Protein FAM32A

Overview
NameProtein FAM32A
Smed IDSMED30014415
Length (bp)453
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein FAM32A (SMED30014415) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein FAM32A (SMED30014415) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein FAM32A (SMED30014415) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein FAM32A (SMED30014415) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014415

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014415 SmedASXL_002995SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30014415 dd_Smed_v4_1341_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014415 dd_Smed_v4_1341_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014415 dd_Smed_v4_1341_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014415 dd_Smed_v4_1341_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014415 dd_Smed_v4_1341_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014415 dd_Smed_v4_1341_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein FAM32A vs. Ensembl Human
Match: FAM32A (family with sequence similarity 32 member A [Source:HGNC Symbol;Acc:HGNC:24563])

HSP 1 Score: 55.8398 bits (133), Expect = 3.037e-10
Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  244 TEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            T AQ  F +  +KR +E    K   ++K R+  FNR LDTL+EH+DI KVSWTK
Sbjct:   59 TPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK 112          
BLAST of Protein FAM32A vs. Ensembl Human
Match: FAM32A (family with sequence similarity 32 member A [Source:HGNC Symbol;Acc:HGNC:24563])

HSP 1 Score: 54.6842 bits (130), Expect = 4.416e-10
Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  244 TEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            T AQ  F +  +KR +E    K   ++K R+  FNR LDTL+EH+DI KVSWTK
Sbjct:   39 TPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK 92          
BLAST of Protein FAM32A vs. Ensembl Fly
Match: CG15432 (gene:FBgn0031603 transcript:FBtr0331434)

HSP 1 Score: 48.1358 bits (113), Expect = 1.174e-7
Identity = 28/64 (43.75%), Postives = 43/64 (67.19%), Query Frame = 1
Query:  214 YKTNSDKAELTEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            Y+    KAEL  ++K+  +   KR++    +K + ++K+R+ +FN  LDTL+EHFDI KVSWTK
Sbjct:   60 YERKLTKAELA-SKKQQEKMRNKRIM----DKAQTTHKERVEKFNEHLDTLTEHFDIPKVSWTK 118          
BLAST of Protein FAM32A vs. Ensembl Fly
Match: CG15432 (gene:FBgn0031603 transcript:FBtr0077438)

HSP 1 Score: 48.1358 bits (113), Expect = 1.174e-7
Identity = 28/64 (43.75%), Postives = 43/64 (67.19%), Query Frame = 1
Query:  214 YKTNSDKAELTEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            Y+    KAEL  ++K+  +   KR++    +K + ++K+R+ +FN  LDTL+EHFDI KVSWTK
Sbjct:   60 YERKLTKAELA-SKKQQEKMRNKRIM----DKAQTTHKERVEKFNEHLDTLTEHFDIPKVSWTK 118          
BLAST of Protein FAM32A vs. Ensembl Fly
Match: CG15432 (gene:FBgn0031603 transcript:FBtr0331435)

HSP 1 Score: 48.1358 bits (113), Expect = 1.174e-7
Identity = 28/64 (43.75%), Postives = 43/64 (67.19%), Query Frame = 1
Query:  214 YKTNSDKAELTEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            Y+    KAEL  ++K+  +   KR++    +K + ++K+R+ +FN  LDTL+EHFDI KVSWTK
Sbjct:   60 YERKLTKAELA-SKKQQEKMRNKRIM----DKAQTTHKERVEKFNEHLDTLTEHFDIPKVSWTK 118          
BLAST of Protein FAM32A vs. Ensembl Zebrafish
Match: fam32a (family with sequence similarity 32 member A [Source:NCBI gene;Acc:431750])

HSP 1 Score: 53.9138 bits (128), Expect = 7.224e-10
Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  244 TEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            T AQ  F +  +KR +E    K   ++K R+  FNR LDTL+EH+DI KVSWTK
Sbjct:   56 TPAQMAFDKIQEKRQMERILKKASKTHKRRVEDFNRHLDTLTEHYDIPKVSWTK 109          
BLAST of Protein FAM32A vs. Ensembl Zebrafish
Match: fam32a (family with sequence similarity 32 member A [Source:NCBI gene;Acc:431750])

