SMED30014396
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30014396 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 6
Alignments
SMED30014396 aligns in the following genomic locations:
Homology
BLAST of SMED30014396 vs. TrEMBL
Match: A0A1I8HA02 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1) HSP 1 Score: 66.2402 bits (160), Expect = 1.525e-10 Identity = 31/88 (35.23%), Postives = 47/88 (53.41%), Query Frame = 3 Query: 234 GGGSNSTILNIRRFSDIAITMLKDKDETDEHPYGRGKTVDGCFNRSSSGKDSDQSMIIVWFIFVGFLLGSCVMIIILAELYRSQAVVN 497 G ++ L RFS +AI ML+++++ D HPYGRG +G D + + W +F GF+L + IIILAE+ R Q + Sbjct: 34 AGFCDTRQLQENRFSAVAIEMLREQEDRDLHPYGRGGRFEGVLYSRRVKVQVDHAKFLAWIVFAGFILLTSGAIIILAEMERRQKTLQ 121
BLAST of SMED30014396 vs. TrEMBL
Match: A0A4S2LFB0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008011 PE=4 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 6.349e-10 Identity = 36/96 (37.50%), Postives = 51/96 (53.12%), Query Frame = 3 Query: 195 KNDLKSSLNETEKGGGSNSTILNI---RRFSDIAITMLKDKDETDEHPYGRGKTVDGCFNRSSSGKDSDQSMIIVWFIFVGFLLGSCVMIIILAEL 473 K+ LK SL + ST ++ RR S + + ML +++E D HPYGRG +G G+ D ++VWFIF G L+ V II +AEL Sbjct: 62 KSILKMSLGLGSQVSAPESTAISTETQRRLSSVTLEMLMEREEIDIHPYGRGGIYEGILYTRKEGEPVDMLGLVVWFIFFGSLVMMAVSIIFVAEL 157
BLAST of SMED30014396 vs. TrEMBL
Match: A0A1I8IHX0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1) HSP 1 Score: 64.6994 bits (156), Expect = 9.167e-9 Identity = 31/84 (36.90%), Postives = 46/84 (54.76%), Query Frame = 3 Query: 234 GGGSNSTILNIRRFSDIAITMLKDKDETDEHPYGRGKTVDGCFNRSSSGKDSDQSMIIVWFIFVGFLLGSCVMIIILAELYRSQ 485 G ++ L RFS +AI ML+++++ D HPYGRG +G D + + W +F GF+L + IIILAE+ R Q Sbjct: 34 AGFCDTRQLQENRFSAVAIEMLREQEDRDLHPYGRGGRFEGVLYSRRVKVQVDHAKFLAWIVFAGFILLTSGAIIILAEMERRQ 117
BLAST of SMED30014396 vs. TrEMBL
Match: A0A2H1BUQ6 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_14327 PE=4 SV=1) HSP 1 Score: 58.5362 bits (140), Expect = 3.212e-7 Identity = 33/95 (34.74%), Postives = 51/95 (53.68%), Query Frame = 3 Query: 195 KNDLKSSLNETEKGGGSNSTILNI--RRFSDIAITMLKDKDETDEHPYGRGKTVDGCFNRSSSGKDSDQSMIIVWFIFVGFLLGSCVMIIILAEL 473 K+ LKSSL G S+ + + RR S I + ML +++E D HPYGRG +G ++ D +I+VW IF +L + ++ +AEL Sbjct: 69 KSILKSSLGLDTMTGISDIPLSTVDQRRVSSITLEMLMEREEIDVHPYGRGGIYEGILYSHKKEEELDFVVILVWLIFSSSVLMISIAVVFVAEL 163
BLAST of SMED30014396 vs. TrEMBL
Match: A0A4E0QVR4 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_009859 PE=4 SV=1) HSP 1 Score: 58.151 bits (139), Expect = 4.487e-7 Identity = 33/95 (34.74%), Postives = 51/95 (53.68%), Query Frame = 3 Query: 195 KNDLKSSLNETEKGGGSNSTILNI--RRFSDIAITMLKDKDETDEHPYGRGKTVDGCFNRSSSGKDSDQSMIIVWFIFVGFLLGSCVMIIILAEL 473 K+ LKSSL G S+ + + RR S I + ML +++E D HPYGRG +G ++ D +I+VW IF +L + ++ +AEL Sbjct: 66 KSILKSSLGLDTMTGISDIPLSTVDQRRVSSITLEMLMEREEIDVHPYGRGGIYEGILYSHKKEEELDFVVILVWLIFSSSVLMISIAVVFVAEL 160
BLAST of SMED30014396 vs. Planmine SMEST
Match: SMESG000048041.1 (SMESG000048041.1) HSP 1 Score: 276.559 bits (706), Expect = 9.321e-97 Identity = 135/135 (100.00%), Postives = 135/135 (100.00%), Query Frame = 3 Query: 111 MPDDKQVKLVGKSPKTVSFTNLGYENDDKNDLKSSLNETEKGGGSNSTILNIRRFSDIAITMLKDKDETDEHPYGRGKTVDGCFNRSSSGKDSDQSMIIVWFIFVGFLLGSCVMIIILAELYRSQAVVNISYSNG 515 MPDDKQVKLVGKSPKTVSFTNLGYENDDKNDLKSSLNETEKGGGSNSTILNIRRFSDIAITMLKDKDETDEHPYGRGKTVDGCFNRSSSGKDSDQSMIIVWFIFVGFLLGSCVMIIILAELYRSQAVVNISYSNG Sbjct: 1 MPDDKQVKLVGKSPKTVSFTNLGYENDDKNDLKSSLNETEKGGGSNSTILNIRRFSDIAITMLKDKDETDEHPYGRGKTVDGCFNRSSSGKDSDQSMIIVWFIFVGFLLGSCVMIIILAELYRSQAVVNISYSNG 135
BLAST of SMED30014396 vs. Planmine SMEST
Match: SMESG000081746.1 (SMESG000081746.1) HSP 1 Score: 62.7734 bits (151), Expect = 6.417e-13 Identity = 31/75 (41.33%), Postives = 42/75 (56.00%), Query Frame = 3 Query: 267 RRFSDIAITMLKDKDETDEHPYGRGKTVDGCFNRSSSGKDS-DQSMIIVWFIFVGFLLGSCVMIIILAELYRSQA 488 RFS +A+ +L+ D D HP+GRG G + K+ D S I VW +F+GF L +IIILAE+ R Q Sbjct: 41 HRFSSVALDLLRVNDNEDIHPFGRGGKFTGVLYGNQKIKNRIDHSKIFVWILFIGFALTGSALIIILAEIDRKQT 115 The following BLAST results are available for this feature:
BLAST of SMED30014396 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30014396 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30014396 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30014396 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30014396 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30014396 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30014396 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30014396 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of SMED30014396 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30014396 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30014396 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30014396 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30014396 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30014396 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 2
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30014396 ID=SMED30014396|Name=SMED30014396|organism=Schmidtea mediterranea sexual|type=transcript|length=543bpback to top protein sequence of SMED30014396-orf-1 >SMED30014396-orf-1 ID=SMED30014396-orf-1|Name=SMED30014396-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=146bp MDILINESNKMPDDKQVKLVGKSPKTVSFTNLGYENDDKNDLKSSLNETEback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|