cyclin B-1

Overview
Namecyclin B-1 (AFJ24835.1)
Smed IDSMED30014394
Length (bp)1360
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cyclin B-1 (SMED30014394) t-SNE clustered cells

Violin plots show distribution of expression levels for cyclin B-1 (SMED30014394) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cyclin B-1 (SMED30014394) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cyclin B-1 (SMED30014394) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014394

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014394SMESG000028669.1 SmedASXL_006092SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014394SMESG000028669.1 SmedASXL_006092SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30014394SMESG000028669.1 dd_Smed_v4_11487_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014394SMESG000028669.1 dd_Smed_v4_11487_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30014394SMESG000028669.1 dd_Smed_v6_11487_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30014394SMESG000028669.1 dd_Smed_v4_11487_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014394SMESG000028669.1 SMED30014394smed_20140614PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30014394SMESG000028669.1 SmWIOct06_007685GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30014394SMESG000028669.1 SMED_04901_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30014394SMESG000028669.1 SMED_04901_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cyclin B-1 vs. Ensembl Human
Match: CCNB1 (cyclin B1 [Source:HGNC Symbol;Acc:HGNC:1579])

HSP 1 Score: 65.0846 bits (157), Expect = 9.355e-12
Identity = 47/173 (27.17%), Postives = 82/173 (47.40%), Query Frame = 2
Query:  512 QPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMAL 1027
            Q +   +L G  VT   R ++I+ L  +     + + ++   +SI DR+++        K L+L  VT  +IASK + +  P I D   ++        I   E+++LR + F L  P P+ FLR  S I +     H +AK + E+    Y++   P    A  ++CLA+ +
Sbjct:    1 QAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNN--CVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKI 171          
BLAST of cyclin B-1 vs. Ensembl Human
Match: CCNB1 (cyclin B1 [Source:HGNC Symbol;Acc:HGNC:1579])

HSP 1 Score: 66.2402 bits (160), Expect = 3.276e-11
Identity = 53/208 (25.48%), Postives = 95/208 (45.67%), Query Frame = 2
Query:  512 QPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            Q +   +L G  VT   R ++I+ L  +     + + ++   +SI DR+++        K L+L  VT  +IASK + +  P I D   ++        I   E+++LR + F L  P P+ FLR  S I +     H +AK + E+    Y++   P    A  ++CLA+ +   N      W P ++       + + P++  +AK
Sbjct:  185 QAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQ--NNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKI-LDN----GEWTPTLQHYLSYTEESLLPVMQHLAK 385          
BLAST of cyclin B-1 vs. Ensembl Human
Match: CCNB1 (cyclin B1 [Source:HGNC Symbol;Acc:HGNC:1579])

HSP 1 Score: 66.6254 bits (161), Expect = 3.587e-11
Identity = 53/208 (25.48%), Postives = 95/208 (45.67%), Query Frame = 2
Query:  512 QPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            Q +   +L G  VT   R ++I+ L  +     + + ++   +SI DR+++        K L+L  VT  +IASK + +  P I D   ++        I   E+++LR + F L  P P+ FLR  S I +     H +AK + E+    Y++   P    A  ++CLA+ +   N      W P ++       + + P++  +AK
Sbjct:  185 QAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQ--NNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKI-LDN----GEWTPTLQHYLSYTEESLLPVMQHLAK 385          
BLAST of cyclin B-1 vs. Ensembl Human
Match: CCNB1 (cyclin B1 [Source:HGNC Symbol;Acc:HGNC:1579])

HSP 1 Score: 65.0846 bits (157), Expect = 9.565e-11
Identity = 47/174 (27.01%), Postives = 82/174 (47.13%), Query Frame = 2
Query:  509 HQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMAL 1027
             Q +   +L G  VT   R ++I+ L  +     + + ++   +SI DR+++        K L+L  VT  +IASK + +  P I D   ++        I   E+++LR + F L  P P+ FLR  S I +     H +AK + E+    Y++   P    A  ++CLA+ +
Sbjct:  184 EQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQ--NNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKI 355          
BLAST of cyclin B-1 vs. Ensembl Human
Match: CCNB2 (cyclin B2 [Source:HGNC Symbol;Acc:HGNC:1580])

HSP 1 Score: 61.6178 bits (148), Expect = 9.631e-10
Identity = 55/225 (24.44%), Postives = 110/225 (48.89%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAG-HPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            ++ +I   +  LE V Q +   FL G ++  + R ++++ L  + +   + + ++   + I DR+++ +  S   K L+L  +T   +ASK + +  P IED   ++      + I + E  +L+ ++F L  P P+ FLR  S   +     H +AK + E+    Y++   HPS V A AS CL+     + +  +  W    ++ TG   +++  ++  +AK
Sbjct:  134 YVKDIYQYLRQLE-VLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVS--RKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDMVHYHPSKVAAAAS-CLS-----QKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAK 349          
BLAST of cyclin B-1 vs. Ensembl Celegans
Match: cyb-3 (G2/mitotic-specific cyclin-B3 [Source:UniProtKB/Swiss-Prot;Acc:Q10654])

HSP 1 Score: 51.9878 bits (123), Expect = 4.770e-7
Identity = 45/192 (23.44%), Postives = 88/192 (45.83%), Query Frame = 2
Query:  548 VTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS--KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLI 1117
            V ++ R ++I+ +  +  +  +   ++ N + + D Y+ K          KLA V   +IA+K D    P ++D+  LS  +     L+   E E+  T+ ++L  P    +LR    + +    +  + + I E    VYE A       A A++ LAM +  +N + E  W P++   +G   +++ PL+
Sbjct:  138 VDVKTRAILIDWMVEIQETFELNHETLYNAVKLTDMYLCKTKNVDKNTIQKLACVAI-FIAAKYDERSPPLVDDLIYLSGDRFSRDELLA-MERELFATVGYDLGSPLSYRYLRRFGRVCRVDMKTLTMGRFILETSLMVYEYAMVSQSRLAAAAFVLAMRMLDKNNEYE--WNPVLEKYSGFTGEEVMPLV 325          
BLAST of cyclin B-1 vs. Ensembl Celegans
Match: cyb-3 (G2/mitotic-specific cyclin-B3 [Source:UniProtKB/Swiss-Prot;Acc:Q10654])

HSP 1 Score: 51.9878 bits (123), Expect = 5.270e-7
Identity = 45/192 (23.44%), Postives = 88/192 (45.83%), Query Frame = 2
Query:  548 VTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS--KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLI 1117
            V ++ R ++I+ +  +  +  +   ++ N + + D Y+ K          KLA V   +IA+K D    P ++D+  LS  +     L+   E E+  T+ ++L  P    +LR    + +    +  + + I E    VYE A       A A++ LAM +  +N + E  W P++   +G   +++ PL+
Sbjct:  139 VDVKTRAILIDWMVEIQETFELNHETLYNAVKLTDMYLCKTKNVDKNTIQKLACVAI-FIAAKYDERSPPLVDDLIYLSGDRFSRDELLA-MERELFATVGYDLGSPLSYRYLRRFGRVCRVDMKTLTMGRFILETSLMVYEYAMVSQSRLAAAAFVLAMRMLDKNNEYE--WNPVLEKYSGFTGEEVMPLV 326          
BLAST of cyclin B-1 vs. Ensembl Celegans
Match: cyb-3 (G2/mitotic-specific cyclin-B3 [Source:UniProtKB/Swiss-Prot;Acc:Q10654])

HSP 1 Score: 51.9878 bits (123), Expect = 5.270e-7
Identity = 45/192 (23.44%), Postives = 88/192 (45.83%), Query Frame = 2
Query:  548 VTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS--KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLI 1117
            V ++ R ++I+ +  +  +  +   ++ N + + D Y+ K          KLA V   +IA+K D    P ++D+  LS  +     L+   E E+  T+ ++L  P    +LR    + +    +  + + I E    VYE A       A A++ LAM +  +N + E  W P++   +G   +++ PL+
Sbjct:  139 VDVKTRAILIDWMVEIQETFELNHETLYNAVKLTDMYLCKTKNVDKNTIQKLACVAI-FIAAKYDERSPPLVDDLIYLSGDRFSRDELLA-MERELFATVGYDLGSPLSYRYLRRFGRVCRVDMKTLTMGRFILETSLMVYEYAMVSQSRLAAAAFVLAMRMLDKNNEYE--WNPVLEKYSGFTGEEVMPLV 326          
BLAST of cyclin B-1 vs. Ensembl Fly
Match: CycB (gene:FBgn0000405 transcript:FBtr0309858)

HSP 1 Score: 77.7962 bits (190), Expect = 4.407e-15
Identity = 73/255 (28.63%), Postives = 123/255 (48.24%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGTN-VTIQQRNVIIN--NLFSLANSLSVERYSVQNGMSIFDRY---IKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPAL-INDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGH-PSHVQACASYCLAMALSFRNLQL-----EDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYE 1189
            ++ +I D +  +E + QP+  D L G   V+ + R V+I+  N   L   L+ E +  Q  ++I DRY   +K   +++    L+L  VT  +IA+K + L  P I D   ++     A  I   E+++ + I+ NL  P PI FLR  S      +  H ++K   E+ +  YE+A + PS + A AS  L++ L   N +      + HW P + F +      +RP+   IAK L       +  +IY +Y+
Sbjct:  255 YVNDIYDYLYQVE-LEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETF--QLAVAIIDRYLQVVKDTKRTY----LQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSKYFIELASVDYEMATYRPSEI-AAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAK-LARDAPQAKLKAIYNKYQ 500          
BLAST of cyclin B-1 vs. Ensembl Fly
Match: CycB (gene:FBgn0000405 transcript:FBtr0071913)