HSP 1 Score: 54.299 bits (129), Expect = 7.228e-10
Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  244 TEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            T AQ  F +  +KR +E    K   ++K R+  FNR LDTL+EH+DI KVSWTK
Sbjct:   57 TPAQMAFDKIQEKRQMERILKKASKTHKRRVEDFNRHLDTLTEHYDIPKVSWTK 110          
BLAST of Protein FAM32A vs. Ensembl Xenopus
Match: rps9 (ribosomal protein S9 [Source:Xenbase;Acc:XB-GENE-5930153])

HSP 1 Score: 54.6842 bits (130), Expect = 5.708e-10
Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  244 TEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            T AQ  F +  +KR +E    K   ++K R+  FNR LDTL+EH+DI KVSWTK
Sbjct:   59 TPAQLAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK 112          
BLAST of Protein FAM32A vs. Ensembl Mouse
Match: Fam32a (family with sequence similarity 32, member A [Source:MGI Symbol;Acc:MGI:1915172])

HSP 1 Score: 55.8398 bits (133), Expect = 1.856e-10
Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  244 TEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            T AQ  F +  +KR +E    K   ++K R+  FNR LDTL+EH+DI KVSWTK
Sbjct:   59 TPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK 112          
BLAST of Protein FAM32A vs. UniProt/SwissProt
Match: sp|Q9CR80|FA32A_MOUSE (Protein FAM32A OS=Mus musculus OX=10090 GN=Fam32a PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.298e-9
Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  244 TEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            T AQ  F +  +KR +E    K   ++K R+  FNR LDTL+EH+DI KVSWTK
Sbjct:   59 TPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK 112          
BLAST of Protein FAM32A vs. UniProt/SwissProt
Match: sp|B2RYG1|FA32A_RAT (Protein FAM32A OS=Rattus norvegicus OX=10116 GN=Fam32a PE=3 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.369e-9
Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  244 TEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            T AQ  F +  +KR +E    K   ++K R+  FNR LDTL+EH+DI KVSWTK
Sbjct:   59 TPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK 112          
BLAST of Protein FAM32A vs. UniProt/SwissProt
Match: sp|Q5R9E5|FA32A_PONAB (Protein FAM32A OS=Pongo abelii OX=9601 GN=FAM32A PE=3 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.458e-9
Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  244 TEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            T AQ  F +  +KR +E    K   ++K R+  FNR LDTL+EH+DI KVSWTK
Sbjct:   59 TPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK 112          
BLAST of Protein FAM32A vs. UniProt/SwissProt
Match: sp|Q9Y421|FA32A_HUMAN (Protein FAM32A OS=Homo sapiens OX=9606 GN=FAM32A PE=1 SV=2)

