Forkhead box J1

Overview
NameForkhead box J1
Smed IDSMED30014407
Length (bp)2464
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Forkhead box J1 (SMED30014407) t-SNE clustered cells

Violin plots show distribution of expression levels for Forkhead box J1 (SMED30014407) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Forkhead box J1 (SMED30014407) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Forkhead box J1 (SMED30014407) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014407

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014407SMESG000017088.1 SmedASXL_009037SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30014407SMESG000062900.1 SMESG000017088.1 dd_Smed_v6_491_1_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30014407SMESG000017088.1 dd_Smed_v6_13009_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30014407SMESG000017088.1 DN295231ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30014407SMESG000017088.1 DN295231ncbi_smed_estsPMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30014407SMESG000017088.1 dd_Smed_v4_13009_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30014407SMESG000017088.1 dd_Smed_v4_13009_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30014407SMESG000017088.1 dd_Smed_v4_13009_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014407SMESG000062900.1 SMESG000017088.1 dd_Smed_v4_491_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30014407SMESG000062900.1 SMESG000017088.1 dd_Smed_v4_491_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30014407SMESG000062900.1 SMESG000017088.1 dd_Smed_v4_491_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Forkhead box J1 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 78.9518 bits (193), Expect = 7.917e-17
Identity = 35/74 (47.30%), Postives = 51/74 (68.92%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGF 838
            +PP+S  +LI+ AI+S  K K++  EI QWI + FPYY+     WK  I+++L+L+KCF KVPR +D+  K GF
Sbjct:   35 KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKVGF 108          
BLAST of Forkhead box J1 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 84.3445 bits (207), Expect = 1.166e-16
Identity = 35/75 (46.67%), Postives = 52/75 (69.33%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW 841
            +PP+S  +LI+ AI+S  K K++  EI QWI + FPYY+     WK  I+++L+L+KCF KVPR +D+  KG +W
Sbjct:   78 KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYW 152          
BLAST of Forkhead box J1 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 84.3445 bits (207), Expect = 3.315e-16
Identity = 35/77 (45.45%), Postives = 52/77 (67.53%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF 847
            +PP+S  +LI+ AI+S  K K++  EI QWI + FPYY+     WK  I+++L+L+KCF KVPR +D+  KG +W  
Sbjct:   78 KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 154          
BLAST of Forkhead box J1 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 84.3445 bits (207), Expect = 3.427e-16
Identity = 35/77 (45.45%), Postives = 52/77 (67.53%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF 847
            +PP+S  +LI+ AI+S  K K++  EI QWI + FPYY+     WK  I+++L+L+KCF KVPR +D+  KG +W  
Sbjct:   78 KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 154          
BLAST of Forkhead box J1 vs. Ensembl Human
Match: FOXJ3 (forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178])

HSP 1 Score: 84.3445 bits (207), Expect = 3.427e-16
Identity = 35/77 (45.45%), Postives = 52/77 (67.53%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF 847
            +PP+S  +LI+ AI+S  K K++  EI QWI + FPYY+     WK  I+++L+L+KCF KVPR +D+  KG +W  
Sbjct:   78 KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 154          
BLAST of Forkhead box J1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 75.0998 bits (183), Expect = 7.373e-14
Identity = 38/98 (38.78%), Postives = 55/98 (56.12%), Query Frame = 2
Query:  608 NQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF----SNEFLN--YLERNR 883
             Q +PP+S I+LI+MAI   N  +++  EI  WI + FPYY++    W+  I++ L+ + CF KV R  D+  KG FW       N F N  YL R +
Sbjct:  169 GQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQK 266          
BLAST of Forkhead box J1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 74.7146 bits (182), Expect = 7.555e-14
Identity = 38/98 (38.78%), Postives = 55/98 (56.12%), Query Frame = 2
Query:  608 NQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF----SNEFLN--YLERNR 883
             Q +PP+S I+LI+MAI   N  +++  EI  WI + FPYY++    W+  I++ L+ + CF KV R  D+  KG FW       N F N  YL R +
Sbjct:  138 GQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQK 235          
BLAST of Forkhead box J1 vs. Ensembl Celegans
Match: pha-4 (Defective pharyngeal development protein 4 [Source:UniProtKB/Swiss-Prot;Acc:Q17381])

HSP 1 Score: 74.7146 bits (182), Expect = 1.167e-13
Identity = 38/98 (38.78%), Postives = 55/98 (56.12%), Query Frame = 2
Query:  608 NQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF----SNEFLN--YLERNR 883
             Q +PP+S I+LI+MAI   N  +++  EI  WI + FPYY++    W+  I++ L+ + CF KV R  D+  KG FW       N F N  YL R +
Sbjct:  233 GQSKPPYSYISLITMAIQKSNSRQLTLSEIYNWIMDLFPYYQNNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSFWTLHEHCGNMFENGCYLRRQK 330          
BLAST of Forkhead box J1 vs. Ensembl Celegans
Match: fkh-7 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:V6CLW4])

HSP 1 Score: 64.3142 bits (155), Expect = 5.748e-11
Identity = 29/83 (34.94%), Postives = 50/83 (60.24%), Query Frame = 2
Query:  593 FFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW 841
            F+R N+ +RPP++  +LI  AI   +  +++  EI  W  ETF Y++  +  WK  ++++L+L KCFQ+V    ++  KG  W
Sbjct:   73 FYRTND-VRPPYTYASLIRQAIMESSDCQLTLNEIYTWFTETFAYFRRNAATWKNAVRHNLSLHKCFQRV----EQNVKGAVW 150          
BLAST of Forkhead box J1 vs. Ensembl Celegans
Match: fkh-7 (ForKHead transcription factor family [Source:UniProtKB/TrEMBL;Acc:V6CLW4])

HSP 1 Score: 64.3142 bits (155), Expect = 6.975e-11
Identity = 29/83 (34.94%), Postives = 50/83 (60.24%), Query Frame = 2
Query:  593 FFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW 841
            F+R N+ +RPP++  +LI  AI   +  +++  EI  W  ETF Y++  +  WK  ++++L+L KCFQ+V    ++  KG  W
Sbjct:   73 FYRTND-VRPPYTYASLIRQAIMESSDCQLTLNEIYTWFTETFAYFRRNAATWKNAVRHNLSLHKCFQRV----EQNVKGAVW 150          
BLAST of Forkhead box J1 vs. Ensembl Fly
Match: fd96Ca (gene:FBgn0004897 transcript:FBtr0339246)

HSP 1 Score: 68.5514 bits (166), Expect = 6.669e-12
Identity = 29/86 (33.72%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLE 874
            +PP+S I+L +MAI S  +  +   +I ++I + FPYY+  +  W+  ++++L+ + CF KVPRR D   KG +W    +  +  E
Sbjct:   13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFE 98          
BLAST of Forkhead box J1 vs. Ensembl Fly
Match: fd96Ca (gene:FBgn0004897 transcript:FBtr0084770)

HSP 1 Score: 68.5514 bits (166), Expect = 6.669e-12
Identity = 29/86 (33.72%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLE 874
            +PP+S I+L +MAI S  +  +   +I ++I + FPYY+  +  W+  ++++L+ + CF KVPRR D   KG +W    +  +  E
Sbjct:   13 KPPYSYISLTAMAIWSSPEKMLPLSDIYKFITDRFPYYRKNTQRWQNSLRHNLSFNDCFIKVPRRPDRPGKGAYWALHPQAFDMFE 98          
BLAST of Forkhead box J1 vs. Ensembl Fly
Match: croc (gene:FBgn0014143 transcript:FBtr0078395)

HSP 1 Score: 69.3218 bits (168), Expect = 7.133e-12
Identity = 32/84 (38.10%), Postives = 50/84 (59.52%), Query Frame = 2
Query:  614 LRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLN 865
            ++PP+S I LI+MAI +    KV+   I Q+I E FPYY+     W+  I+++L+L++CF KV R   +  KG +W    +  N
Sbjct:   69 VKPPYSYIALIAMAIQNAADKKVTLNGIYQYIMERFPYYRDNKQGWQNSIRHNLSLNECFVKVARDDKKPGKGSYWTLDPDSYN 152          
BLAST of Forkhead box J1 vs. Ensembl Fly
Match: fd59A (gene:FBgn0004896 transcript:FBtr0071898)