HSP 1 Score: 77.7962 bits (190), Expect = 4.487e-15
Identity = 73/255 (28.63%), Postives = 123/255 (48.24%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGTN-VTIQQRNVIIN--NLFSLANSLSVERYSVQNGMSIFDRY---IKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPA-LINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGH-PSHVQACASYCLAMALSFRNLQL-----EDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYE 1189
            ++ +I D +  +E + QP+  D L G   V+ + R V+I+  N   L   L+ E +  Q  ++I DRY   +K   +++    L+L  VT  +IA+K + L  P I D   ++     A  I   E+++ + I+ NL  P PI FLR  S      +  H ++K   E+ +  YE+A + PS + A AS  L++ L   N +      + HW P + F +      +RP+   IAK L       +  +IY +Y+
Sbjct:  251 YVNDIYDYLYQVE-LEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETF--QLAVAIIDRYLQVVKDTKRTY----LQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSKYFIELASVDYEMATYRPSEI-AAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAK-LARDAPQAKLKAIYNKYQ 496          
BLAST of cyclin B-1 vs. Ensembl Fly
Match: CycB (gene:FBgn0000405 transcript:FBtr0071914)

HSP 1 Score: 77.7962 bits (190), Expect = 4.673e-15
Identity = 73/255 (28.63%), Postives = 123/255 (48.24%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGTN-VTIQQRNVIIN--NLFSLANSLSVERYSVQNGMSIFDRY---IKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPAL-INDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGH-PSHVQACASYCLAMALSFRNLQL-----EDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYE 1189
            ++ +I D +  +E + QP+  D L G   V+ + R V+I+  N   L   L+ E +  Q  ++I DRY   +K   +++    L+L  VT  +IA+K + L  P I D   ++     A  I   E+++ + I+ NL  P PI FLR  S      +  H ++K   E+ +  YE+A + PS + A AS  L++ L   N +      + HW P + F +      +RP+   IAK L       +  +IY +Y+
Sbjct:  227 YVNDIYDYLYQVE-LEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETF--QLAVAIIDRYLQVVKDTKRTY----LQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSKYFIELASVDYEMATYRPSEI-AAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAK-LARDAPQAKLKAIYNKYQ 472          
BLAST of cyclin B-1 vs. Ensembl Fly
Match: CycB (gene:FBgn0000405 transcript:FBtr0071911)

HSP 1 Score: 77.7962 bits (190), Expect = 5.059e-15
Identity = 73/255 (28.63%), Postives = 123/255 (48.24%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGTN-VTIQQRNVIIN--NLFSLANSLSVERYSVQNGMSIFDRY---IKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPAL-INDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGH-PSHVQACASYCLAMALSFRNLQL-----EDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYE 1189
            ++ +I D +  +E + QP+  D L G   V+ + R V+I+  N   L   L+ E +  Q  ++I DRY   +K   +++    L+L  VT  +IA+K + L  P I D   ++     A  I   E+++ + I+ NL  P PI FLR  S      +  H ++K   E+ +  YE+A + PS + A AS  L++ L   N +      + HW P + F +      +RP+   IAK L       +  +IY +Y+
Sbjct:  257 YVNDIYDYLYQVE-LEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETF--QLAVAIIDRYLQVVKDTKRTY----LQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSKYFIELASVDYEMATYRPSEI-AAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAK-LARDAPQAKLKAIYNKYQ 502          
BLAST of cyclin B-1 vs. Ensembl Zebrafish
Match: ccnb1 (cyclin B1 [Source:ZFIN;Acc:ZDB-GENE-000406-10])

HSP 1 Score: 75.485 bits (184), Expect = 2.631e-14
Identity = 56/208 (26.92%), Postives = 98/208 (47.12%), Query Frame = 2
Query:  512 QPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            Q +   +L G  VT   R ++I+ L  +     + + ++   ++I DR+++        K L+L  VT  +IASK + +  P I D   ++ +    + I + E++VLR + F    P P+ FLR  S I       H +AK   E+    Y++  +P    A A+Y    AL+ +     D W P ++   G   D++ P++  IAK
Sbjct:  151 QAVRPKYLAGKEVTGNMRAILIDWLVQVQIKFRLLQETMYMTVAIIDRFLQDH--PVPKKQLQLVGVTAMFIASKYEEMYPPEIADFAFVTDRAYTTSQIREMEMKVLRVLNFGFGRPLPLQFLRRASKIGDVTAEHHTLAKYFLELTMVDYDMVHYPPSQMASAAY----ALTLKVFNCGD-WTPTLQHYMGYTEDELVPVMQHIAK 351          
BLAST of cyclin B-1 vs. Ensembl Zebrafish
Match: ccnb3 (cyclin B3 [Source:ZFIN;Acc:ZDB-GENE-060929-684])

HSP 1 Score: 53.1434 bits (126), Expect = 3.319e-7
Identity = 49/217 (22.58%), Postives = 100/217 (46.08%), Query Frame = 2
Query:  545 NVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIED---VCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEY 1186
            N+    R ++++ L  +  +  +   ++   + + D Y+        A  L+L   T   IASK +    PC++D   +C+    +   LI+  E+ +L+ + F++ IP P  FLR  +        +  +A+ I E+  ++ E+   P      AS CL +AL  ++L     W   ++F +G   +D+ P++  +  ++L+   D +   I  +Y
Sbjct:  168 NLNTNMRAILVDWLVEVQENFELNHETLYLAVKVTDHYLAVSQTKREA--LQLIGSTAMLIASKFEERAPPCVDDFLYICD-DAYKRSQLIS-MEISILQALNFDINIPVPYRFLRRYAKCVNAGMDTLTLARFICEL--SLLEMEFVPVRASLLASACLLIALVTKDL---GGWTQCLQFHSGYSAEDLAPVVRKL-HHMLSSPADSKLAVIRSKY 374          
BLAST of cyclin B-1 vs. Ensembl Zebrafish
Match: ccnb3 (cyclin B3 [Source:ZFIN;Acc:ZDB-GENE-060929-684])

HSP 1 Score: 53.1434 bits (126), Expect = 3.319e-7
Identity = 49/217 (22.58%), Postives = 100/217 (46.08%), Query Frame = 2
Query:  545 NVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIED---VCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEY 1186
            N+    R ++++ L  +  +  +   ++   + + D Y+        A  L+L   T   IASK +    PC++D   +C+    +   LI+  E+ +L+ + F++ IP P  FLR  +        +  +A+ I E+  ++ E+   P      AS CL +AL  ++L     W   ++F +G   +D+ P++  +  ++L+   D +   I  +Y
Sbjct:  168 NLNTNMRAILVDWLVEVQENFELNHETLYLAVKVTDHYLAVSQTKREA--LQLIGSTAMLIASKFEERAPPCVDDFLYICD-DAYKRSQLIS-MEISILQALNFDINIPVPYRFLRRYAKCVNAGMDTLTLARFICEL--SLLEMEFVPVRASLLASACLLIALVTKDL---GGWTQCLQFHSGYSAEDLAPVVRKL-HHMLSSPADSKLAVIRSKY 374          
BLAST of cyclin B-1 vs. Ensembl Zebrafish
Match: ccnb3 (cyclin B3 [Source:ZFIN;Acc:ZDB-GENE-060929-684])

HSP 1 Score: 53.1434 bits (126), Expect = 3.319e-7
Identity = 49/217 (22.58%), Postives = 100/217 (46.08%), Query Frame = 2
Query:  545 NVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIED---VCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEY 1186
            N+    R ++++ L  +  +  +   ++   + + D Y+        A  L+L   T   IASK +    PC++D   +C+    +   LI+  E+ +L+ + F++ IP P  FLR  +        +  +A+ I E+  ++ E+   P      AS CL +AL  ++L     W   ++F +G   +D+ P++  +  ++L+   D +   I  +Y
Sbjct:  168 NLNTNMRAILVDWLVEVQENFELNHETLYLAVKVTDHYLAVSQTKREA--LQLIGSTAMLIASKFEERAPPCVDDFLYICD-DAYKRSQLIS-MEISILQALNFDINIPVPYRFLRRYAKCVNAGMDTLTLARFICEL--SLLEMEFVPVRASLLASACLLIALVTKDL---GGWTQCLQFHSGYSAEDLAPVVRKL-HHMLSSPADSKLAVIRSKY 374          
BLAST of cyclin B-1 vs. Ensembl Zebrafish
Match: ccnb2 (cyclin B2 [Source:ZFIN;Acc:ZDB-GENE-030429-12])

HSP 1 Score: 50.8322 bits (120), Expect = 1.727e-6
Identity = 46/206 (22.33%), Postives = 92/206 (44.66%), Query Frame = 2
Query:  530 FLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPAL----INDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDH-WPPIMRFVTGIDIDDIRPLIVAIAK 1132
            ++ G ++  + R ++++ L  + +   + + ++   ++I DR+++ +      + L+L  VT   IA K + +  P + D    + I D A     I + E+ +L  + F L  P P+ FLR  S         H +AK   E+    Y++  +     A A+ CL+       L L+   W    +  +  D   ++P++  IAK
Sbjct:  143 YMEGYDINGRMRALLVDWLIQVHSRFQLLQETLYMTVAILDRFLQVQ--PVTRRKLQLVGVTAMLIACKYEEMYVPMVGD---FAYIADDAFTKAQIREMEMLMLSGLNFKLGRPLPLHFLRRASKAGNADAEKHTLAKYFLELTLLDYDMVHYNPSETAAAALCLS------QLVLDGQKWSSTQQHYSTYDEAHLKPIMQLIAK 337          
BLAST of cyclin B-1 vs. Ensembl Xenopus
Match: nyap1 (neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adaptor 1 [Source:Xenbase;Acc:XB-GENE-6462398])

HSP 1 Score: 74.3294 bits (181), Expect = 8.450e-14
Identity = 56/209 (26.79%), Postives = 102/209 (48.80%), Query Frame = 2
Query:  512 QPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGH-PSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            Q +  ++L+G  VT   R ++I+ L  +     + + ++   + I DR+++      N   L+L  VT  ++A+K + +  P I D   ++      A I D E++VLR ++F +  P P+ FLR  S I +     H++AK + E+    Y++  + PS + A AS CL++ +          W P M        DD+ P++  +AK
Sbjct:  149 QAVRQNYLHGQEVTGNMRAILIDWLVQVQMKFRLLQETMFMTVGIIDRFLQDHPVPKN--QLQLVGVTAMFLAAKYEEMYPPEIGDFTFVTDHTYTKAQIRDMEMKVLRVLKFAIGRPLPLHFLRRASKIGEVTAEQHSLAKYLMELVMVDYDMVHYSPSQIAAAAS-CLSLKILNTG-----EWTPTMHHYMAYSEDDLVPVMQHMAK 349          
BLAST of cyclin B-1 vs. Ensembl Xenopus
Match: nyap1 (neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adaptor 1 [Source:Xenbase;Acc:XB-GENE-6462398])