HSP 1 Score: 55.8398 bits (133), Expect = 1.458e-9
Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  244 TEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            T AQ  F +  +KR +E    K   ++K R+  FNR LDTL+EH+DI KVSWTK
Sbjct:   59 TPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK 112          
BLAST of Protein FAM32A vs. UniProt/SwissProt
Match: sp|A6QR31|FA32A_BOVIN (Protein FAM32A OS=Bos taurus OX=9913 GN=FAM32A PE=3 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 1.458e-9
Identity = 27/54 (50.00%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  244 TEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            T AQ  F +  +KR +E    K   ++K R+  FNR LDTL+EH+DI KVSWTK
Sbjct:   59 TPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK 112          
BLAST of Protein FAM32A vs. TrEMBL
Match: A0A443SHD0 (Protein FAM32A-like protein (Fragment) OS=Leptotrombidium deliense OX=299467 GN=B4U80_05145 PE=4 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 5.459e-11
Identity = 33/70 (47.14%), Postives = 48/70 (68.57%), Query Frame = 1
Query:  196 TSEPDEYKTNSDKAELTEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            +SE  + +  S+K ELT+AQ+ F +  +KR +E    K   S+K R+ +FNR+LD L+EH+DI KVSWTK
Sbjct:    7 SSELKDVQKQSEKIELTKAQQSFLKMQEKRQMERVMEKATKSHKQRVEEFNRQLDCLTEHYDIPKVSWTK 76          
BLAST of Protein FAM32A vs. TrEMBL
Match: A0A4S2MBE2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001310 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 6.122e-11
Identity = 35/72 (48.61%), Postives = 49/72 (68.06%), Query Frame = 1
Query:  193 ETSEPDEYKTN-SDKAELTEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            E SEP+  K   S++  LT+AQK+  +   KR++E   +K   S+K R+ +FN  L+TL+EHFDIQKVSWTK
Sbjct:   46 EGSEPNSEKPKLSERGHLTKAQKELERRKDKRMLETVLSKAVKSHKQRIIEFNNHLETLTEHFDIQKVSWTK 117          
BLAST of Protein FAM32A vs. TrEMBL
Match: A0A074ZD45 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_07286 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 8.134e-11
Identity = 35/72 (48.61%), Postives = 50/72 (69.44%), Query Frame = 1
Query:  193 ETSEPDEYKTN-SDKAELTEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            E SEP+  K   S+++ LT+AQK+  +   KR++E   +K   S+K R+ +FN  L+TL+EHFDIQKVSWTK
Sbjct:   40 EGSEPNTQKPKLSERSHLTKAQKELERRKDKRMLETVLSKAVKSHKQRIIEFNNHLETLTEHFDIQKVSWTK 111          
BLAST of Protein FAM32A vs. TrEMBL
Match: A0A1S8X534 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=X801_02265 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 9.286e-11
Identity = 35/72 (48.61%), Postives = 50/72 (69.44%), Query Frame = 1
Query:  193 ETSEPDEYKTN-SDKAELTEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            E SEP+  K   S+++ LT+AQK+  +   KR++E   +K   S+K R+ +FN  L+TL+EHFDIQKVSWTK
Sbjct:   46 EGSEPNTQKPKLSERSHLTKAQKELERRKDKRMLETVLSKAVKSHKQRIIEFNNHLETLTEHFDIQKVSWTK 117          
BLAST of Protein FAM32A vs. TrEMBL
Match: A0A183AR00 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS9387 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 7.995e-10
Identity = 30/59 (50.85%), Postives = 45/59 (76.27%), Query Frame = 1
Query:  229 DKAELTEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            D++ LT+AQ+++ +  +KR+VEN  +K   S+K R+ + N  L+TL+EHFDIQKVSWTK
Sbjct:   64 DQSHLTKAQREWEKRREKRIVENALSKAVKSHKQRIIELNNHLETLTEHFDIQKVSWTK 122          
BLAST of Protein FAM32A vs. Ensembl Cavefish
Match: fam32a (family with sequence similarity 32 member A [Source:NCBI gene;Acc:431750])

HSP 1 Score: 42.743 bits (99), Expect = 8.136e-6
Identity = 17/22 (77.27%), Postives = 20/22 (90.91%), Query Frame = 1
Query:  340 QFNRKLDTLSEHFDIQKVSWTK 405
            +FNR LDTL+EH+DI KVSWTK
Sbjct:   66 EFNRHLDTLTEHYDIPKVSWTK 87          
BLAST of Protein FAM32A vs. Ensembl Nematostella
Match: EDO36147 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJE7])

HSP 1 Score: 53.1434 bits (126), Expect = 5.841e-10
Identity = 26/54 (48.15%), Postives = 35/54 (64.81%), Query Frame = 1
Query:  244 TEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            T AQK + +  +KR  E    K E ++K R+ +FN  LD L+EH+DI KVSWTK
Sbjct:   62 TPAQKAYDRLQEKRAAERILKKAEKTHKQRVEKFNEYLDELTEHYDIPKVSWTK 115          
BLAST of Protein FAM32A vs. Ensembl Medaka
Match: fam32a (family with sequence similarity 32 member A [Source:NCBI gene;Acc:101159813])