HSP 1 Score: 68.9366 bits (167), Expect = 9.434e-12
Identity = 32/76 (42.11%), Postives = 45/76 (59.21%), Query Frame = 2
Query:  614 LRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW 841
            ++PP+S I LI+MAI      K++   IC +I   FPYYK     W+  I+++L+L+ CF KVPR      KG FW
Sbjct:   84 VKPPYSYIALITMAILQSPHKKLTLSGICDFIMSRFPYYKDKFPAWQNSIRHNLSLNDCFIKVPREPGNPGKGNFW 159          
BLAST of Forkhead box J1 vs. Ensembl Fly
Match: fkh (gene:FBgn0000659 transcript:FBtr0346765)

HSP 1 Score: 68.9366 bits (167), Expect = 9.643e-12
Identity = 36/103 (34.95%), Postives = 56/103 (54.37%), Query Frame = 2
Query:  593 FFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF----SNEFLN--YLERNR 883
            + R     +PP+S I+LI+MAI +     ++  EI Q+I + FP+Y+     W+  I++ L+ + CF K+PR  D+  KG FW       N F N  YL R +
Sbjct:  202 YRRSYTHAKPPYSYISLITMAIQNNPTRMLTLSEIYQFIMDLFPFYRQNQQRWQNSIRHSLSFNDCFVKIPRTPDKPGKGSFWTLHPDSGNMFENGCYLRRQK 304          
BLAST of Forkhead box J1 vs. Ensembl Zebrafish
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 90.8929 bits (224), Expect = 9.660e-19
Identity = 41/112 (36.61%), Postives = 69/112 (61.61%), Query Frame = 2
Query:  596 FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW----RFSNEFLNYLERNRIQTLSGVNFDNR 919
            ++ N  ++PP+S   LI MA+ + NK K++   I  WI E F YY+     W+  I+++L+L+KCF KVPR++DE  KGGFW    ++++ F+N + + R   +   NF+ +
Sbjct:  132 YKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNLSLNKCFMKVPRQKDEPGKGGFWQIDPQYADMFVNGVFKRR--RMPATNFNTQ 241          
BLAST of Forkhead box J1 vs. Ensembl Zebrafish
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 90.8929 bits (224), Expect = 9.660e-19
Identity = 41/112 (36.61%), Postives = 69/112 (61.61%), Query Frame = 2
Query:  596 FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW----RFSNEFLNYLERNRIQTLSGVNFDNR 919
            ++ N  ++PP+S   LI MA+ + NK K++   I  WI E F YY+     W+  I+++L+L+KCF KVPR++DE  KGGFW    ++++ F+N + + R   +   NF+ +
Sbjct:  132 YKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNLSLNKCFMKVPRQKDEPGKGGFWQIDPQYADMFVNGVFKRR--RMPATNFNTQ 241          
BLAST of Forkhead box J1 vs. Ensembl Zebrafish
Match: foxj1a (forkhead box J1a [Source:NCBI gene;Acc:767737])

HSP 1 Score: 86.6557 bits (213), Expect = 2.677e-17
Identity = 46/149 (30.87%), Postives = 79/149 (53.02%), Query Frame = 2
Query:  440 HQMTMPSPQFPLSMNPMNQLNRIIPQYFESSSLYAEVAMNLEFMNDEASVHF-----FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYL 871
            H M   +P  PL+ +P +    + P    ++S +  V M     +  A  H      ++ N  ++PP+S   LI MA+ +  K K++   I +WI + F Y++     W+  I+++L+L+KCF KVPR++DE  KGGFW+   ++   L
Sbjct:   79 HLMGSDAPSSPLAGDPASIGMPLTPGKPTAAS-FCRVPMFSALPSLVAHGHCPDEVDYKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERL 226          
BLAST of Forkhead box J1 vs. Ensembl Zebrafish
Match: foxj1a (forkhead box J1a [Source:NCBI gene;Acc:767737])

HSP 1 Score: 86.6557 bits (213), Expect = 2.677e-17
Identity = 46/149 (30.87%), Postives = 79/149 (53.02%), Query Frame = 2
Query:  440 HQMTMPSPQFPLSMNPMNQLNRIIPQYFESSSLYAEVAMNLEFMNDEASVHF-----FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYL 871
            H M   +P  PL+ +P +    + P    ++S +  V M     +  A  H      ++ N  ++PP+S   LI MA+ +  K K++   I +WI + F Y++     W+  I+++L+L+KCF KVPR++DE  KGGFW+   ++   L
Sbjct:   79 HLMGSDAPSSPLAGDPASIGMPLTPGKPTAAS-FCRVPMFSALPSLVAHGHCPDEVDYKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERL 226          
BLAST of Forkhead box J1 vs. Ensembl Zebrafish
Match: foxj3 (forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1])

HSP 1 Score: 84.7297 bits (208), Expect = 1.969e-16
Identity = 35/77 (45.45%), Postives = 52/77 (67.53%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF 847
            +PP+S  +LI+ AI+S  K K++  EI QWI + FPYY+     WK  I+++L+L+KCF KVPR +D+  KG +W  
Sbjct:   62 KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 138          
BLAST of Forkhead box J1 vs. Ensembl Xenopus
Match: prss2 (serine protease 2 [Source:Xenbase;Acc:XB-GENE-6065254])

HSP 1 Score: 86.2705 bits (212), Expect = 2.352e-17
Identity = 40/102 (39.22%), Postives = 64/102 (62.75%), Query Frame = 2
Query:  596 FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW----RFSNEFLN-YLERNRI 886
            +R N  ++PP+S   LI MA+ +  + K++   I  WI + F YY+     W+  I+++L+L+KCF KVPR +DE  KGGFW    R+++ F+N  L+R R+
Sbjct:  102 YRTNANIKPPYSYATLICMAMEASQQRKLTLSAIYSWITQNFCYYRHADPSWQNSIRHNLSLNKCFMKVPRGKDEPGKGGFWQMDPRYADMFVNGVLKRRRM 203          
BLAST of Forkhead box J1 vs. Ensembl Xenopus
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:496834])

HSP 1 Score: 87.0409 bits (214), Expect = 3.134e-17
Identity = 45/138 (32.61%), Postives = 74/138 (53.62%), Query Frame = 2
Query:  458 SPQFPLSMNPMNQLNRIIPQYFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYL 871
            +P  PL+ +P        P    SSS      + L+ M D      ++ N  ++PP+S   LI MA+ +  K K++   I +WI + F Y++     W+  I+++L+L+KCF KVPR +DE  KGGFW+   ++ + L
Sbjct:  135 APCSPLAADPACLGMPHTPGKPISSSTSRASHLGLQPMEDID----YKTNPHVKPPYSYATLICMAMQASKKTKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWKIDPQYADRL 268          
BLAST of Forkhead box J1 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 85.8853 bits (211), Expect = 1.136e-16
Identity = 36/77 (46.75%), Postives = 52/77 (67.53%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF 847
            +PP+S  +LI+ AI+S  K K++  EI QWI + FPYYK     WK  I+++L+L+KCF KVPR +D+  KG +W  
Sbjct:   63 KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 139          
BLAST of Forkhead box J1 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 85.5001 bits (210), Expect = 1.339e-16
Identity = 36/77 (46.75%), Postives = 52/77 (67.53%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF 847
            +PP+S  +LI+ AI+S  K K++  EI QWI + FPYYK     WK  I+++L+L+KCF KVPR +D+  KG +W  
Sbjct:   80 KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 156          
BLAST of Forkhead box J1 vs. Ensembl Xenopus
Match: ndel1 (nudE neurodevelopment protein 1 like 1 [Source:Xenbase;Acc:XB-GENE-989304])

HSP 1 Score: 85.5001 bits (210), Expect = 1.364e-16
Identity = 36/77 (46.75%), Postives = 52/77 (67.53%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF 847
            +PP+S  +LI+ AI+S  K K++  EI QWI + FPYYK     WK  I+++L+L+KCF KVPR +D+  KG +W  
Sbjct:   63 KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYKEAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 139          
BLAST of Forkhead box J1 vs. Ensembl Mouse
Match: Foxj2 (forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805])

HSP 1 Score: 81.6481 bits (200), Expect = 4.111e-17
Identity = 40/95 (42.11%), Postives = 58/95 (61.05%), Query Frame = 2
Query:  557 NLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW 841
            N     DEA+VH        +P +S   LI+ AI+S    K++  EI +WI + FPYYK+    WK  I+++L+L+KCF+KVPR RD+  KG +W
Sbjct:   51 NATLSKDEAAVH-----QDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYW 140          
BLAST of Forkhead box J1 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 84.3445 bits (207), Expect = 2.853e-16
Identity = 35/77 (45.45%), Postives = 52/77 (67.53%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF 847
            +PP+S  +LI+ AI+S  K K++  EI QWI + FPYY+     WK  I+++L+L+KCF KVPR +D+  KG +W  
Sbjct:   78 KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 154          
BLAST of Forkhead box J1 vs. Ensembl Mouse
Match: Foxj3 (forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432])