HSP 1 Score: 74.3294 bits (181), Expect = 8.694e-14
Identity = 56/209 (26.79%), Postives = 102/209 (48.80%), Query Frame = 2
Query:  512 QPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGH-PSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            Q +  ++L+G  VT   R ++I+ L  +     + + ++   + I DR+++      N   L+L  VT  ++A+K + +  P I D   ++      A I D E++VLR ++F +  P P+ FLR  S I +     H++AK + E+    Y++  + PS + A AS CL++ +          W P M        DD+ P++  +AK
Sbjct:  151 QAVRQNYLHGQEVTGNMRAILIDWLVQVQMKFRLLQETMFMTVGIIDRFLQDHPVPKN--QLQLVGVTAMFLAAKYEEMYPPEIGDFTFVTDHTYTKAQIRDMEMKVLRVLKFAIGRPLPLHFLRRASKIGEVTAEQHSLAKYLMELVMVDYDMVHYSPSQIAAAAS-CLSLKILNTG-----EWTPTMHHYMAYSEDDLVPVMQHMAK 351          
BLAST of cyclin B-1 vs. Ensembl Xenopus
Match: ccnb1 (cyclin B1 [Source:NCBI gene;Acc:100101736])

HSP 1 Score: 71.633 bits (174), Expect = 5.704e-13
Identity = 50/208 (24.04%), Postives = 100/208 (48.08%), Query Frame = 2
Query:  512 QPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            Q +   +L G  +    R ++++ L  +     + + ++   ++I DR++++       K L+LA V+  +IA K + +  P I D   ++      + I + E+++LR ++F++  P P+ FLR  S I +  +V H +AK + E+    Y++   P    A A++CLAM +          W P++          + P++  IAK
Sbjct:  145 QAIRPHYLDGQEINGNMRAILVDWLVQVHLRFKLLQETMSMTIAILDRFLQEN--PVPKKLLQLAGVSAMFIACKYEEIYCPTIGDFAFVTDHTYTKSQIRNMEMQILRVLKFDIGRPLPLHFLRRASKIGEVDSVHHTLAKYLIELVMTDYDMVHVPPSQLAAAAFCLAMKILNSG-----EWTPVLEHYMAYKESSLMPVMQHIAK 345          
BLAST of cyclin B-1 vs. Ensembl Xenopus
Match: ccnb1 (cyclin B1 [Source:NCBI gene;Acc:100101736])

HSP 1 Score: 71.633 bits (174), Expect = 6.124e-13
Identity = 50/208 (24.04%), Postives = 100/208 (48.08%), Query Frame = 2
Query:  512 QPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            Q +   +L G  +    R ++++ L  +     + + ++   ++I DR++++       K L+LA V+  +IA K + +  P I D   ++      + I + E+++LR ++F++  P P+ FLR  S I +  +V H +AK + E+    Y++   P    A A++CLAM      +     W P++          + P++  IAK
Sbjct:  139 QAIRPHYLDGQEINGNMRAILVDWLVQVHLRFKLLQETMSMTIAILDRFLQEN--PVPKKLLQLAGVSAMFIACKYEEIYCPTIGDFAFVTDHTYTKSQIRNMEMQILRVLKFDIGRPLPLHFLRRASKIGEVDSVHHTLAKYLIELVMTDYDMVHVPPSQLAAAAFCLAM-----KILNSGEWTPVLEHYMAYKESSLMPVMQHIAK 339          
BLAST of cyclin B-1 vs. Ensembl Xenopus
Match: ENSXETT00000018933.1 (cyclin B5 [Source:NCBI gene;Acc:394448])

HSP 1 Score: 70.8626 bits (172), Expect = 9.891e-13
Identity = 57/216 (26.39%), Postives = 105/216 (48.61%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAG-HPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDI 1105
            ++ +I   +  LE V Q +   +L+G  V  + R ++++ L  +     + + ++   ++I DR+++  G+  +   L+L  VT  +IASK + + YP I D   ++      A I + E+ +L+ + F+L  P P+ FLR  S         H +AK   E+    Y++   HPS + A A+ CL   +   N+     W   ++F TG   DD+
Sbjct:  123 YVKDIYTYLRQLE-VQQAVRPRYLHGMEVNERMRAILVDWLIQVHLKFQLLQETLYMAIAIMDRFLQ--GQPISRSKLQLVGVTSLFIASKYEEMYYPEISDFVYITDNTYSKAQIREMEMMILKELNFDLGRPLPLNFLRRASKCCSADAGQHTLAKYFMELTLLDYDMVHFHPSAI-AAAALCLTQKV--LNI---GTWDATLQFYTGYSQDDL 329          
BLAST of cyclin B-1 vs. Ensembl Mouse
Match: Ccnb1 (cyclin B1 [Source:MGI Symbol;Acc:MGI:88302])

HSP 1 Score: 63.929 bits (154), Expect = 1.212e-10
Identity = 54/209 (25.84%), Postives = 98/209 (46.89%), Query Frame = 2
Query:  512 QPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSK-IEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAG-HPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            Q +   +L G  VT   R ++I+ L  +     + + ++   +SI DR+++        K L+L  VT  +IASK + +  P I D   ++        I   E+++LR + F+L  P P+ FLR  S + +     H +AK + E+    Y++    PS + A  ++CLA+ +   N      W P ++       D + P++  +AK
Sbjct:  121 QSVRPKYLQGREVTGNMRAILIDWLIQVQMKFRLLQETMYMTVSIIDRFMQ--NSCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTNNTYTKHQIRQMEMKILRVLNFSLGRPLPLHFLRRASKVGEVDVEQHTLAKYLMELSMLDYDMVHFAPSQI-AAGAFCLALKI-LDN----GEWTPTLQHYLSYSEDSLLPVMQHLAK 321          
BLAST of cyclin B-1 vs. Ensembl Mouse
Match: Ccnb1 (cyclin B1 [Source:MGI Symbol;Acc:MGI:88302])

HSP 1 Score: 63.929 bits (154), Expect = 1.621e-10
Identity = 52/208 (25.00%), Postives = 95/208 (45.67%), Query Frame = 2
Query:  512 QPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSK-IEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            Q +   +L G  VT   R ++I+ L  +     + + ++   +SI DR+++        K L+L  VT  +IASK + +  P I D   ++        I   E+++LR + F+L  P P+ FLR  S + +     H +AK + E+    Y++        A  ++CLA+ +   N      W P ++       D + P++  +AK
Sbjct:  182 QSVRPKYLQGREVTGNMRAILIDWLIQVQMKFRLLQETMYMTVSIIDRFMQ--NSCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTNNTYTKHQIRQMEMKILRVLNFSLGRPLPLHFLRRASKVGEVDVEQHTLAKYLMELSMLDYDMVHFAPSQIAAGAFCLALKI-LDN----GEWTPTLQHYLSYSEDSLLPVMQHLAK 382          
BLAST of cyclin B-1 vs. Ensembl Mouse
Match: Ccnb2 (cyclin B2 [Source:MGI Symbol;Acc:MGI:88311])

HSP 1 Score: 61.6178 bits (148), Expect = 8.705e-10
Identity = 49/187 (26.20%), Postives = 94/187 (50.27%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAG-HPSHVQACASYCLA 1018
            ++ +I   +  LE V Q +   FL G ++  + R ++++ L  + +   + + ++   ++I DR+++   +    K L+L  +T   +ASK + +  P IED   ++      + I + E  +L+ ++F L  P P+ FLR  S   +     H +AK + E+    Y++   HPS V A AS CL+
Sbjct:  134 YVKDIYQYLRQLE-VLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCIAIMDRFLQ--AQLVCRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLVDYDMVHYHPSQVAAAAS-CLS 316          
BLAST of cyclin B-1 vs. Ensembl Mouse
Match: Ccnb1 (cyclin B1 [Source:MGI Symbol;Acc:MGI:88302])

HSP 1 Score: 60.077 bits (144), Expect = 2.447e-9
Identity = 45/174 (25.86%), Postives = 82/174 (47.13%), Query Frame = 2
Query:  509 HQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSK-IEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMAL 1027
             Q +   +L G  VT   R ++I+ L  +     + + ++   +SI DR+++        K L+L  VT  +IASK + +  P I D   ++        I   E+++LR + F+L  P P+ FLR  S + +     H +AK + E+    Y++        A  ++CLA+ +
Sbjct:  181 EQSVRPKYLQGREVTGNMRAILIDWLIQVQMKFRLLQETMYMTVSIIDRFMQ--NSCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTNNTYTKHQIRQMEMKILRVLNFSLGRPLPLHFLRRASKVGEVDVEQHTLAKYLMELSMLDYDMVHFAPSQIAAGAFCLALKI 352          
BLAST of cyclin B-1 vs. UniProt/SwissProt
Match: sp|P20439|CCNB_DROME (G2/mitotic-specific cyclin-B OS=Drosophila melanogaster OX=7227 GN=CycB PE=1 SV=2)