HSP 1 Score: 53.5286 bits (127), Expect = 1.275e-9
Identity = 33/73 (45.21%), Postives = 45/73 (61.64%), Query Frame = 1
Query:  196 TSEPDEYKTNSDKAEL---TEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            TS+ DE +T + KA +   T AQ  F +  +KR +E    K   ++K R+  FNR LD L+EH+DI KVSWTK
Sbjct:   43 TSQNDE-ETKAKKAYVDKRTPAQIAFDKMQEKRQMERILKKASKTHKHRVEDFNRHLDALTEHYDIPKVSWTK 114          
BLAST of Protein FAM32A vs. Planmine SMEST
Match: SMESG000034920.1 (SMESG000034920.1)

HSP 1 Score: 182.956 bits (463), Expect = 1.164e-60
Identity = 108/108 (100.00%), Postives = 108/108 (100.00%), Query Frame = 1
Query:   82 MSDPYTQYTPXXXXXXXXXXXXXXXNAIEKHLEESNKETSEPDEYKTNSDKAELTEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            MSDPYTQYTPGKIKLKKKKGGKKLKNAIEKHLEESNKETSEPDEYKTNSDKAELTEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK
Sbjct:    1 MSDPYTQYTPGKIKLKKKKGGKKLKNAIEKHLEESNKETSEPDEYKTNSDKAELTEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 108          
BLAST of Protein FAM32A vs. Planmine SMEST
Match: SMESG000043038.1 (SMESG000043038.1)

HSP 1 Score: 48.9062 bits (115), Expect = 5.065e-8
Identity = 26/56 (46.43%), Postives = 39/56 (69.64%), Query Frame = 1
Query:  241 LTEAQKKFRQT-TQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            +T+ +K+   T   +RL  N+DN  ELSYK+++++FN KL  +SE  DI K+SWTK
Sbjct:   61 MTDTEKQLYLTQNDRRLKRNYDN--ELSYKEKIAKFNIKLGNMSEINDIPKISWTK 114          
BLAST of Protein FAM32A vs. Planmine SMEST
Match: SMESG000016566.1 (SMESG000016566.1)