HSP 1 Score: 83.9593 bits (206), Expect = 2.885e-16
Identity = 35/77 (45.45%), Postives = 52/77 (67.53%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF 847
            +PP+S  +LI+ AI+S  K K++  EI QWI + FPYY+     WK  I+++L+L+KCF KVPR +D+  KG +W  
Sbjct:   78 KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 154          
BLAST of Forkhead box J1 vs. Ensembl Mouse
Match: Foxj1 (forkhead box J1 [Source:MGI Symbol;Acc:MGI:1347474])

HSP 1 Score: 82.0333 bits (201), Expect = 7.024e-16
Identity = 34/92 (36.96%), Postives = 55/92 (59.78%), Query Frame = 2
Query:  596 FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYL 871
            +  N  ++PP+S   LI MA+ +    K++   I +WI + F Y++     W+  I+++L+L+KCF KVPR +DE  KGGFWR   ++   L
Sbjct:  114 YATNPHVKPPYSYATLICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWRIDPQYAERL 205          
BLAST of Forkhead box J1 vs. Ensembl Mouse
Match: Foxj2 (forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805])

HSP 1 Score: 82.0333 bits (201), Expect = 1.359e-15
Identity = 40/95 (42.11%), Postives = 58/95 (61.05%), Query Frame = 2
Query:  557 NLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW 841
            N     DEA+VH        +P +S   LI+ AI+S    K++  EI +WI + FPYYK+    WK  I+++L+L+KCF+KVPR RD+  KG +W
Sbjct:   51 NATLSKDEAAVH-----QDGKPRYSYATLITYAINSSPAKKMTLSEIYRWICDNFPYYKNAGIGWKNSIRHNLSLNKCFRKVPRPRDDPGKGSYW 140          
BLAST of Forkhead box J1 vs. UniProt/SwissProt
Match: sp|F1R8Z9|FXJ1B_DANRE (Forkhead box protein J1-B OS=Danio rerio OX=7955 GN=foxj1b PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 7.292e-18
Identity = 41/112 (36.61%), Postives = 69/112 (61.61%), Query Frame = 2
Query:  596 FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW----RFSNEFLNYLERNRIQTLSGVNFDNR 919
            ++ N  ++PP+S   LI MA+ + NK K++   I  WI E F YY+     W+  I+++L+L+KCF KVPR++DE  KGGFW    ++++ F+N + + R   +   NF+ +
Sbjct:  132 YKTNRHVKPPYSYATLICMAMQASNKTKITLSAIYSWITENFCYYRYAEPSWQNSIRHNLSLNKCFMKVPRQKDEPGKGGFWQIDPQYADMFVNGVFKRR--RMPATNFNTQ 241          
BLAST of Forkhead box J1 vs. UniProt/SwissProt
Match: sp|Q66IG8|FXJ12_XENTR (Forkhead box protein J1.2 OS=Xenopus tropicalis OX=8364 GN=foxj1.2 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.246e-16
Identity = 40/102 (39.22%), Postives = 64/102 (62.75%), Query Frame = 2
Query:  596 FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW----RFSNEFLN-YLERNRI 886
            +R N  ++PP+S   LI MA+ +  + K++   I  WI + F YY+     W+  I+++L+L+KCF KVPR +DE  KGGFW    R+++ F+N  L+R R+
Sbjct:  102 YRTNANIKPPYSYATLICMAMEASQQRKLTLSAIYSWITQNFCYYRHADPSWQNSIRHNLSLNKCFMKVPRGKDEPGKGGFWQMDPRYADMFVNGVLKRRRM 203          
BLAST of Forkhead box J1 vs. UniProt/SwissProt
Match: sp|Q5M7N6|FOXJ1_XENTR (Forkhead box protein J1 OS=Xenopus tropicalis OX=8364 GN=foxj1 PE=2 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 1.393e-16
Identity = 45/138 (32.61%), Postives = 74/138 (53.62%), Query Frame = 2
Query:  458 SPQFPLSMNPMNQLNRIIPQYFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYL 871
            +P  PL+ +P        P    SSS      + L+ M D      ++ N  ++PP+S   LI MA+ +  K K++   I +WI + F Y++     W+  I+++L+L+KCF KVPR +DE  KGGFW+   ++ + L
Sbjct:   74 APCSPLAADPACLGMPHTPGKPISSSTSRASHLGLQPMEDID----YKTNPHVKPPYSYATLICMAMQASKKTKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGGFWKIDPQYADRL 207          
BLAST of Forkhead box J1 vs. UniProt/SwissProt
Match: sp|F1QDF8|FXJ1A_DANRE (Forkhead box protein J1-A OS=Danio rerio OX=7955 GN=foxj1a PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 2.021e-16
Identity = 46/149 (30.87%), Postives = 79/149 (53.02%), Query Frame = 2
Query:  440 HQMTMPSPQFPLSMNPMNQLNRIIPQYFESSSLYAEVAMNLEFMNDEASVHF-----FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYL 871
            H M   +P  PL+ +P +    + P    ++S +  V M     +  A  H      ++ N  ++PP+S   LI MA+ +  K K++   I +WI + F Y++     W+  I+++L+L+KCF KVPR++DE  KGGFW+   ++   L
Sbjct:   79 HLMGSDAPSSPLAGDPASIGMPLTPGKPTAAS-FCRVPMFSALPSLVAHGHCPDEVDYKSNPHIKPPYSYATLICMAMQASKKTKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERL 226          
BLAST of Forkhead box J1 vs. UniProt/SwissProt
Match: sp|Q32NH9|FXJ12_XENLA (Forkhead box protein J1.2 OS=Xenopus laevis OX=8355 GN=foxj1.2 PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.037e-16
Identity = 40/104 (38.46%), Postives = 65/104 (62.50%), Query Frame = 2
Query:  596 FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW----RFSNEFLN-YLERNRIQT 892
            +R N  ++PP+S   LI MA+ +  + K++   I  WI + F YY+     W+  I+++L+L+KCF KVPR +DE  KGGFW    R+++ F+N  L+R R+ +
Sbjct:  101 YRTNANVKPPYSYATLICMAMEASQQRKLTLSAIYNWITQNFCYYRHADPSWQNSIRHNLSLNKCFMKVPRGKDEPGKGGFWQMDPRYADMFVNGVLKRRRMPS 204          
BLAST of Forkhead box J1 vs. TrEMBL
Match: K7WR19 (Forkhead box J1-like protein 2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 3.086e-22
Identity = 45/108 (41.67%), Postives = 72/108 (66.67%), Query Frame = 2
Query:  518 YFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW 841
            Y    S+ +++  + + ++D   + F++ +   RPPFS I+LI MAI    + +++  +IC+WI   FPYY+ L + W+  ++N L++SKCFQKVPRR+DE EKGGFW
Sbjct:   77 YASDPSVRSDIICSWDQIDDSTRI-FYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFW 183          
BLAST of Forkhead box J1 vs. TrEMBL
Match: V3ZDS8 (Fork-head domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_69660 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 5.867e-18
Identity = 40/90 (44.44%), Postives = 58/90 (64.44%), Query Frame = 2
Query:  605 NNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLE 874
            N  ++PP+S   LI MA+    K K++   I  WI + F YY+     W+  I+++L+L+KCF+KVPRR+DE  KGGFWR + EF + LE
Sbjct:    1 NPYVKPPYSYATLIGMAMKETQKQKITLSAIYNWITDNFMYYRMADPSWQNSIRHNLSLNKCFEKVPRRKDEPGKGGFWRINPEFSDMLE 90          
BLAST of Forkhead box J1 vs. TrEMBL
Match: A0A3Q2Y3Q9 (Forkhead box J1b OS=Hippocampus comes OX=109280 PE=4 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 2.526e-17
Identity = 56/165 (33.94%), Postives = 93/165 (56.36%), Query Frame = 2
Query:  596 FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW----RFSNEFLNYLERNRIQTLSGVNFDNRINHDNAN---PS-----NDITYKFGKIINRKRTMN-KFVTQDENENSAFRIPK 1051
            ++ N +++PP+S  +LI MA+ +  + KV+   I  WI E F YY+     W+  I+++L+L+KCF+KVPR++DE  KGGFW    ++++ F+N + + R  + +  N +N  +    N   PS     N   Y+ GK I  KR  N K +++ E+   A   PK
Sbjct:  152 YKTNPKVKPPYSYASLICMAMEASKQPKVTLSTIYNWITENFCYYRHAEPSWQNSIRHNLSLNKCFKKVPRQKDEPGKGGFWQIDPQYADMFVNGIFKRRRMSANSYNGNNSGSAHRPNKLVPSSHSTQNSCPYQNGKDIGSKRKNNSKAISETESPLLATEAPK 316          
BLAST of Forkhead box J1 vs. TrEMBL
Match: A0A2T7Q124 (Fork-head domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_02006 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 9.152e-17
Identity = 41/93 (44.09%), Postives = 60/93 (64.52%), Query Frame = 2
Query:  596 FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLE 874
            +R N  ++PPFS   LI MA+    K K++   I  WI E F YY+     W+  I+++L+L+KCF+KVPRR+DE  KGGFWR + E+ + +E
Sbjct:  146 YRTNPYIKPPFSYATLICMAMKETKKQKITLSSIYNWITENFIYYRMADPSWQNSIRHNLSLNKCFEKVPRRKDEPGKGGFWRINPEYSDMIE 238          
BLAST of Forkhead box J1 vs. TrEMBL
Match: A0A3B3I6M5 (Fork-head domain-containing protein OS=Oryzias latipes OX=8090 GN=foxj1 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 9.211e-17
Identity = 51/169 (30.18%), Postives = 89/169 (52.66%), Query Frame = 2
Query:  440 HQMTMPSPQFPLSMNPMNQLNRIIPQYFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLERNRIQTLSGVNFDNRINHDNANPS 946
             Q+ + +P  PL+ +P +    + P    ++S Y+ +   +           +R N +++PPFS   LI MA+ +  K K++   I +WI + F YY+     W+  I+++L+L+KCF KVPR++DE  KGGFW+   ++  +L       LSG +   R+     NP+
Sbjct:   75 QQLGLDAPASPLAGDPASMGMPLTPGKPTAAS-YSRIQPGVVARGLTPDGADYRNNARVKPPFSYATLICMAMQASKKSKITLSCIYKWITDNFCYYRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAEHL-------LSGSHKKRRMPPVQINPA 235          
BLAST of Forkhead box J1 vs. Ensembl Cavefish
Match: ENSAMXT00000049290.1 (forkhead box J1 [Source:NCBI gene;Acc:103028087])