HSP 1 Score: 77.7962 bits (190), Expect = 5.071e-14
Identity = 73/255 (28.63%), Postives = 123/255 (48.24%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGTN-VTIQQRNVIIN--NLFSLANSLSVERYSVQNGMSIFDRY---IKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPAL-INDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGH-PSHVQACASYCLAMALSFRNLQL-----EDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYE 1189
            ++ +I D +  +E + QP+  D L G   V+ + R V+I+  N   L   L+ E +  Q  ++I DRY   +K   +++    L+L  VT  +IA+K + L  P I D   ++     A  I   E+++ + I+ NL  P PI FLR  S      +  H ++K   E+ +  YE+A + PS + A AS  L++ L   N +      + HW P + F +      +RP+   IAK L       +  +IY +Y+
Sbjct:  257 YVNDIYDYLYQVE-LEQPIHKDHLAGQKEVSHKMRAVLIDWINEVHLQFHLAAETF--QLAVAIIDRYLQVVKDTKRTY----LQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTMSKYFIELASVDYEMATYRPSEI-AAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAK-LARDAPQAKLKAIYNKYQ 502          
BLAST of cyclin B-1 vs. UniProt/SwissProt
Match: sp|Q9DGA4|CCNB1_ORYCU (G2/mitotic-specific cyclin-B1 OS=Oryzias curvinotus OX=104658 GN=ccnb1 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 2.281e-13
Identity = 61/224 (27.23%), Postives = 108/224 (48.21%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            ++ +I   +  LE V Q +  ++L G  VT   R ++I+ L  ++    +   ++   + I DR+++        K L+L  VT  ++ASK + +  P I D   ++ +    A I D E+ VLR ++F L  P P+ FLR  S I +     H +AK + E+    Y++A  P  + A A    A+AL+ + L     W   ++   G   + + P++  IAK
Sbjct:  140 YVKDIYKYLRQLE-VEQSVKPNYLEGQEVTGNMRAILIDWLVQVSLKFRLLPETMYMTVGIIDRFLQDH--PVPKKQLQLVGVTAMFLASKYEEMYPPEISDFAFVTDRAYTTAQIRDMEMTVLRVLKFQLGRPLPLQFLRRASKIYEVTADQHTLAKYLLELSMVDYDMAHFPPSMVASA----ALALTLKVLD-AGEWDVTLQHYMGYTAETLTPVMAHIAK 355          
BLAST of cyclin B-1 vs. UniProt/SwissProt
Match: sp|Q92162|CCNB1_CARAU (G2/mitotic-specific cyclin-B1 OS=Carassius auratus OX=7957 GN=ccnb1 PE=2 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 5.518e-13
Identity = 54/210 (25.71%), Postives = 98/210 (46.67%), Query Frame = 2
Query:  506 VHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            + Q +   +L G+ VT   R ++I+ L  +     + + ++   +++ DR+++        K L+L  VT  +IASK + +  P I D   ++ +      I D E+++LR ++F+   P P+ FLR  S I       H +AK   E+    Y++   P    A A Y    AL+ +     D W P ++   G   D + P++  IA+
Sbjct:  149 IEQAVRPKYLEGSEVTGNMRAILIDWLVQVQIKFKLLQETMYMTVAVIDRFLQDH--PVPKKQLQLVGVTAMFIASKYEEMYPPEIADFAFVTDRAYTTGQIRDMEMKILRVLDFSFGKPLPLQFLRRASKIGDVTAEHHTLAKYFLELTMVDYDMVHFPPSQVASARY----ALTLKVFNCGD-WTPTLQHYMGYTEDSLVPVMQHIAR 351          
BLAST of cyclin B-1 vs. UniProt/SwissProt
Match: sp|Q9DG97|CCNB1_ORYLU (G2/mitotic-specific cyclin-B1 OS=Oryzias luzonensis OX=104659 GN=ccnb1 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.505e-12
Identity = 66/265 (24.91%), Postives = 122/265 (46.04%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLN---------RVVDREFPSIYEEYETVFVVLNNRIRDL 1228
            ++ +I   +  LE V Q +  ++L G  VT   R ++I+ L  ++    + + ++   + I DR+++        K L+L  VT  ++ASK + +  P I D   ++ K    A I D E+ +LR ++F L  P P+ FLR  S I +     H +AK + E+    Y +   P  + A A    A+AL+ + L     W   ++       D + P++  IAK ++           +  + F S      T+F + ++ ++DL
Sbjct:  140 YVKDIYKYLRQLE-VEQSVKPNYLEGQEVTGNMRALLIDWLVQVSLKFRLLQETMYMTVGIIDRFLQDH--PVPKKQLQLVGVTAMFLASKYEEMYPPEISDFAYVTDKAYTTAQIRDMEMTILRVLKFQLGRPLPLQFLRRASKIYEVTAEQHTLAKYLLELSMVDYAMDHFPPSMVASA----ALALTLKVLD-AGEWDVTLQHYMAYTADTLTPVMAHIAKNVVKVNNGQTKHMTIKGKYFTSKQMRIATIFQLKSSVVKDL 396          
BLAST of cyclin B-1 vs. UniProt/SwissProt
Match: sp|O93229|CCNB2_RANJA (G2/mitotic-specific cyclin-B2 OS=Rana japonica OX=8402 GN=CCNB2 PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.065e-12
Identity = 59/228 (25.88%), Postives = 111/228 (48.68%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPAL----INDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAG-HPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            ++++I + + + E V Q +   +L G  +  + R ++++ L  + +     + ++  G++I DR+++ +    +   L+L  VT   +ASK + +  P   +V + + I D A     I + E+ +LR ++F+L  P P+ FLR  S         H +AK + E+    YE+   HPS + A A+ CLA     + +     W       TG   +D+ P+I  IAK
Sbjct:  129 YVVDIYNYLRERE-VQQSIKQRYLDGMEINERMRAILVDWLIQVNSRFQFLQETLYMGIAIMDRFLQVQ--PISRGKLQLVGVTSLLLASKYEEMYSP---EVADFAYITDNAYTTSQIREMEMIILRELKFDLGRPLPLHFLRRASKACSADAEQHTLAKYLMELTLVDYEMVHFHPSEI-AAAALCLA-----QKVLGVGSWGSTQHHYTGYTEEDLTPIIKHIAK 344          
BLAST of cyclin B-1 vs. TrEMBL
Match: I1ZII1 (Cyclin B-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 790.03 bits (2039), Expect = 0.000e+0
Identity = 388/390 (99.49%), Postives = 388/390 (99.49%), Query Frame = 2
Query:   83 ENRNSNYICENVIRNSKPNLLKESNNLLPSQTDRKLNVKSYADSNQKSSTKNVLENDVSLLSINDDSQNCRYFLPSSKDLMNSKVANKFSDDVSIRRNHNRDLTMDKLQNFKKEILRLSTDLETGKVFIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYETVFVVLNNRIRDLEVIVTGKI 1252
            ENRNSNYICENVIRNSKPNLLKESNNLLPSQTDRKLNVKSYADSNQKSSTKNVLENDVSLLSINDDSQNCRYFLPSSKDLMNSKVANKFSDDVSIRRNHNRDLTMDKLQNFKKEILRLSTDLETGKVFIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGK FN KNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYETVFVVLNNRIRDLEVIVTGKI
Sbjct:   60 ENRNSNYICENVIRNSKPNLLKESNNLLPSQTDRKLNVKSYADSNQKSSTKNVLENDVSLLSINDDSQNCRYFLPSSKDLMNSKVANKFSDDVSIRRNHNRDLTMDKLQNFKKEILRLSTDLETGKVFIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKLFNPKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYETVFVVLNNRIRDLEVIVTGKI 449          
BLAST of cyclin B-1 vs. TrEMBL
Match: A0A0R3UAY3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS4082 PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 2.241e-21
Identity = 74/255 (29.02%), Postives = 130/255 (50.98%), Query Frame = 2
Query:  443 DLETGKVFIIEILDNMIDLECVHQPLGSDFLYG-TNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPAL----INDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYET 1192
            D  +   F   I + + + E   QP+  +FL     +T + R +++N L  +  S  +   ++   ++I DRYI+K G        +L  VT  +IASK + + YP   D+ + S I D       I   E  +L+T++F L IP+PI+FLR  S   +   + HN+AK   E+    Y+LA  P +++A  + CLA+A+      ++D W   + +++G  I DIR  +  +AK +  +    ++ +IY++Y T
Sbjct:  130 DTASVSAFAETIFNYLQNRELSFQPVRPNFLDACVEITPRMRYILVNWLVQVHQSYKLLPETLYLCVAIMDRYIQKCGSEIRKGYFQLVGVTSLFIASKFEEM-YP--PDISDFSSITDNTYNKKDIRSCEQMILQTLDFYLSIPSPIVFLRRFSRALEADRLMHNLAKYFLELTIQEYDLACLPGNLRATIAICLALAICSHTSIIDDVWDEKIAYLSGYAIGDIRGPLQVLAKAVYRQNSPSKYRAIYDKYRT 381          
BLAST of cyclin B-1 vs. TrEMBL
Match: A0A5K3FWM0 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 2.407e-21
Identity = 74/255 (29.02%), Postives = 130/255 (50.98%), Query Frame = 2
Query:  443 DLETGKVFIIEILDNMIDLECVHQPLGSDFLYG-TNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPAL----INDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYET 1192
            D  +   F   I + + + E   QP+  +FL     +T + R +++N L  +  S  +   ++   ++I DRYI+K G        +L  VT  +IASK + + YP   D+ + S I D       I   E  +L+T++F L IP+PI+FLR  S   +   + HN+AK   E+    Y+LA  P +++A  + CLA+A+      ++D W   + +++G  I DIR  +  +AK +  +    ++ +IY++Y T
Sbjct:  135 DTASVSAFAETIFNYLQNRELSFQPVRPNFLDACVEITPRMRYILVNWLVQVHQSYKLLPETLYLCVAIMDRYIQKCGSEIRKGYFQLVGVTSLFIASKFEEM-YP--PDISDFSSITDNTYNKKDIRSCEQMILQTLDFYLSIPSPIVFLRRFSRALEADRLMHNLAKYFLELTIQEYDLACLPGNLRATIAICLALAICSHTSIIDDVWDEKIAYLSGYAIGDIRGPLQVLAKAVYRQNSPSKYRAIYDKYRT 386          
BLAST of cyclin B-1 vs. TrEMBL
Match: A0A5K3FX99 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.845e-21
Identity = 74/255 (29.02%), Postives = 130/255 (50.98%), Query Frame = 2
Query:  443 DLETGKVFIIEILDNMIDLECVHQPLGSDFLYG-TNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPAL----INDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYET 1192
            D  +   F   I + + + E   QP+  +FL     +T + R +++N L  +  S  +   ++   ++I DRYI+K G        +L  VT  +IASK + + YP   D+ + S I D       I   E  +L+T++F L IP+PI+FLR  S   +   + HN+AK   E+    Y+LA  P +++A  + CLA+A+      ++D W   + +++G  I DIR  +  +AK +  +    ++ +IY++Y T
Sbjct:  122 DTASVSAFAETIFNYLQNRELSFQPVRPNFLDACVEITPRMRYILVNWLVQVHQSYKLLPETLYLCVAIMDRYIQKCGSEIRKGYFQLVGVTSLFIASKFEEM-YP--PDISDFSSITDNTYNKKDIRSCEQMILQTLDFYLSIPSPIVFLRRFSRALEADRLMHNLAKYFLELTIQEYDLACLPGNLRATIAICLALAICSHTSIIDDVWDEKIAYLSGYAIGDIRGPLQVLAKAVYRQNSPSKYRAIYDKYRT 373          
BLAST of cyclin B-1 vs. TrEMBL
Match: A0A0X3PNJ9 (G2/mitotic-specific cyclin-B2 (Fragment) OS=Schistocephalus solidus OX=70667 GN=CCNB2 PE=3 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 3.032e-21
Identity = 68/236 (28.81%), Postives = 129/236 (54.66%), Query Frame = 2
Query:  494 DLECVHQPLGSDFLYG-TNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPAL----INDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEY 1186
            +L C  QPL S FL   T ++ + R +++N L  +  S  ++  ++   ++I DRY++K G        +L  +T  +IASK + + YP   D+ + S I D       I   E  +L++++F L IP+PI+FLR +S   +     HN++K   E+    Y+LA  P +++A  + CL++A+   + +++D W   + +++G  IDD+R  +  +AK +  +    ++ +IY++Y
Sbjct:  180 ELRC--QPLSSTFLSACTEISPRMRYILVNWLVQVHQSYKLQPETLYLCIAIMDRYLQKCGSGITKDLFQLVGITALFIASKFEEM-YP--PDIGDFSSITDNTYTKRDIRTCEQLILQSLDFYLSIPSPIVFLRRISRALEADRRMHNLSKYFLELTIQEYDLAYLPGNLKAVVAACLSLAVCAHSDKIDDVWNEKLAYISGYSIDDVRGPVRILAKAVYRQNSPSKYRAIYDKY 410          
BLAST of cyclin B-1 vs. Ensembl Cavefish
Match: ccnb1 (cyclin B1 [Source:NCBI gene;Acc:103046107])