HSP 1 Score: 48.9062 bits (115), Expect = 5.065e-8
Identity = 26/56 (46.43%), Postives = 39/56 (69.64%), Query Frame = 1
Query:  241 LTEAQKKFRQT-TQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFDIQKVSWTK 405
            +T+ +K+   T   +RL  N+DN  ELSYK+++++FN KL  +SE  DI K+SWTK
Sbjct:   61 MTDTEKQLYLTQNDRRLKRNYDN--ELSYKEKIAKFNIKLGNMSEINDIPKISWTK 114          
The following BLAST results are available for this feature:
BLAST of Protein FAM32A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
FAM32A3.037e-1050.00family with sequence similarity 32 member A [Sourc... [more]
FAM32A4.416e-1050.00family with sequence similarity 32 member A [Sourc... [more]
back to top
BLAST of Protein FAM32A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM32A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG154321.174e-743.75gene:FBgn0031603 transcript:FBtr0331434[more]
CG154321.174e-743.75gene:FBgn0031603 transcript:FBtr0077438[more]
CG154321.174e-743.75gene:FBgn0031603 transcript:FBtr0331435[more]
back to top
BLAST of Protein FAM32A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fam32a7.224e-1050.00family with sequence similarity 32 member A [Sourc... [more]
fam32a7.228e-1050.00family with sequence similarity 32 member A [Sourc... [more]
back to top
BLAST of Protein FAM32A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps95.708e-1050.00ribosomal protein S9 [Source:Xenbase;Acc:XB-GENE-5... [more]
back to top
BLAST of Protein FAM32A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Fam32a1.856e-1050.00family with sequence similarity 32, member A [Sour... [more]
back to top
BLAST of Protein FAM32A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CR80|FA32A_MOUSE1.298e-950.00Protein FAM32A OS=Mus musculus OX=10090 GN=Fam32a ... [more]
sp|B2RYG1|FA32A_RAT1.369e-950.00Protein FAM32A OS=Rattus norvegicus OX=10116 GN=Fa... [more]
sp|Q5R9E5|FA32A_PONAB1.458e-950.00Protein FAM32A OS=Pongo abelii OX=9601 GN=FAM32A P... [more]
sp|Q9Y421|FA32A_HUMAN1.458e-950.00Protein FAM32A OS=Homo sapiens OX=9606 GN=FAM32A P... [more]
sp|A6QR31|FA32A_BOVIN1.458e-950.00Protein FAM32A OS=Bos taurus OX=9913 GN=FAM32A PE=... [more]
back to top
BLAST of Protein FAM32A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443SHD05.459e-1147.14Protein FAM32A-like protein (Fragment) OS=Leptotro... [more]
A0A4S2MBE26.122e-1148.61Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074ZD458.134e-1148.61Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A1S8X5349.286e-1148.61Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A183AR007.995e-1050.85Uncharacterized protein OS=Echinostoma caproni OX=... [more]
back to top
BLAST of Protein FAM32A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam32a8.136e-677.27family with sequence similarity 32 member A [Sourc... [more]
back to top
BLAST of Protein FAM32A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM32A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein FAM32A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO361475.841e-1048.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein FAM32A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fam32a1.275e-945.21family with sequence similarity 32 member A [Sourc... [more]
back to top
BLAST of Protein FAM32A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000034920.11.164e-60100.00SMESG000034920.1[more]
SMESG000043038.15.065e-846.43SMESG000043038.1[more]
SMESG000016566.15.065e-846.43SMESG000016566.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014415 ID=SMED30014415|Name=Protein FAM32A|organism=Schmidtea mediterranea sexual|type=transcript|length=453bp
AAATAATTTTCTTGGAGATTTCAAATTTTCGATGTATTACTTTAGTTTAA
ATGAATTAAATGAAATAACAAAATTTTCAAAATGAGCGATCCGTACACAC
AGTATACGCCAGGAAAAATTAAACTAAAGAAGAAAAAAGGAGGAAAAAAA
TTAAAAAATGCAATTGAAAAGCATTTGGAAGAATCTAATAAAGAAACTAG
TGAGCCAGATGAATATAAAACAAATAGCGATAAAGCTGAATTAACTGAAG
CTCAAAAAAAATTTAGACAAACAACTCAAAAAAGGCTTGTTGAAAATTTT
GATAACAAAAAGGAATTATCATACAAAGACAGACTTAGTCAATTTAACCG
AAAATTAGATACTTTAAGCGAACATTTTGATATACAGAAGGTTTCGTGGA
CCAAATAAGCGTGTTAAAAGTTTTGTTTAATAAAAGTTATTCATAAAAAA
AAA
back to top

protein sequence of SMED30014415-orf-1

>SMED30014415-orf-1 ID=SMED30014415-orf-1|Name=SMED30014415-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=109bp
MSDPYTQYTPGKIKLKKKKGGKKLKNAIEKHLEESNKETSEPDEYKTNSD
KAELTEAQKKFRQTTQKRLVENFDNKKELSYKDRLSQFNRKLDTLSEHFD
IQKVSWTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR013865FAM32A
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
Vocabulary: biological process
TermDefinition
GO:0006915apoptotic process
GO:0007049cell cycle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..51
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 26..51
NoneNo IPR availablePANTHERPTHR13282:SF6PROTEIN FAM32Acoord: 4..106
IPR013865Protein FAM32APANTHERPTHR13282UNCHARACTERIZEDcoord: 4..106