HSP 1 Score: 84.3445 bits (207), Expect = 1.416e-16
Identity = 40/117 (34.19%), Postives = 65/117 (55.56%), Query Frame = 2
Query:  596 FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLERNRIQTLSGVNFDNRINHDNANPS 946
            ++ N  ++PP+S   LI MA+ +  K K++   I +WI + F Y++     W+  I+++L+L+KCF KVPR++DE  KGGFW+   ++   L       LSG     R      NP+
Sbjct:  140 YKTNPHIKPPYSYATLICMAMQASKKSKITLSCIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAERL-------LSGAYKKRRTPPVQINPA 249          
BLAST of Forkhead box J1 vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 83.9593 bits (206), Expect = 2.508e-16
Identity = 35/77 (45.45%), Postives = 52/77 (67.53%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF 847
            +PP+S  +LI+ AI+S  K K++  EI QWI + FPYY+     WK  I+++L+L+KCF KVPR +D+  KG +W  
Sbjct:   62 KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAI 138          
BLAST of Forkhead box J1 vs. Ensembl Cavefish
Match: foxj3 (forkhead box J3 [Source:NCBI gene;Acc:103033658])

HSP 1 Score: 83.9593 bits (206), Expect = 2.598e-16
Identity = 35/75 (46.67%), Postives = 52/75 (69.33%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW 841
            +PP+S  +LI+ AI+S  K K++  EI QWI + FPYY+     WK  I+++L+L+KCF KVPR +D+  KG +W
Sbjct:   72 KPPYSYASLITFAINSSPKKKMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYW 146          
BLAST of Forkhead box J1 vs. Ensembl Cavefish
Match: foxa1 (forkhead box A1 [Source:ZFIN;Acc:ZDB-GENE-990415-78])

HSP 1 Score: 75.8702 bits (185), Expect = 3.729e-14
Identity = 49/142 (34.51%), Postives = 70/142 (49.30%), Query Frame = 2
Query:  476 SMNPMNQLNRIIPQYFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRF----SNEFLN--YLERNR 883
            SMN +N  + I P    S   YA+ ++N    N      F R     +PP+S I+LI+MAI       ++  EI QWI + FPYY+     W+  I++ L+ + CF KV R  D+  KG +W       N F N  YL R +
Sbjct:   98 SMNALNPYSSISPTM--SPMTYAQPSLNRARDNKT----FRRSYPHAKPPYSYISLITMAIQQSPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVSRSPDKPGKGSYWTLHPDSGNMFENGCYLRRQK 233          
BLAST of Forkhead box J1 vs. Ensembl Cavefish
Match: foxj2 (forkhead box protein J2 [Source:NCBI gene;Acc:103026648])

HSP 1 Score: 77.0258 bits (188), Expect = 4.362e-14
Identity = 34/79 (43.04%), Postives = 50/79 (63.29%), Query Frame = 2
Query:  605 NNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW 841
            N + +PP S   LI+MAI S  + K+S  +I  WI + FPYY      WK  I+++L+L+KCF+KVPR + +  KG +W
Sbjct:   54 NAKGKPPHSYATLIAMAIGSAPERKLSLNDIYTWISDMFPYYSRAGRGWKNSIRHNLSLNKCFRKVPRPQSDPGKGSYW 132          
BLAST of Forkhead box J1 vs. Ensembl Sea Lamprey
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 90.8929 bits (224), Expect = 1.575e-19
Identity = 45/121 (37.19%), Postives = 68/121 (56.20%), Query Frame = 2
Query:  596 FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNY-----LERNRIQTLSGVNFDNRINHDNANP 943
            +R N   +PP+S   LI MA+ +  K KV+   I +WI + F YY+     W+  I+++L+L+KCF KVPR++DE  KGGFW  + ++ +      L R RI T    N  N I+ +   P
Sbjct:  126 YRTNGAAKPPYSYATLICMAMQASKKSKVTLATIYKWITDNFCYYRHADPCWRNSIRHNLSLNKCFSKVPRQKDEPGKGGFWSINPQYADVVANGLLRRRRISTARWAN--NPISANKPGP 244          
BLAST of Forkhead box J1 vs. Ensembl Sea Lamprey
Match: foxj1b (forkhead box J1b [Source:NCBI gene;Acc:494105])

HSP 1 Score: 87.8113 bits (216), Expect = 1.317e-18
Identity = 37/93 (39.78%), Postives = 59/93 (63.44%), Query Frame = 2
Query:  596 FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLE 874
            +R +  ++PP+S   LI MA+ S +K KV+   I +WI + F YY+     W+  I+++L+L+KCF KVPR++DE  KGGFW    ++ +  E
Sbjct:   86 YRTDASVKPPYSYATLICMAMRSTHKSKVTLASIYKWIMDNFCYYRHADPTWQNSIRHNLSLNKCFVKVPRQKDEPGKGGFWAMDPQYADLFE 178          
BLAST of Forkhead box J1 vs. Ensembl Sea Lamprey
Match: foxj3 (forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1])

HSP 1 Score: 83.5741 bits (205), Expect = 5.750e-17
Identity = 36/75 (48.00%), Postives = 52/75 (69.33%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW 841
            +PP+S  NLI+ AI+S  + +++  EI QWI + FPYYK     WK  I+++L+L+KCF KVPR RD+  KG +W
Sbjct:   68 KPPYSYANLITFAINSSARKRMTLSEIYQWICDNFPYYKEAGIGWKNSIRHNLSLNKCFIKVPRSRDDPGKGSYW 142          
BLAST of Forkhead box J1 vs. Ensembl Sea Lamprey
Match: foxi3b (forkhead box I3b [Source:ZFIN;Acc:ZDB-GENE-031126-4])

HSP 1 Score: 75.485 bits (184), Expect = 1.095e-14
Identity = 36/106 (33.96%), Postives = 63/106 (59.43%), Query Frame = 2
Query:  524 ESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW 841
            +S    A   MN  +++ +    FFR+   +RPP+S   LI+MAI    + +++  +I Q++ E +P+YK     W+  I+++L+L+ CF+KVPR  D+  KG +W
Sbjct:   92 QSPGYGAGAEMN-PWLSYQGQQDFFRL---VRPPYSYSALIAMAIQHTPEKRLTLSQIYQYVAENYPFYKKSKAGWQNSIRHNLSLNDCFKKVPRDDDDPGKGNYW 193          
BLAST of Forkhead box J1 vs. Ensembl Sea Lamprey
Match: FOXC2 (forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801])