HSP 1 Score: 77.411 bits (189), Expect = 4.269e-15
Identity = 96/381 (25.20%), Postives = 158/381 (41.47%), Query Frame = 2
Query:   77 LRENRNSNYICENVIRNSKPNL-----LKE-SNNLLPSQT-DRKLNVKSYADSN---------QKSSTKNVLENDVSLLS-----INDDSQNCRYFLPSSKDLMNSKVANKFSD------DVSIRRNHNRDLTMDKLQNFKKEILRLSTDLETGKVFIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGH-PSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            L  + N N +    +  SKP+L     L E  N +LP QT  +K +VK  A +          Q       ++N+V LLS     +  ++  C     + +DL  +     FSD      DV      N  L  + +++  K + +L  D                      Q +   +L G  VT   R ++I+ L  +     + + ++   ++I DR+++        K L+L  VT  +IASK + +  P I D   ++ +    A I D E+ +LR ++F+   P P+ FLR  S I +     H +AK   E+    Y++    PS V   AS   A+ L   N      W P ++F  G   D + P++  IAK
Sbjct:   11 LASSENQNAVAGKAVVASKPSLRPRNALGEIGNAVLPRQTLKKKQDVKPAAPAVVEKVVEPVKQPKKEVPAVQNEVQLLSEPSSPVPMETSGC-----APEDLCQA-----FSDVLLNIKDVDADDYDNPMLCSEYVKDIYKYLRQLEAD----------------------QAVRPRYLEGREVTGNMRAILIDWLVQVQIKFRLLQETMYMTVAIIDRFLQDH--PVPKKRLQLVGVTAMFIASKYEEMYPPEIADFAFVTDRAYTTAEIRDMEMNILRVLKFSFGRPLPLQFLRRASKIGEVTAEHHTLAKYFVELTMVDYDMVHFAPSQV---ASAAFALMLKVFNC---GEWTPTLQFYMGYAEDSLIPVMQHIAK 351          
BLAST of cyclin B-1 vs. Ensembl Cavefish
Match: ccnb1 (cyclin B1 [Source:NCBI gene;Acc:103046107])

HSP 1 Score: 76.6406 bits (187), Expect = 9.515e-15
Identity = 96/381 (25.20%), Postives = 158/381 (41.47%), Query Frame = 2
Query:   77 LRENRNSNYICENVIRNSKPNL-----LKE-SNNLLPSQT-DRKLNVKSYADSN---------QKSSTKNVLENDVSLLS-----INDDSQNCRYFLPSSKDLMNSKVANKFSD------DVSIRRNHNRDLTMDKLQNFKKEILRLSTDLETGKVFIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGH-PSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            L  + N N +    +  SKP+L     L E  N +LP QT  +K +VK  A +          Q       ++N+V LLS     +  ++  C     + +DL  +     FSD      DV      N  L  + +++  K + +L  D                      Q +   +L G  VT   R ++I+ L  +     + + ++   ++I DR+++        K L+L  VT  +IASK + +  P I D   ++ +    A I D E+ +LR ++F+   P P+ FLR  S I +     H +AK   E+    Y++    PS V   AS   A+ L   N      W P ++F  G   D + P++  IAK
Sbjct:   11 LASSENQNAVAGKAVVASKPSLRPRNALGEIGNAVLPRQTLKKKQDVKPAAPAVVEKVVEPVKQPKKEVPAVQNEVQLLSEPSSPVPMETSGC-----APEDLCQA-----FSDVLLNIKDVDADDYDNPMLCSEYVKDIYKYLRQLEAD----------------------QAVRPRYLEGREVTGNMRAILIDWLVQVQIKFRLLQETMYMTVAIIDRFLQ--DHPVPKKRLQLVGVTAMFIASKYEEMYPPEIADFAFVTDRAYTTAEIRDMEMNILRVLKFSFGRPLPLQFLRRASKIGEVTAEHHTLAKYFVELTMVDYDMVHFAPSQV---ASAAFALMLKVFNC---GEWTPTLQFYMGYAEDSLIPVMQHIAK 351          
BLAST of cyclin B-1 vs. Ensembl Cavefish
Match: ccnb1 (cyclin B1 [Source:NCBI gene;Acc:103046107])

HSP 1 Score: 73.559 bits (179), Expect = 6.937e-14
Identity = 59/209 (28.23%), Postives = 98/209 (46.89%), Query Frame = 2
Query:  512 QPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGH-PSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            Q +   +L G  VT   R ++I+ L  +     + + ++   ++I DR+++        K L+L  VT  +IASK + +  P I D   ++ +    A I D E+ +LR ++F+   P P+ FLR  S I +     H +AK   E+    Y++    PS V   AS   A+ L   N      W P ++F  G   D + P++  IAK
Sbjct:  140 QAVRPRYLEGREVTGNMRAILIDWLVQVQIKFRLLQETMYMTVAIIDRFLQDH--PVPKKRLQLVGVTAMFIASKYEEMYPPEIADFAFVTDRAYTTAEIRDMEMNILRVLKFSFGRPLPLQFLRRASKIGEVTAEHHTLAKYFVELTMVDYDMVHFAPSQV---ASAAFALMLKVFNC---GEWTPTLQFYMGYAEDSLIPVMQHIAK 340          
BLAST of cyclin B-1 vs. Ensembl Cavefish
Match: ccnb2 (G2/mitotic-specific cyclin-B2 [Source:NCBI gene;Acc:103043733])

HSP 1 Score: 57.7658 bits (138), Expect = 1.134e-8
Identity = 53/215 (24.65%), Postives = 99/215 (46.05%), Query Frame = 2
Query:  506 VHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPAL----INDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAG-HPSHVQACASYCLAMALSFRNLQLEDH-WPPIMRFVTGIDIDDIRPLIVAIAK 1132
              Q +   ++ G  +  + R ++++ L  + +   + + ++   ++I DR+++ +  S   K L+LA VT   +ASK + +  P   +V + + I D A     I + E+ +LR + F L  P P+ FLR  S         H +AK   E+    Y++   HPS + A A  CL+       L ++   W P     T      ++P++  +AK
Sbjct:  164 AQQSIRPRYMDGYEINERMRALLVDWLIQVHSRFQLLQETLYMTVAILDRFLQVQPVS--RKKLQLAGVTAMLLASKYEEMFVP---EVGDFAYITDNAFTKPQIREMEMIILRELNFELGRPLPLHFLRRASKAGNADAEKHTLAKYFLELTLLDYDMVHYHPSEIGA-AGLCLS------QLVIDGQKWSPTQEHYTTYSEAHLKPIMQHMAK 366          
BLAST of cyclin B-1 vs. Ensembl Cavefish
Match: ccnb2 (G2/mitotic-specific cyclin-B2 [Source:NCBI gene;Acc:103043733])

HSP 1 Score: 56.9954 bits (136), Expect = 2.040e-8
Identity = 52/215 (24.19%), Postives = 99/215 (46.05%), Query Frame = 2
Query:  506 VHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPAL----INDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAG-HPSHVQACASYCLAMALSFRNLQLEDH-WPPIMRFVTGIDIDDIRPLIVAIAK 1132
              Q +   ++ G  +  + R ++++ L  + +   + + ++   ++I DR+++ +    + K L+LA VT   +ASK + +  P   +V + + I D A     I + E+ +LR + F L  P P+ FLR  S         H +AK   E+    Y++   HPS + A A  CL+       L ++   W P     T      ++P++  +AK
Sbjct:  133 AQQSIRPRYMDGYEINERMRALLVDWLIQVHSRFQLLQETLYMTVAILDRFLQVQ--PVSRKKLQLAGVTAMLLASKYEEMFVP---EVGDFAYITDNAFTKPQIREMEMIILRELNFELGRPLPLHFLRRASKAGNADAEKHTLAKYFLELTLLDYDMVHYHPSEIGA-AGLCLS------QLVIDGQKWSPTQEHYTTYSEAHLKPIMQHMAK 335          
BLAST of cyclin B-1 vs. Ensembl Sea Lamprey
Match: ccnb2 (cyclin B2 [Source:ZFIN;Acc:ZDB-GENE-030429-12])

