHTDPYRSIPIHTHPHPFAPIRTHPYPSV 118
            I T P+ S PIHTDPYRSIPIHT P+ + PI T PY S+
Sbjct:  510 IHTDPYRSIPIHTDPYRSIPIHTDPYRYIPIHTDPYRSI 548          

HSP 2 Score: 48.521 bits (114), Expect = 2.729e-6
Identity = 25/39 (64.10%), Postives = 29/39 (74.36%), Query Frame = -2
Query:    2 IRTHPHPSAPIHTDPYRSIPIHTHPHPFAPIRTHPYPSV 118
            I T P+ S PIHTDPYRSIPIHT P+ + PI T PY S+
Sbjct:  630 IHTDPYRSIPIHTDPYRSIPIHTDPYRYIPIHTDPYRSI 668          

HSP 3 Score: 48.1358 bits (113), Expect = 3.155e-6
Identity = 26/42 (61.90%), Postives = 30/42 (71.43%), Query Frame = -1
Query:    6 PIRTDPHPSAPIRTHPHRSIPIHTHPYPSAPIRTHPHPSVPI 131
            PI TDP+ S PI T P RSIP+HT PY S PI T P+ S+PI
Sbjct:  479 PIHTDPYRSIPINTGPCRSIPVHTGPYRSIPIHTDPYRSIPI 520          

HSP 4 Score: 47.7506 bits (112), Expect = 4.787e-6
Identity = 26/46 (56.52%), Postives = 32/46 (69.57%), Query Frame = -1
Query:    6 FTHTPIRTDPHPSAPIRTHPHRSIPIHTHPYPSAPIRTHPHPSVPI 143
            + + PI TDP+ S PI T P+RSIPIHT PY   PI T P+ S+PI
Sbjct:  625 YRYIPIHTDPYRSIPIHTDPYRSIPIHTDPYRYIPIHTDPYRSIPI 670          

HSP 5 Score: 46.9802 bits (110), Expect = 8.467e-6
Identity = 26/42 (61.90%), Postives = 30/42 (71.43%), Query Frame = -1
Query:    6 PIRTDPHPSAPIRTHPHRSIPIHTHPYPSAPIRTHPHPSVPI 131
            PI TDP+ S PI T P+RSIPIHT PY   PI T P+ S+PI
Sbjct:  509 PIHTDPYRSIPIHTDPYRSIPIHTDPYRYIPIHTDPYRSIPI 550          
The following BLAST results are available for this feature:
BLAST of SMED30014423 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014423 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014423 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014423 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014423 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014423 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014423 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014423 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014423 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014423 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014423 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014423 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO403014.211e-646.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30014423 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014423 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000046838.12.996e-1168.89SMESG000046838.1[more]
SMESG000038129.17.969e-1162.07SMESG000038129.1[more]
SMESG000038129.12.729e-664.10SMESG000038129.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014423 ID=SMED30014423|Name=SMED30014423|organism=Schmidtea mediterranea sexual|type=transcript|length=764bp
GTACGGATGGGTACGGATGGGTGCGGATGGGTGCGAATGGGTGCGGATGG
GTATGGATGGGTATGGATCGGTATGGATCTGTGTGGATGGGTGCGGATGG
GTGCGGATGGGTGCGGATCTGTGCGGATGGGTGTGTGTGTGAAATGTTTA
AGAACCAAAGGTTCTAGAAGGTAGGTGTGTGGAAGATACGCCTAACGATG
AAGACAATGACAATCAACAATAAAACAACGAAAAGAAAGAAATCGGCAAG
GAAAAGAAAGCTAACGGATGTAACAACAATAAAAACTATAGAAACAACAA
AAACGAAAACAAAAAGACGAAATATGGAAAACGCACTGTATGCCTACCGT
AAATAGAAATAAATTTGAAAAATAATATGATACCAACAACTGGGAGATTA
ACCTTAGCTCAACAGCGAGTAACAATCAATAAGAGAGAAAGAGAAAGTAT
ACGAATATATATAGCAAATGAATATAACAAATATCAACGGTCAGACAATA
AATCAAATATGCATAGCAAGAATTGAACGAGATGAATGACTTATCGTAAT
ATGGAAGCGACTATGTATGAGAGAAATGTCATTCAAAACAAAAGTATTAC
AATATCATTTCTGCGAACTCAAAAAGGATCATAAAAATAAAACAAATAAC
CTAACTTCAAAAAAAAAAAAAAATATTACGTATGTGACGAACAGGATGAT
GATAAAAATGCAATAACAAGATAACCAATCGTAGAATACAACGAAACAAC
CAAATAAATATTAT
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002032epidermal cell
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process