HSP 1 Score: 70.8626 bits (172), Expect = 1.894e-14
Identity = 33/87 (37.93%), Postives = 52/87 (59.77%), Query Frame = 2
Query:  614 LRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLE 874
            ++PP+S I LI+MAI S    KV+   I Q+I + FP+Y+     W+  I+++L+L++CF KVPR   +  KG +W    +  N  E
Sbjct:   76 VKPPYSYIALITMAIQSAPDKKVTLNGIYQFIMDKFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSYWSLDPDSYNMFE 162          
BLAST of Forkhead box J1 vs. Ensembl Yeast
Match: FKH2 (Forkhead family transcription factor; rate-limiting activator of replication origins; evolutionarily conserved regulator of lifespan; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; positively regulates transcriptional elongation; facilitates clustering, activation of early-firing replication origins; negative role in chromatin silencing at HML and HMR; major role in expression of G2/M phase genes; relocalizes to cytosol under hypoxia [Source:SGD;Acc:S000005012])

HSP 1 Score: 71.633 bits (174), Expect = 3.133e-13
Identity = 46/147 (31.29%), Postives = 75/147 (51.02%), Query Frame = 2
Query:  470 PLSMNPMNQLNRIIPQYF----ESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFS----NEFLNYLERNRI 886
            P + +P    N II   F    +SS+ Y +    L+F +D +       N  ++PP S   +I+ AI S  +  +S  +I ++I   + YY+     W+  I+++L+L+K F+KVPRR +E  KG  WR S     EFLN     ++
Sbjct:  294 PQAASPQGPPNTIIAANFVDSYKSSNAYPQA---LDFTSDLS----HDENRNVKPPHSYATMITQAILSSPEGVISLADIYKYISSNYAYYRFAKSGWQNSIRHNLSLNKAFEKVPRRPNEPGKGMKWRISESYQQEFLNKWNTGKV 433          
BLAST of Forkhead box J1 vs. Ensembl Yeast
Match: FKH1 (Forkhead family transcription factor; rate-limiting replication origin activator; evolutionarily conserved lifespan regulator; binds multiple chromosomal elements with distinct specificities, cell cycle dynamics; regulates transcription elongation, chromatin silencing at mating loci, expression of G2/M phase genes; facilitates clustering, activation of early-firing replication origins; binds HML recombination enhancer, regulates donor preference during mating-type switching [Source:SGD;Acc:S000001393])

HSP 1 Score: 59.6918 bits (143), Expect = 9.172e-10
Identity = 36/124 (29.03%), Postives = 68/124 (54.84%), Query Frame = 2
Query:  506 IIPQYFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNE----FLN 865
            I P  + SSS  A    N+  + + + +     N  ++PP S  ++I+ AI S  +  +S  +I ++I + + +Y+     W+  ++++L+L+K F+KVP+R  +  KG  W+ S+E    FLN
Sbjct:  267 IRPNTYTSSSNNAVTNGNVPHIENPSDLSLDE-NRYIKPPQSYASMITQAILSTPEGSISLADIYKFISDNYAFYRFSQMAWQNSVRHNLSLNKAFEKVPKRAGQQGKGMNWKISDEVRRDFLN 389          
BLAST of Forkhead box J1 vs. Ensembl Yeast
Match: HCM1 (Forkhead transcription factor; drives S-phase activation of genes involved in chromosome segregation, spindle dynamics, budding; also activates genes involved in respiration, use of alternative energy sources (like proline), NAD synthesis, oxidative stress resistance; key factor in early adaptation to nutrient deficiency and diauxic shift; suppressor of calmodulin mutants with specific SPB assembly defects; ortholog of C. elegans lifespan regulator PHA-4 [Source:SGD;Acc:S000000661])

HSP 1 Score: 56.225 bits (134), Expect = 1.234e-8
Identity = 30/83 (36.14%), Postives = 46/83 (55.42%), Query Frame = 2
Query:  599 RMNNQL--RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW 841
            R+N +L  +PP+S   LI +AI    + K++  +I  WI   FPYYK     W+  I+++L+L+  F K  +  D   KG FW
Sbjct:  101 RINGELAKKPPYSYATLICLAILQSQEGKLTLSQIYHWIHVHFPYYKQKDASWQNSIRHNLSLNDAFIKTEKSCD--GKGHFW 181          
BLAST of Forkhead box J1 vs. Ensembl Yeast
Match: FHL1 (Regulator of ribosomal protein (RP) transcription; has forkhead associated domain that binds phosphorylated proteins; recruits coactivator Ifh1p or corepressor Crf1p to RP gene promoters; also has forkhead DNA-binding domain though in vitro DNA binding assays give inconsistent results; computational analyses suggest it binds DNA directly at highly active RP genes and indirectly through Rap1p motifs at others; suppresses RNA pol III and splicing factor prp4 mutants [Source:SGD;Acc:S000006308])

HSP 1 Score: 56.6102 bits (135), Expect = 1.328e-8
Identity = 29/90 (32.22%), Postives = 48/90 (53.33%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMK-VSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLERNR 883
            +P  S   +++  I  Y+  K +S  EI   I E FPYYK   D W++ ++++L+L+K F+KV +      KG  W    E++   ER +
Sbjct:  461 KPTVSYSAMLTTCIRKYSTAKGMSLSEIYAGIRELFPYYKYCPDGWQSSVRHNLSLNKSFRKVSKEG----KGWLWGLDEEYIAERERQK 546          
BLAST of Forkhead box J1 vs. Ensembl Nematostella
Match: EDO44876 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUL7])

HSP 1 Score: 83.1889 bits (204), Expect = 2.476e-19
Identity = 33/76 (43.42%), Postives = 52/76 (68.42%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWR 844
            +PP+S   LI MA+    ++K++   I +WI+E F +Y+     W+  I+++L+L+KCF KVPR++DE  KGGFWR
Sbjct:    1 KPPYSYATLICMAMRDTKRVKITLSAIYKWIKENFMFYRVADPTWQNSIRHNLSLNKCFVKVPRKKDEPGKGGFWR 76          
BLAST of Forkhead box J1 vs. Ensembl Nematostella
Match: EDO36306 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIZ2])

HSP 1 Score: 75.485 bits (184), Expect = 5.859e-16
Identity = 34/71 (47.89%), Postives = 50/71 (70.42%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEK 829
            +PP+S  NLI+ AI+S  + K++  EI QWI + FPYYK   + WK  I+++L+L+KCF KVPR +D+  K
Sbjct:   73 KPPYSYANLITFAINSSPEKKMTLSEIYQWICDHFPYYKEAGNGWKNSIRHNLSLNKCFIKVPRSKDDPGK 143          
BLAST of Forkhead box J1 vs. Ensembl Nematostella
Match: EDO42654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0W7])

HSP 1 Score: 72.0182 bits (175), Expect = 1.887e-15
Identity = 32/81 (39.51%), Postives = 49/81 (60.49%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEF 859
            +PP+S + LISMAI      K++   I Q+I E FPYY+     W+  I+++L+L+KCF K+PR R +  KG +W     +
Sbjct:    3 KPPYSYVALISMAIKQSKGQKITLSGIYQFIIENFPYYRLNKRGWQNSIRHNLSLNKCFVKIPRERSDPGKGCYWALDPAY 83          
BLAST of Forkhead box J1 vs. Ensembl Nematostella
Match: EDO45105 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTX1])

HSP 1 Score: 67.781 bits (164), Expect = 6.945e-14
Identity = 29/75 (38.67%), Postives = 48/75 (64.00%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW 841
            +PP+S I LI+MAI    + K++  +IC++I+  FPYY+     W+  I+++L+L+ CF K+PR      KG +W
Sbjct:    3 KPPYSYIALITMAILQSPQRKLTLSDICEFIKRRFPYYREKFPSWQNSIRHNLSLNDCFVKMPREPGNPGKGNYW 77          
BLAST of Forkhead box J1 vs. Ensembl Nematostella
Match: EDO33900 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQU5])