HSP 1 Score: 65.855 bits (159), Expect = 4.762e-12
Identity = 51/209 (24.40%), Postives = 100/209 (47.85%), Query Frame = 2
Query:  512 QPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAG-HPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            Q + +++L G  +  + R+++++ L  +     + + ++   ++I DRY++     F+  NL+L  VT  +IA+K + +  P +ED   ++      A I   E  +L  ++FNL  P P+ FLR  S         H +AK + E+    Y +   HPS + A A Y        + L  +  W   +++ T    +++ P++  +AK
Sbjct:  150 QSVQANYLEGKKINGRMRSILVDWLVQVQMKFRLLQETLYLTVAIIDRYLQ--VVPFSLVNLQLVGVTAMFIAAKYEEMYSPEMEDFVYITDHAYTKAEIRAMEQAILLGLQFNLGRPLPLHFLRRASKAGSVDADKHTLAKYLMELSLVDYNMVHFHPSQIAAAALYL------SQKLMDDSKWNMDLQYYTTYTEEELMPVVQHLAK 350          
BLAST of cyclin B-1 vs. Ensembl Yeast
Match: CLB2 (B-type cyclin involved in cell cycle progression; activates Cdc28p to promote the transition from G2 to M phase; accumulates during G2 and M, then targeted via a destruction box motif for ubiquitin-mediated degradation by the proteasome; CLB2 has a paralog, CLB1, that arose from the whole genome duplication [Source:SGD;Acc:S000006323])

HSP 1 Score: 68.1662 bits (165), Expect = 8.211e-13
Identity = 61/244 (25.00%), Postives = 115/244 (47.13%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSK---IEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAG-HPSHVQACASYCLAMALSFRNLQLEDHWPP-IMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYE 1180
            ++ +I + +  LE +  P   D     N+  Q R++++N L  + N   +   ++   ++I DR++ K+    +   L+L   +C +IASK + +  P I+     +     ED   I + E  +L+T++FNL  P P+ FLR +S        S  +AK + EI    +   G  PS    CA+  + M+   R +  +  W   ++ +  G   +++ P+   I  YL++ +V  EF   Y+
Sbjct:  229 YVNDIFEYLHQLEVITLPKKEDLYQHRNIH-QNRDILVNWLVKIHNKFGLLPETLYLAINIMDRFLGKELVQLDK--LQLVGTSCLFIASKYEEVYSPSIKHFASETDGACTEDE--IKEGEKFILKTLKFNLNYPNPMNFLRRISKADDYDIQSRTLAKFLLEISLVDFRFIGILPS---LCAAAAMFMS---RKMLGKGKWDGNLIHYSGGYTKEELAPVCHMIMDYLVSPIVHDEFHRKYQ 461          
BLAST of cyclin B-1 vs. Ensembl Yeast
Match: CLB5 (B-type cyclin involved in DNA replication during S phase; activates Cdc28p to promote initiation of DNA synthesis; functions in formation of mitotic spindles along with Clb3p and Clb4p; most abundant during late G1 phase; CLB5 has a paralog, CLB6, that arose from the whole genome duplication [Source:SGD;Acc:S000006324])

HSP 1 Score: 50.447 bits (119), Expect = 3.241e-7
Identity = 48/162 (29.63%), Postives = 79/162 (48.77%), Query Frame = 2
Query:  635 GMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPAL----INDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAG-HPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDI 1105
             +++ DR++ K   + N   L+L  VT  +IA+K + +  P    + E + I D A     I + E+ +L ++EFN+  P P+ FLR +S       V+ NI K I E     ++     PS V A A Y +A  ++ RN    + W   ++  +G  ID I
Sbjct:  222 SINLMDRFLAKNKVTMNK--LQLLAVTSLFIAAKFEEVNLP---KLAEYAYITDGAASKNDIKNAEMFMLTSLEFNIGWPNPLNFLRRISKADDYDPVNRNIGKFILEYAYCCHQFIHLPPSTVSAMAMY-IARRMTNRNKN--ELWNGTLQHYSG-GIDPI 374          
BLAST of cyclin B-1 vs. Ensembl Nematostella
Match: EDO39942 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8H6])

HSP 1 Score: 47.3654 bits (111), Expect = 4.126e-6
Identity = 34/147 (23.13%), Postives = 69/147 (46.94%), Query Frame = 2
Query:  548 VTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIED---VCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGH 979
            +TI  R ++++ L  +  S  +   ++  G+ + D Y+ +       +NL+L      YIA K +    PC++D   +C+    +  A +   E ++L ++EFN+ +P P  FLR  + +      +  +++ I E     Y+   H
Sbjct:    7 LTISMRAILVDWLVEVQESFELYHETLYLGVRVLDNYLMRS--YVERENLQLVGAVSLYIACKVEERHPPCLDDFLYICD-DAYQQKAFVA-MEKKILNSLEFNINMPIPYRFLRRFAKVASADVKTLTLSRFILETTLHHYKFIVH 149          
BLAST of cyclin B-1 vs. Ensembl Medaka
Match: ccnb1 (cyclin B1 [Source:NCBI gene;Acc:100049212])

HSP 1 Score: 72.0182 bits (175), Expect = 2.483e-13
Identity = 57/224 (25.45%), Postives = 107/224 (47.77%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            ++ +I   +  LE + Q +  ++L G  +T   R ++I+ L  +     + + ++   + I DR+++        K L+L  VT  ++ASK + +  P I D   ++ +    A I D E+ +LR ++F L  P P+ FLR  S I +     H +AK + E+    Y++A  P  + A A    A+AL+ + L     W   ++       + + P++  IAK
Sbjct:  104 YVKDIYKYLRQLE-MEQSVKPNYLEGQEITGNMRAILIDWLVQVGLKFRLLQETMYMTVGIIDRFLQDH--PVPKKQLQLVGVTAMFLASKYEEMYPPEISDFAYVTDRAYTTAQIRDMEMTILRVLKFQLGRPLPLQFLRRASKIYEVTAEQHTLAKYLLELSMVDYDMAHFPPSLVASA----ALALTLKVLD-AGEWDVTLQHYMEYTAETLTPVMAHIAK 319          
BLAST of cyclin B-1 vs. Ensembl Medaka
Match: ccnb1 (cyclin B1 [Source:NCBI gene;Acc:100049212])

HSP 1 Score: 71.2478 bits (173), Expect = 3.858e-13
Identity = 54/210 (25.71%), Postives = 100/210 (47.62%), Query Frame = 2
Query:  506 VHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            + Q +  ++L G  +T   R ++I+ L  +     + + ++   + I DR+++        K L+L  VT  ++ASK + +  P I D   ++ +    A I D E+ +LR ++F L  P P+ FLR  S I +     H +AK + E+    Y++A  P  + A A    A+AL+ + L     W   ++       + + P++  IAK
Sbjct:  156 MEQSVKPNYLEGQEITGNMRAILIDWLVQVGLKFRLLQETMYMTVGIIDRFLQDH--PVPKKQLQLVGVTAMFLASKYEEMYPPEISDFAYVTDRAYTTAQIRDMEMTILRVLKFQLGRPLPLQFLRRASKIYEVTAEQHTLAKYLLELSMVDYDMAHFPPSLVASA----ALALTLKVLD-AGEWDVTLQHYMEYTAETLTPVMAHIAK 358          
BLAST of cyclin B-1 vs. Ensembl Medaka
Match: ccnb1 (cyclin B1 [Source:NCBI gene;Acc:100049212])

HSP 1 Score: 71.2478 bits (173), Expect = 4.540e-13
Identity = 57/224 (25.45%), Postives = 107/224 (47.77%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELS-KIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAK 1132
            ++ +I   +  LE + Q +  ++L G  +T   R ++I+ L  +     + + ++   + I DR+++        K L+L  VT  ++ASK + +  P I D   ++ +    A I D E+ +LR ++F L  P P+ FLR  S I +     H +AK + E+    Y++A  P  + A A    A+AL+ + L     W   ++       + + P++  IAK
Sbjct:  143 YVKDIYKYLRQLE-MEQSVKPNYLEGQEITGNMRAILIDWLVQVGLKFRLLQETMYMTVGIIDRFLQDH--PVPKKQLQLVGVTAMFLASKYEEMYPPEISDFAYVTDRAYTTAQIRDMEMTILRVLKFQLGRPLPLQFLRRASKIYEVTAEQHTLAKYLLELSMVDYDMAHFPPSLVASA----ALALTLKVLD-AGEWDVTLQHYMEYTAETLTPVMAHIAK 358          
BLAST of cyclin B-1 vs. Ensembl Medaka
Match: ccnb2 (cyclin B2 [Source:NCBI gene;Acc:100049213])

HSP 1 Score: 58.151 bits (139), Expect = 6.985e-9
Identity = 55/225 (24.44%), Postives = 107/225 (47.56%), Query Frame = 2
Query:  509 HQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPAL----INDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGH-PSHVQACASYCLAMAL------SFRNLQL----EDHWPPIMRFVTG--IDIDDIRPLIVAIAK 1132
             QP+ ++++ G  VT + R ++++ L  + +   + + ++   ++I DR+++      + + L+L  VT   +A K + +  P   +V + + I D A     I + E  +LR++ F L  P P+ FLR  + +       H +AK + E+    Y +  + PS V A A+ CL+  L      S    Q     E H  PIM+ +    + +++ R   +A+ K
Sbjct:  138 QQPVRANYMQGYEVTERMRALLVDWLVQVHSRFQLLQETLYLTVAILDRFLQVH--PVSRRKLQLVGVTAMLVACKYEEMYAP---EVGDFAYITDNAFTKSQIVEMEQVILRSLSFQLGRPLPLHFLRRATKVAGADVEKHTLAKYLMELTLLDYHMVHYRPSEV-AAAALCLSQLLLDGLPWSLTQQQYSTYEEQHLKPIMQHMAKNVVLVNEGRTKFLAVKK 356          
BLAST of cyclin B-1 vs. Ensembl Medaka
Match: ccnb3 (cyclin B3 [Source:NCBI gene;Acc:101158560])

HSP 1 Score: 56.9954 bits (136), Expect = 1.539e-8
Identity = 49/203 (24.14%), Postives = 96/203 (47.29%), Query Frame = 2
Query:  518 LGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIED---VCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLI 1117
            L +  L  T++  + R ++++ L  +  +  +   ++   + + D Y+ K   S + + L+L   T   IASK +    PC++D   +C+    +   LI+  E  +L+T+ F++ IP P  FLR  +        +  +A+   E+     +L      + A A  CL MAL  ++L     W PI++F +G    ++ P++
Sbjct:  141 LSNYMLTHTSLNPEMRAILVDWLVEVQENFELYHETLYLAVKMTDHYLSKA--SIHREMLQLVGSTAMLIASKFEERSPPCVDDFLYICD-DAYKREELIS-MEASILQTLSFDINIPIPYRFLRRYAKCVSASMETLTLARYYCEMSLMEMDLVSERGSLLASA--CLLMALITKDL---GSWSPILQFHSGYQASEVAPVV 334          
BLAST of cyclin B-1 vs. Planmine SMEST
Match: SMESG000028669.1 (SMESG000028669.1)

HSP 1 Score: 632.098 bits (1629), Expect = 0.000e+0
Identity = 308/310 (99.35%), Postives = 308/310 (99.35%), Query Frame = 2
Query:  323 MNSKVANKFSDDVSIRRNHNRDLTMDKLQNFKKEILRLSTDLETGKVFIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYETVFVVLNNRIRDLEVIVTGKI 1252
            MNSKVANKFSDDVSIRRNHNRDLTMDKLQNFKKEILRLSTDLETGKVFIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGK FN KNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYETVFVVLNNRIRDLEVIVTGKI
Sbjct:    1 MNSKVANKFSDDVSIRRNHNRDLTMDKLQNFKKEILRLSTDLETGKVFIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKLFNPKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYETVFVVLNNRIRDLEVIVTGKI 310          
BLAST of cyclin B-1 vs. Planmine SMEST
Match: SMESG000030455.1 (SMESG000030455.1)

HSP 1 Score: 395.586 bits (1015), Expect = 6.978e-136
Identity = 189/339 (55.75%), Postives = 252/339 (74.34%), Query Frame = 2
Query:  233 KNVLENDVSLLSINDDSQNCRYFLPSSKDLMNSKVANKFSDDVSIRRNHNRDLTMDKLQNFKKEILRLSTDLETGKVFIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEYETVFVVLNNRIRDLEVIVTGK 1249
            K  LEND+S++SINDDSQNCRYFLPSS+D  N  V +KFS+D   RR  NRDLT+DKL+ +K +I  LS   +TG+  I+EI+DN++D EC   PLGS+FL GTNVT QQRN I++ L+  ++ L++ERY+V N M++FDRY+ +KGK+  A +L +  +TC YIA K DL++YP I+ + E+  IE    I+  E EV+  I+FN+C PTPILFLRPL++IKQR  VSH++AKV+ E+CT+VYELAGHPSHVQACASY +++ LSFR  Q E  W PI+RFVTG+D DDIRP+IV +AKYLL   V  +FP +Y E+  +F +  NR  DL+ I+TGK
Sbjct:   23 KQTLENDLSMISINDDSQNCRYFLPSSQDFKNPGVTHKFSEDAKTRRQLNRDLTVDKLRKYKMKIYTLSYRDQTGRTCILEIMDNIVDQECSCLPLGSNFLEGTNVTSQQRNSIVDRLYESSSELNIERYTVSNAMAMFDRYVTRKGKNLIADDLTILAMTCLYIACKNDLIQYPHIDQMYEIFDIEPTIPISKLEAEVINVIDFNICNPTPILFLRPLTVIKQRVLVSHSLAKVLCELCTSVYELAGHPSHVQACASYFISLVLSFRKYQPEAIWTPIIRFVTGLDCDDIRPVIVTMAKYLLTEKVKLQFPLLYNEHRKLFDIFPNRKEDLKKIITGK 361          
BLAST of cyclin B-1 vs. Planmine SMEST
Match: SMESG000030455.1 (SMESG000030455.1)

HSP 1 Score: 374.4 bits (960), Expect = 5.465e-128
Identity = 178/312 (57.05%), Postives = 235/312 (75.32%), Query Frame = 2
Query:  233 KNVLENDVSLLSINDDSQNCRYFLPSSKDLMNSKVANKFSDDVSIRRNHNRDLTMDKLQNFKKEILRLSTDLETGKVFIIEILDNMIDLECVHQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFP 1168
            K  LEND+S++SINDDSQNCRYFLPSS+D  N  V +KFS+D   RR  NRDLT+DKL+ +K +I  LS   +TG+  I+EI+DN++D EC   PLGS+FL GTNVT QQRN I++ L+  ++ L++ERY+V N M++FDRY+ +KGK+  A +L +  +TC YIA K DL++YP I+ + E+  IE    I+  E EV+  I+FN+C PTPILFLRPL++IKQR  VSH++AKV+ E+CT+VYELAGHPSHVQACASY +++ LSFR  Q E  W PI+RFVTG+D DDIRP+IV +AKYLL   V  +FP
Sbjct:   23 KQTLENDLSMISINDDSQNCRYFLPSSQDFKNPGVTHKFSEDAKTRRQLNRDLTVDKLRKYKMKIYTLSYRDQTGRTCILEIMDNIVDQECSCLPLGSNFLEGTNVTSQQRNSIVDRLYESSSELNIERYTVSNAMAMFDRYVTRKGKNLIADDLTILAMTCLYIACKNDLIQYPHIDQMYEIFDIEPTIPISKLEAEVINVIDFNICNPTPILFLRPLTVIKQRVLVSHSLAKVLCELCTSVYELAGHPSHVQACASYFISLVLSFRKYQPEAIWTPIIRFVTGLDCDDIRPVIVTMAKYLLTEKVKLQFP 334          
BLAST of cyclin B-1 vs. Planmine SMEST
Match: SMESG000060055.1 (SMESG000060055.1)

HSP 1 Score: 77.7962 bits (190), Expect = 2.656e-15
Identity = 55/244 (22.54%), Postives = 119/244 (48.77%), Query Frame = 2
Query:  464 FIIEILDNMIDLECVHQPLGSDFLYGT-NVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIED-VCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFR-NLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYLLNRVVDREFPSIYEEY 1186
            ++  I+D + + E     LG  FL  +  ++ + R + IN L    +  S+   ++   +S+ DR+IK +  +  + +L +  + C +IA+K + +  P + D V  L++        + E+++L TI+F L IP PI F+R  + +    + S  +++   E+    YE +G  +++   +   LA  +S +   +  D W P ++  +G+   D + L+  +   +  +    +F +I ++Y
Sbjct:  147 YLANIIDYLNECEIFCDVLGRHFLECSREISPRHRYIFINWLVDAHSQFSLCAETLYLAISLSDRFIKAQKATLVSNDLIVIGIVCLFIAAKVEEVWPPSLNDIVATLTQDYTEEFCRELELKILSTIDFKLAIPMPISFIRHYNFLFDSDHFSQYLSRYFCELSLQDYEASGQSNNLIGASCVFLAQIISKKVTSEFSDIWNPKLQAASGLVYADFKDLVKNLGIIVHKQATFSKFRAITQKY 390          
BLAST of cyclin B-1 vs. Planmine SMEST
Match: SMESG000077303.1 (SMESG000077303.1)