HSP 1 Score: 73.1738 bits (178), Expect = 1.441e-13
Identity = 33/87 (37.93%), Postives = 54/87 (62.07%), Query Frame = 2
Query:  614 LRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLE 874
            ++PP+S I LI+MAI S  + +++   I  +I + FPYY++    W+  I+++L+L++CF KVPR   +  KG FW    + LN  E
Sbjct:   78 VKPPYSYIALIAMAIQSAPEKRITLSGIYSFIMDRFPYYRNNKQGWQNSIRHNLSLNECFVKVPRDDKKPGKGSFWMLDPDSLNMFE 164          
BLAST of Forkhead box J1 vs. Ensembl Medaka
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:100301616])

HSP 1 Score: 95.1301 bits (235), Expect = 3.467e-20
Identity = 51/169 (30.18%), Postives = 89/169 (52.66%), Query Frame = 2
Query:  440 HQMTMPSPQFPLSMNPMNQLNRIIPQYFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLERNRIQTLSGVNFDNRINHDNANPS 946
             Q+ + +P  PL+ +P +    + P    ++S Y+ +   +           +R N +++PPFS   LI MA+ +  K K++   I +WI + F YY+     W+  I+++L+L+KCF KVPR++DE  KGGFW+   ++  +L       LSG +   R+     NP+
Sbjct:   75 QQLGLDAPASPLAGDPASMGMPLTPGKPTAAS-YSRIQPGVVARGLTPDGADYRNNARVKPPFSYATLICMAMQASKKSKITLSCIYKWITDNFCYYRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAEHL-------LSGSHKKRRMPPVQINPA 235          
BLAST of Forkhead box J1 vs. Ensembl Medaka
Match: foxj1 (forkhead box J1 [Source:NCBI gene;Acc:100301616])

HSP 1 Score: 95.5153 bits (236), Expect = 3.526e-20
Identity = 51/169 (30.18%), Postives = 89/169 (52.66%), Query Frame = 2
Query:  440 HQMTMPSPQFPLSMNPMNQLNRIIPQYFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLERNRIQTLSGVNFDNRINHDNANPS 946
             Q+ + +P  PL+ +P +    + P    ++S Y+ +   +           +R N +++PPFS   LI MA+ +  K K++   I +WI + F YY+     W+  I+++L+L+KCF KVPR++DE  KGGFW+   ++  +L       LSG +   R+     NP+
Sbjct:   93 QQLGLDAPASPLAGDPASMGMPLTPGKPTAAS-YSRIQPGVVARGLTPDGADYRNNARVKPPFSYATLICMAMQASKKSKITLSCIYKWITDNFCYYRHADPTWQNSIRHNLSLNKCFIKVPRQKDEPGKGGFWKIDPQYAEHL-------LSGSHKKRRMPPVQINPA 253          
BLAST of Forkhead box J1 vs. Ensembl Medaka
Match: foxj1b (forkhead box protein J1-B [Source:NCBI gene;Acc:101165351])

HSP 1 Score: 86.2705 bits (212), Expect = 2.454e-17
Identity = 37/100 (37.00%), Postives = 66/100 (66.00%), Query Frame = 2
Query:  596 FRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFW----RFSNEFLNYLERNR 883
            ++ N +++PP+S  +LI MA+ +  + KV+   I  WI + F YY+     W+  I+++L+L+KCF+KVPR++DE  KGGFW    ++++ F+N + + R
Sbjct:  136 YKTNPKVKPPYSYASLICMAMQASKQPKVTLSTIYNWITQNFCYYRHAEPSWQNSIRHNLSLNKCFKKVPRQKDEPGKGGFWQIDPQYADMFVNGIFKRR 235          
BLAST of Forkhead box J1 vs. Ensembl Medaka
Match: ENSORLT00000031716.1 (forkhead box protein J3 [Source:NCBI gene;Acc:101156973])

HSP 1 Score: 79.7221 bits (195), Expect = 1.561e-16
Identity = 33/79 (41.77%), Postives = 52/79 (65.82%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSN 853
            +PP+S  +LI+ AI+   + +++  EI QWI + FPYY+     WK  I+++L+L+KCF KVPR +D+  KG +W   N
Sbjct:   76 KPPYSYASLITFAINGSPRKRMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDN 154          
BLAST of Forkhead box J1 vs. Ensembl Medaka
Match: ENSORLT00000042706.1 (forkhead box protein J3 [Source:NCBI gene;Acc:101156973])

HSP 1 Score: 82.4185 bits (202), Expect = 8.725e-16
Identity = 33/79 (41.77%), Postives = 52/79 (65.82%), Query Frame = 2
Query:  617 RPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSN 853
            +PP+S  +LI+ AI+   + +++  EI QWI + FPYY+     WK  I+++L+L+KCF KVPR +D+  KG +W   N
Sbjct:   77 KPPYSYASLITFAINGSPRKRMTLSEIYQWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDN 155          
BLAST of Forkhead box J1 vs. Planmine SMEST
Match: SMESG000017088.1 (SMESG000017088.1)

HSP 1 Score: 1011.91 bits (2615), Expect = 0.000e+0
Identity = 534/534 (100.00%), Postives = 534/534 (100.00%), Query Frame = 2
Query:  173 MISETRLGLAEKFRQNWQTQYPCSMIEKSETRNFHQNFLKRNNRNFNQSFFGGNHNDNEDDSXXXXXXXXXXXXXXMXXXXXXXXXXXXHQMTMPSPQFPLSMNPMNQLNRIIPQYFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLERNRIQTLSGVNFDNRINHDNANPSNDITYKFGKIINRKRTMNKFVTQDENENSAFRIPKKKWFSNEMIDFQNGKSILIHXXXXXXXXXXXXIHHGIRECKPRESLLLQYQDGSLCNINQMNLAINSCANESMSNIGISVLANSDLSRLQESNELFHQNIMCNQINPIVTASQSPCPEQVTEEEFLSGQAFTNNYITLNTNADSLPSMLDTQTNYSHNDFNISDLSITGIGLKPPEWWNQSFSASQISLSKFNCSFRSVTVANNGEQISPFCIGIDEDHHGLWSSNDISNLSELDVLFGLS 1774
            MISETRLGLAEKFRQNWQTQYPCSMIEKSETRNFHQNFLKRNNRNFNQSFFGGNHNDNEDDSLTNLNWLQNLNLFNMSQTQPPLSPSPTHQMTMPSPQFPLSMNPMNQLNRIIPQYFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLERNRIQTLSGVNFDNRINHDNANPSNDITYKFGKIINRKRTMNKFVTQDENENSAFRIPKKKWFSNEMIDFQNGKSILIHNKANNNSNNMDNIHHGIRECKPRESLLLQYQDGSLCNINQMNLAINSCANESMSNIGISVLANSDLSRLQESNELFHQNIMCNQINPIVTASQSPCPEQVTEEEFLSGQAFTNNYITLNTNADSLPSMLDTQTNYSHNDFNISDLSITGIGLKPPEWWNQSFSASQISLSKFNCSFRSVTVANNGEQISPFCIGIDEDHHGLWSSNDISNLSELDVLFGLS
Sbjct:    1 MISETRLGLAEKFRQNWQTQYPCSMIEKSETRNFHQNFLKRNNRNFNQSFFGGNHNDNEDDSLTNLNWLQNLNLFNMSQTQPPLSPSPTHQMTMPSPQFPLSMNPMNQLNRIIPQYFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLERNRIQTLSGVNFDNRINHDNANPSNDITYKFGKIINRKRTMNKFVTQDENENSAFRIPKKKWFSNEMIDFQNGKSILIHNKANNNSNNMDNIHHGIRECKPRESLLLQYQDGSLCNINQMNLAINSCANESMSNIGISVLANSDLSRLQESNELFHQNIMCNQINPIVTASQSPCPEQVTEEEFLSGQAFTNNYITLNTNADSLPSMLDTQTNYSHNDFNISDLSITGIGLKPPEWWNQSFSASQISLSKFNCSFRSVTVANNGEQISPFCIGIDEDHHGLWSSNDISNLSELDVLFGLS 534          
BLAST of Forkhead box J1 vs. Planmine SMEST
Match: SMESG000072873.1 (SMESG000072873.1)

HSP 1 Score: 114.775 bits (286), Expect = 3.500e-26
Identity = 49/118 (41.53%), Postives = 78/118 (66.10%), Query Frame = 2
Query:  518 YFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYL 871
            Y    S+ +++  + + ++D   + F++ +   RPPFS I+LI MAI    + +++  +IC+WI   FPYY+ L + W+  ++N L++SKCFQKVPRR+DE EKGGFWR S ++  YL
Sbjct:   79 YASDPSVRSDIICSWDQIDDSTRI-FYKTHTTGRPPFSHISLICMAIQDIGQSRITSTQICEWIIINFPYYQILDNSWQNSVRNLLSVSKCFQKVPRRKDEPEKGGFWRLSGDYQKYL 195          
BLAST of Forkhead box J1 vs. Planmine SMEST
Match: SMESG000010030.1 (SMESG000010030.1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.026e-19
Identity = 40/100 (40.00%), Postives = 64/100 (64.00%), Query Frame = 2
Query:  590 HFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLERNRIQ 889
            H ++ N   +PPFS   LI M++   NK K++  +I  WI + F YY+     W+  ++++L+L+KCF+KVPR +DE  KGGFWR + ++ + LE N I+
Sbjct:  168 HDYKTNWSGKPPFSYATLICMSMRELNKSKITLSDIYGWITDNFIYYRLSDSSWQNSVRHNLSLNKCFEKVPRSKDERGKGGFWRINPKYADRLESNLIK 267          
BLAST of Forkhead box J1 vs. Planmine SMEST
Match: SMESG000067319.1 (SMESG000067319.1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.974e-19
Identity = 51/151 (33.77%), Postives = 81/151 (53.64%), Query Frame = 2
Query:  452 MPSPQFPLSMNPMNQ-----LNRIIPQYFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLERNRIQ 889
            +PS    L+ N  N       ++ + QYF S     + A+  E + D    + ++ + + +PP S   LI MA+    K K++  EI +WI E F YY+     W+  ++++L+L KCF+KVPR++DE  KGGFWR +  F   L  N I+
Sbjct:   82 LPSSTLSLNANSFNSNKIQTYDKSVLQYFPSK---LQAALRNEGLFDPIIRYEYKNSWKNKPPLSYTTLICMAMLDLGKPKIALNEIYEWIRENFLYYRKSDSSWQNSVRHNLSLKKCFEKVPRKKDERGKGGFWRINPNFTENLGNNFIK 229          
BLAST of Forkhead box J1 vs. Planmine SMEST
Match: SMESG000067319.1 (SMESG000067319.1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.290e-19
Identity = 51/151 (33.77%), Postives = 81/151 (53.64%), Query Frame = 2
Query:  452 MPSPQFPLSMNPMNQ-----LNRIIPQYFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRPPFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNHLTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLERNRIQ 889
            +PS    L+ N  N       ++ + QYF S     + A+  E + D    + ++ + + +PP S   LI MA+    K K++  EI +WI E F YY+     W+  ++++L+L KCF+KVPR++DE  KGGFWR +  F   L  N I+
Sbjct:   93 LPSSTLSLNANSFNSNKIQTYDKSVLQYFPSK---LQAALRNEGLFDPIIRYEYKNSWKNKPPLSYTTLICMAMLDLGKPKIALNEIYEWIRENFLYYRKSDSSWQNSVRHNLSLKKCFEKVPRKKDERGKGGFWRINPNFTENLGNNFIK 240          
The following BLAST results are available for this feature:
BLAST of Forkhead box J1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FOXJ37.917e-1747.30forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ31.166e-1646.67forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ33.315e-1645.45forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ33.427e-1645.45forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
FOXJ33.427e-1645.45forkhead box J3 [Source:HGNC Symbol;Acc:HGNC:29178... [more]
back to top
BLAST of Forkhead box J1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pha-47.373e-1438.78Defective pharyngeal development protein 4 [Sourc... [more]
pha-47.555e-1438.78Defective pharyngeal development protein 4 [Sourc... [more]
pha-41.167e-1338.78Defective pharyngeal development protein 4 [Sourc... [more]
fkh-75.748e-1134.94ForKHead transcription factor family [Source:UniP... [more]
fkh-76.975e-1134.94ForKHead transcription factor family [Source:UniP... [more]
back to top
BLAST of Forkhead box J1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fd96Ca6.669e-1233.72gene:FBgn0004897 transcript:FBtr0339246[more]
fd96Ca6.669e-1233.72gene:FBgn0004897 transcript:FBtr0084770[more]
croc7.133e-1238.10gene:FBgn0014143 transcript:FBtr0078395[more]
fd59A9.434e-1242.11gene:FBgn0004896 transcript:FBtr0071898[more]
fkh9.643e-1234.95gene:FBgn0000659 transcript:FBtr0346765[more]
back to top
BLAST of Forkhead box J1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj1b9.660e-1936.61forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxj1b9.660e-1936.61forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxj1a2.677e-1730.87forkhead box J1a [Source:NCBI gene;Acc:767737][more]
foxj1a2.677e-1730.87forkhead box J1a [Source:NCBI gene;Acc:767737][more]
foxj31.969e-1645.45forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1... [more]
back to top
BLAST of Forkhead box J1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prss22.352e-1739.22serine protease 2 [Source:Xenbase;Acc:XB-GENE-6065... [more]
foxj13.134e-1732.61forkhead box J1 [Source:NCBI gene;Acc:496834][more]
ndel11.136e-1646.75nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel11.339e-1646.75nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
ndel11.364e-1646.75nudE neurodevelopment protein 1 like 1 [Source:Xen... [more]
back to top
BLAST of Forkhead box J1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Foxj24.111e-1742.11forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805... [more]
Foxj32.853e-1645.45forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
Foxj32.885e-1645.45forkhead box J3 [Source:MGI Symbol;Acc:MGI:2443432... [more]
Foxj17.024e-1636.96forkhead box J1 [Source:MGI Symbol;Acc:MGI:1347474... [more]
Foxj21.359e-1542.11forkhead box J2 [Source:MGI Symbol;Acc:MGI:1926805... [more]
back to top
BLAST of Forkhead box J1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1R8Z9|FXJ1B_DANRE7.292e-1836.61Forkhead box protein J1-B OS=Danio rerio OX=7955 G... [more]
sp|Q66IG8|FXJ12_XENTR1.246e-1639.22Forkhead box protein J1.2 OS=Xenopus tropicalis OX... [more]
sp|Q5M7N6|FOXJ1_XENTR1.393e-1632.61Forkhead box protein J1 OS=Xenopus tropicalis OX=8... [more]
sp|F1QDF8|FXJ1A_DANRE2.021e-1630.87Forkhead box protein J1-A OS=Danio rerio OX=7955 G... [more]
sp|Q32NH9|FXJ12_XENLA2.037e-1638.46Forkhead box protein J1.2 OS=Xenopus laevis OX=835... [more]
back to top
BLAST of Forkhead box J1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K7WR193.086e-2241.67Forkhead box J1-like protein 2 (Fragment) OS=Schmi... [more]
V3ZDS85.867e-1844.44Fork-head domain-containing protein (Fragment) OS=... [more]
A0A3Q2Y3Q92.526e-1733.94Forkhead box J1b OS=Hippocampus comes OX=109280 PE... [more]
A0A2T7Q1249.152e-1744.09Fork-head domain-containing protein OS=Pomacea can... [more]
A0A3B3I6M59.211e-1730.18Fork-head domain-containing protein OS=Oryzias lat... [more]
back to top
BLAST of Forkhead box J1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000049290.11.416e-1634.19forkhead box J1 [Source:NCBI gene;Acc:103028087][more]
foxj32.508e-1645.45forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
foxj32.598e-1646.67forkhead box J3 [Source:NCBI gene;Acc:103033658][more]
foxa13.729e-1434.51forkhead box A1 [Source:ZFIN;Acc:ZDB-GENE-990415-7... [more]
foxj24.362e-1443.04forkhead box protein J2 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Forkhead box J1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj1b1.575e-1937.19forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxj1b1.317e-1839.78forkhead box J1b [Source:NCBI gene;Acc:494105][more]
foxj35.750e-1748.00forkhead box J3 [Source:ZFIN;Acc:ZDB-GENE-101005-1... [more]
foxi3b1.095e-1433.96forkhead box I3b [Source:ZFIN;Acc:ZDB-GENE-031126-... [more]
FOXC21.894e-1437.93forkhead box C2 [Source:HGNC Symbol;Acc:HGNC:3801][more]
back to top
BLAST of Forkhead box J1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
FKH23.133e-1331.29Forkhead family transcription factor; rate-limitin... [more]
FKH19.172e-1029.03Forkhead family transcription factor; rate-limitin... [more]
HCM11.234e-836.14Forkhead transcription factor; drives S-phase acti... [more]
FHL11.328e-832.22Regulator of ribosomal protein (RP) transcription;... [more]
back to top
BLAST of Forkhead box J1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448762.476e-1943.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363065.859e-1647.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426541.887e-1539.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451056.945e-1438.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339001.441e-1337.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Forkhead box J1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxj13.467e-2030.18forkhead box J1 [Source:NCBI gene;Acc:100301616][more]
foxj13.526e-2030.18forkhead box J1 [Source:NCBI gene;Acc:100301616][more]
foxj1b2.454e-1737.00forkhead box protein J1-B [Source:NCBI gene;Acc:10... [more]
ENSORLT00000031716.11.561e-1641.77forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000042706.18.725e-1641.77forkhead box protein J3 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Forkhead box J1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017088.10.000e+0100.00SMESG000017088.1[more]
SMESG000072873.13.500e-2641.53SMESG000072873.1[more]
SMESG000010030.11.026e-1940.00SMESG000010030.1[more]
SMESG000067319.13.974e-1933.77SMESG000067319.1[more]
SMESG000067319.14.290e-1933.77SMESG000067319.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014407 ID=SMED30014407|Name=Forkhead box J1|organism=Schmidtea mediterranea sexual|type=transcript|length=2464bp
TAAGACTTTTATAAATATCTACTAAATTAGTTTTGCGCATAATTTCAGTT
ATAACTTTTGAGTTAATTAATCAGTTTTCTTTACAAATTGTGCCAATAAA
TTTACGATATATAATTCCATTATACATTTCCCAATTATCGTCTGACATTT
TAGCGTTGCTAATAATCGGATTATGATTTCTGAAACGAGACTCGGTTTGG
CTGAGAAATTTCGCCAAAATTGGCAAACACAATATCCTTGTTCGATGATT
GAAAAATCTGAAACGAGAAATTTCCATCAAAACTTTCTTAAACGAAACAA
CAGAAATTTTAATCAATCCTTTTTCGGAGGTAACCATAATGATAATGAAG
ATGATTCACTGACAAATCTGAATTGGTTGCAGAACCTAAATTTATTCAAT
ATGTCTCAAACTCAACCGCCTCTAAGTCCTTCTCCGACTCATCAGATGAC
AATGCCTTCTCCCCAGTTTCCTTTATCCATGAACCCAATGAACCAATTAA
ACCGAATAATACCTCAATATTTTGAAAGTAGTAGCCTTTACGCCGAAGTC
GCCATGAATTTGGAGTTCATGAATGATGAAGCCAGTGTTCATTTTTTTAG
AATGAACAACCAACTTAGGCCACCATTTTCAGATATAAACTTAATATCAA
TGGCCATCCACAGCTACAACAAAATGAAAGTCAGTTTTCCAGAAATTTGT
CAGTGGATAGAAGAAACCTTTCCATATTACAAATCACTTTCAGATGATTG
GAAGACGGGAATAAAAAACCATTTGACATTGAGCAAATGCTTTCAAAAGG
TTCCCAGACGAAGAGATGAAACGGAAAAAGGCGGATTTTGGAGATTTAGT
AATGAGTTTTTAAATTACCTGGAAAGAAATCGAATACAAACATTATCGGG
TGTAAATTTTGATAATCGAATCAATCACGACAACGCAAATCCCTCCAATG
ATATCACTTACAAGTTCGGCAAAATCATCAATCGGAAGCGGACAATGAAT
AAATTTGTCACACAGGACGAGAATGAAAACTCGGCGTTTCGGATTCCAAA
AAAGAAATGGTTTTCCAATGAGATGATTGATTTCCAGAACGGTAAATCAA
TTTTGATCCATAACAAAGCCAATAATAATTCCAACAACATGGACAATATC
CACCACGGAATCAGAGAGTGCAAACCAAGGGAGTCCTTATTGCTACAATA
TCAAGATGGCTCCTTGTGTAACATTAACCAAATGAATCTGGCAATAAACA
GTTGCGCGAATGAATCTATGTCTAATATTGGAATTTCAGTATTAGCTAAT
TCGGATCTTTCACGGCTTCAAGAGTCAAATGAACTTTTCCATCAGAACAT
AATGTGTAATCAAATAAATCCCATAGTTACCGCTTCCCAATCTCCATGTC
CAGAACAAGTCACGGAAGAGGAATTCCTTTCTGGTCAAGCATTCACTAAC
AATTATATAACATTGAATACCAATGCTGACAGTCTACCTTCCATGCTTGA
CACTCAAACCAACTACAGTCACAATGATTTCAATATCAGCGACCTAAGCA
TCACTGGAATCGGACTCAAGCCGCCTGAATGGTGGAATCAAAGCTTTTCC
GCCAGTCAAATCAGTTTATCCAAATTCAATTGCTCATTCCGATCTGTGAC
CGTGGCGAATAATGGAGAACAGATTTCCCCTTTCTGCATTGGTATTGATG
AAGATCATCACGGACTTTGGTCATCGAATGATATTTCAAATCTTTCAGAA
TTGGACGTGCTGTTTGGATTGAGCTAGAATCAAATGGACGGTTTGCTATA
GATTGATTACTGCTGTTCCGTGTACCTGGCATTCTTTCATTACTGAATAT
GCTTGTGAAGCTCTATTGCTGCTGTGAGCATATATATGTATGTGTGTGTG
TGTTCGCGTGTTTATCAGCCATTTTGTGAATATCCCTGCCTAAGATTATC
AAATGACTCGTGTCAAATGCTTATTTACCTTCATTTTATCGCCATTACAT
CCATAACAGAGATAACTGATCTTATATTTACACTAAATGTATTTAGTTAT
TTGATTGATATTTTGTGTCTGCTCGATGCCGAGCTCAGCCTCCCCCTCCA
CTGCCTGAGATACTCAATGAAATCAATTTCAGATCGTTCTCCAGAAAGTG
CTGTATAAAAAAATCAATAAATTCACCGTTAGAAATCTACTGAAACACGT
CAATGGCCTCAATTGCAATCACCAAGGACGCCTGGCTATGAGCAATTAAA
CACCATTTATTCAGCTCTCTAACGTCACTCTATGAGAGCGATAAATTAAC
TATTGTTTCTAATAAAGATAGGAAGAATCGATTTTTCATAGAATGGCATC
AATTGTCACTGATAGTGTTTTTAATTTCCAAGTTTATTATTATCATATTT
TTATGGCTGAACAATTGTTTTTTAATGTTACGTAATTGGGTGATATGCAT
GTGTGTATGCGCGC
back to top