HSP 1 Score: 63.929 bits (154), Expect = 2.066e-11
Identity = 51/205 (24.88%), Postives = 98/205 (47.80%), Query Frame = 2
Query:  590 SLANSLSVERYSVQNGMSIFDRYIKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPC----IEDVCELSKIEDPALINDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTAVYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIRPLIVAIAKYL--LNRVVDREFPSIYEEY 1186
            ++AN   +   S+   +++FD Y +   K +N   L +  +  W IASK +   +P     I +   L+  E        E+++L  ++F++ +PTPI FLR  + I       H  AK I ++     +  G    + A +S+C+A+ L  +  ++ D W  +++  +  D  +I P++  +   L  LNR+  +  P +Y+ Y
Sbjct:    5 TIANKTEISNDSIHLAIALFDYYYQIVKKDYN---LYIGIIMLW-IASKIED-SFPISLKNIINHTHLNYDEIHGQCKTMELDILNELDFDVNLPTPIQFLRHFTKIVHTTETCHQTAKFIIDLTLTDNKFIGLNYSLMAASSFCIALDLIKKVPEMGDSWNTLLKRYSSFDKSNILPVMKEMVAMLINLNRLSKQLLP-LYKRY 203          
The following BLAST results are available for this feature:
BLAST of cyclin B-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCNB19.355e-1227.17cyclin B1 [Source:HGNC Symbol;Acc:HGNC:1579][more]
CCNB13.276e-1125.48cyclin B1 [Source:HGNC Symbol;Acc:HGNC:1579][more]
CCNB13.587e-1125.48cyclin B1 [Source:HGNC Symbol;Acc:HGNC:1579][more]
CCNB19.565e-1127.01cyclin B1 [Source:HGNC Symbol;Acc:HGNC:1579][more]
CCNB29.631e-1024.44cyclin B2 [Source:HGNC Symbol;Acc:HGNC:1580][more]
back to top
BLAST of cyclin B-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cyb-34.770e-723.44G2/mitotic-specific cyclin-B3 [Source:UniProtKB/S... [more]
cyb-35.270e-723.44G2/mitotic-specific cyclin-B3 [Source:UniProtKB/S... [more]
cyb-35.270e-723.44G2/mitotic-specific cyclin-B3 [Source:UniProtKB/S... [more]
back to top
BLAST of cyclin B-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CycB4.407e-1528.63gene:FBgn0000405 transcript:FBtr0309858[more]
CycB4.487e-1528.63gene:FBgn0000405 transcript:FBtr0071913[more]
CycB4.673e-1528.63gene:FBgn0000405 transcript:FBtr0071914[more]
CycB5.059e-1528.63gene:FBgn0000405 transcript:FBtr0071911[more]
back to top
BLAST of cyclin B-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnb12.631e-1426.92cyclin B1 [Source:ZFIN;Acc:ZDB-GENE-000406-10][more]
ccnb33.319e-722.58cyclin B3 [Source:ZFIN;Acc:ZDB-GENE-060929-684][more]
ccnb33.319e-722.58cyclin B3 [Source:ZFIN;Acc:ZDB-GENE-060929-684][more]
ccnb33.319e-722.58cyclin B3 [Source:ZFIN;Acc:ZDB-GENE-060929-684][more]
ccnb21.727e-622.33cyclin B2 [Source:ZFIN;Acc:ZDB-GENE-030429-12][more]
back to top
BLAST of cyclin B-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nyap18.450e-1426.79neuronal tyrosine-phosphorylated phosphoinositide-... [more]
nyap18.694e-1426.79neuronal tyrosine-phosphorylated phosphoinositide-... [more]
ccnb15.704e-1324.04cyclin B1 [Source:NCBI gene;Acc:100101736][more]
ccnb16.124e-1324.04cyclin B1 [Source:NCBI gene;Acc:100101736][more]
ENSXETT00000018933.19.891e-1326.39cyclin B5 [Source:NCBI gene;Acc:394448][more]
back to top
BLAST of cyclin B-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ccnb11.212e-1025.84cyclin B1 [Source:MGI Symbol;Acc:MGI:88302][more]
Ccnb11.621e-1025.00cyclin B1 [Source:MGI Symbol;Acc:MGI:88302][more]
Ccnb28.705e-1026.20cyclin B2 [Source:MGI Symbol;Acc:MGI:88311][more]
Ccnb12.447e-925.86cyclin B1 [Source:MGI Symbol;Acc:MGI:88302][more]
back to top
BLAST of cyclin B-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20439|CCNB_DROME5.071e-1428.63G2/mitotic-specific cyclin-B OS=Drosophila melanog... [more]
sp|Q9DGA4|CCNB1_ORYCU2.281e-1327.23G2/mitotic-specific cyclin-B1 OS=Oryzias curvinotu... [more]
sp|Q92162|CCNB1_CARAU5.518e-1325.71G2/mitotic-specific cyclin-B1 OS=Carassius auratus... [more]
sp|Q9DG97|CCNB1_ORYLU1.505e-1224.91G2/mitotic-specific cyclin-B1 OS=Oryzias luzonensi... [more]
sp|O93229|CCNB2_RANJA2.065e-1225.88G2/mitotic-specific cyclin-B2 OS=Rana japonica OX=... [more]
back to top
BLAST of cyclin B-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZII10.000e+099.49Cyclin B-1 OS=Schmidtea mediterranea OX=79327 PE=2... [more]
A0A0R3UAY32.241e-2129.02Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FWM02.407e-2129.02Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FX992.845e-2129.02Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0X3PNJ93.032e-2128.81G2/mitotic-specific cyclin-B2 (Fragment) OS=Schist... [more]
back to top
BLAST of cyclin B-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnb14.269e-1525.20cyclin B1 [Source:NCBI gene;Acc:103046107][more]
ccnb19.515e-1525.20cyclin B1 [Source:NCBI gene;Acc:103046107][more]
ccnb16.937e-1428.23cyclin B1 [Source:NCBI gene;Acc:103046107][more]
ccnb21.134e-824.65G2/mitotic-specific cyclin-B2 [Source:NCBI gene;Ac... [more]
ccnb22.040e-824.19G2/mitotic-specific cyclin-B2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of cyclin B-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccnb24.762e-1224.40cyclin B2 [Source:ZFIN;Acc:ZDB-GENE-030429-12][more]
back to top
BLAST of cyclin B-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CLB28.211e-1325.00B-type cyclin involved in cell cycle progression; ... [more]
CLB53.241e-729.63B-type cyclin involved in DNA replication during S... [more]
back to top
BLAST of cyclin B-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO399424.126e-623.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cyclin B-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnb12.483e-1325.45cyclin B1 [Source:NCBI gene;Acc:100049212][more]
ccnb13.858e-1325.71cyclin B1 [Source:NCBI gene;Acc:100049212][more]
ccnb14.540e-1325.45cyclin B1 [Source:NCBI gene;Acc:100049212][more]
ccnb26.985e-924.44cyclin B2 [Source:NCBI gene;Acc:100049213][more]
ccnb31.539e-824.14cyclin B3 [Source:NCBI gene;Acc:101158560][more]
back to top
BLAST of cyclin B-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028669.10.000e+099.35SMESG000028669.1[more]
SMESG000030455.16.978e-13655.75SMESG000030455.1[more]
SMESG000030455.15.465e-12857.05SMESG000030455.1[more]
SMESG000060055.12.656e-1522.54SMESG000060055.1[more]
SMESG000077303.12.066e-1124.88SMESG000077303.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014394
GenBankAFJ24835.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014394 ID=SMED30014394|Name=cyclin B-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1360bp
GATCTTTATGGAGTTGTTTAAATTTGACAGAAAATAAGAAATTAAATTTT
TATAACTAATGGAAAACTTAAATTTTTTAAGAGAGAATCGAAATAGTAAT
TATATTTGTGAAAATGTCATTAGGAATTCTAAACCTAATTTATTGAAAGA
ATCTAATAATTTGTTGCCTTCTCAAACAGATAGAAAATTAAATGTTAAAA
GTTATGCTGATAGTAATCAAAAATCATCCACAAAAAATGTACTCGAAAAT
GATGTTTCTTTACTTTCCATTAATGATGATTCTCAAAATTGCAGATATTT
TTTGCCGTCTTCTAAAGACTTAATGAATTCCAAAGTTGCTAATAAATTTT
CAGATGATGTTAGCATTCGTCGAAATCACAATCGTGATTTAACGATGGAT
AAATTACAAAATTTTAAAAAAGAAATATTGAGACTGTCTACCGATTTAGA
AACTGGAAAAGTTTTTATAATAGAGATTCTAGATAATATGATCGACTTAG
AGTGTGTTCATCAACCTTTGGGATCTGATTTTTTGTACGGAACAAATGTA
ACCATTCAACAACGAAATGTCATTATTAATAATTTATTTTCGTTGGCCAA
TTCATTATCTGTAGAACGATATTCAGTTCAAAATGGAATGTCTATTTTCG
ATAGATATATCAAGAAAAAAGGAAAATCATTTAATGCCAAGAATTTAAAA
TTGGCATATGTAACATGTTGGTATATTGCTAGCAAAACTGATCTTCTAGA
ATATCCTTGCATTGAAGACGTTTGTGAATTGTCTAAAATCGAAGATCCGG
CTTTAATTAACGATTTCGAAGTTGAAGTTCTTCGCACCATTGAATTTAAT
TTGTGTATTCCAACTCCGATTTTGTTTCTTCGTCCACTTTCGCTTATTAA
ACAAAGGAGAAATGTTAGTCATAATATTGCCAAAGTCATTTCTGAAATAT
GCACAGCTGTGTATGAATTGGCTGGCCATCCCTCGCATGTTCAAGCTTGT
GCATCGTATTGTTTAGCGATGGCTTTGAGTTTTCGTAATTTGCAATTAGA
AGATCATTGGCCTCCGATTATGAGATTTGTCACAGGGATTGACATTGATG
ATATTCGACCGCTAATTGTTGCAATAGCAAAATATTTGTTAAATAGAGTT
GTTGATAGAGAATTTCCATCGATATATGAAGAGTACGAGACGGTTTTTGT
AGTTCTTAACAACCGTATTCGTGATTTGGAAGTTATAGTTACTGGAAAAA
TTTAGGTCTTATCTATCATTTTGTTATCGTTGTACAATAAAATTATATCG
ATGTTTATTTACTGTCTTTATGATGGGCTCATGTTTTGATTTGTATTGAA
TATGAATAAA
back to top

protein sequence of SMED30014394-orf-1

>SMED30014394-orf-1 ID=SMED30014394-orf-1|Name=SMED30014394-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=399bp
MENLNFLRENRNSNYICENVIRNSKPNLLKESNNLLPSQTDRKLNVKSYA
DSNQKSSTKNVLENDVSLLSINDDSQNCRYFLPSSKDLMNSKVANKFSDD
VSIRRNHNRDLTMDKLQNFKKEILRLSTDLETGKVFIIEILDNMIDLECV
HQPLGSDFLYGTNVTIQQRNVIINNLFSLANSLSVERYSVQNGMSIFDRY
IKKKGKSFNAKNLKLAYVTCWYIASKTDLLEYPCIEDVCELSKIEDPALI
NDFEVEVLRTIEFNLCIPTPILFLRPLSLIKQRRNVSHNIAKVISEICTA
VYELAGHPSHVQACASYCLAMALSFRNLQLEDHWPPIMRFVTGIDIDDIR
PLIVAIAKYLLNRVVDREFPSIYEEYETVFVVLNNRIRDLEVIVTGKI*
back to top
Aliases
The feature 'cyclin B-1' has the following synonyms
Synonym
cyclin B-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR039361Cyclin
IPR036915Cyclin-like_sf
IPR004367Cyclin_C-dom
IPR006671Cyclin_N
IPR013763Cyclin-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004367Cyclin, C-terminal domainSMARTSM01332Cyclin_C_2coord: 268..385
e-value: 7.1E-4
score: 28.9
IPR004367Cyclin, C-terminal domainPFAMPF02984Cyclin_Ccoord: 268..377
e-value: 3.1E-10
score: 40.2
NoneNo IPR availableGENE3DG3DSA:1.10.472.10coord: 261..384
e-value: 2.8E-15
score: 58.6
NoneNo IPR availableGENE3DG3DSA:1.10.472.10coord: 156..260
e-value: 6.1E-13
score: 50.8
NoneNo IPR availablePANTHERPTHR10177:SF193G2/MITOTIC-SPECIFIC CYCLIN-B1coord: 143..360
IPR039361CyclinPIRSFPIRSF001771Cyclin_A_B_D_Ecoord: 5..380
e-value: 6.5E-15
score: 52.8
IPR039361CyclinPANTHERPTHR10177CYCLINEcoord: 143..360
IPR006671Cyclin, N-terminalPFAMPF00134Cyclin_Ncoord: 139..266
e-value: 2.8E-13
score: 49.7
IPR036915Cyclin-like superfamilySUPERFAMILYSSF47954Cyclin-likecoord: 267..377
IPR036915Cyclin-like superfamilySUPERFAMILYSSF47954Cyclin-likecoord: 136..265