protein sequence of SMED30014407-orf-1

>SMED30014407-orf-1 ID=SMED30014407-orf-1|Name=SMED30014407-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=535bp
MISETRLGLAEKFRQNWQTQYPCSMIEKSETRNFHQNFLKRNNRNFNQSF
FGGNHNDNEDDSLTNLNWLQNLNLFNMSQTQPPLSPSPTHQMTMPSPQFP
LSMNPMNQLNRIIPQYFESSSLYAEVAMNLEFMNDEASVHFFRMNNQLRP
PFSDINLISMAIHSYNKMKVSFPEICQWIEETFPYYKSLSDDWKTGIKNH
LTLSKCFQKVPRRRDETEKGGFWRFSNEFLNYLERNRIQTLSGVNFDNRI
NHDNANPSNDITYKFGKIINRKRTMNKFVTQDENENSAFRIPKKKWFSNE
MIDFQNGKSILIHNKANNNSNNMDNIHHGIRECKPRESLLLQYQDGSLCN
INQMNLAINSCANESMSNIGISVLANSDLSRLQESNELFHQNIMCNQINP
IVTASQSPCPEQVTEEEFLSGQAFTNNYITLNTNADSLPSMLDTQTNYSH
NDFNISDLSITGIGLKPPEWWNQSFSASQISLSKFNCSFRSVTVANNGEQ
ISPFCIGIDEDHHGLWSSNDISNLSELDVLFGLS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR001766Fork_head_dom
IPR011991WHTH_DNA-bd_dom
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001766Fork head domainPRINTSPR00053FORKHEADcoord: 149..162
score: 55.9
coord: 170..187
score: 36.95
coord: 193..210
score: 39.73
IPR001766Fork head domainSMARTSM00339forkneu4coord: 147..237
e-value: 5.1E-13
score: 59.3
IPR001766Fork head domainPFAMPF00250Forkheadcoord: 149..229
e-value: 6.1E-21
score: 74.5
IPR001766Fork head domainPROSITEPS50039FORK_HEAD_3coord: 149..239
score: 21.696
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 137..240
e-value: 2.1E-23
score: 84.1
NoneNo IPR availablePANTHERPTHR45881:SF2coord: 54..277
NoneNo IPR availablePANTHERPTHR45881FAMILY NOT NAMEDcoord: 54..277
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 149..238