U2 snRNP-associated SURP motif-containing protein

Overview
NameU2 snRNP-associated SURP motif-containing protein
Smed IDSMED30014392
Length (bp)3003
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of U2 snRNP-associated SURP motif-containing protein (SMED30014392) t-SNE clustered cells

Violin plots show distribution of expression levels for U2 snRNP-associated SURP motif-containing protein (SMED30014392) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of U2 snRNP-associated SURP motif-containing protein (SMED30014392) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for U2 snRNP-associated SURP motif-containing protein (SMED30014392) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014392

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014392SMESG000026341.1 SmedASXL_012975SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014392SMESG000026341.1 SmedASXL_012975SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30014392SMESG000026341.1 dd_Smed_v4_3029_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014392SMESG000026341.1 dd_Smed_v4_3029_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014392SMESG000026341.1 dd_Smed_v4_3029_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Human
Match: U2SURP (U2 snRNP associated SURP domain containing [Source:HGNC Symbol;Acc:HGNC:30855])

HSP 1 Score: 500.745 bits (1288), Expect = 2.812e-160
Identity = 321/755 (42.52%), Postives = 438/755 (58.01%), Query Frame = 3
Query:  120 TAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLL-----GKP----KEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSET-DRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEPPALXXXXXXXXXXXXXLLSVKPL-VDYDGDPL-DVDGVPLDSKATEATNSTEIL----DMFANPSSPQTKRITKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQ 2318
             A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GK+Y+P  +  D+     K       N++PP L      KP     E+ K+KSNLE F EELKQ+Q+ER+ R++ +  ++        +F  EP   +S+  R+S        +  P      S   D   P   +  D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+   N ++  +      + ED  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP F+FLF+ Q+P HVYYRWKLYS L G+S   W+T++F M+K G +WRPPPLNP+  G+ EE                              Q  E  +E P       K  L + QR++L EIL  L P K+ IG+AMV+CL +A++AE+++D I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRK+ E  L Q+   LN  Y TI   ++SE  K +V++CFRAW DW +YP  FL KL+N FLG+V     +  +        + L   P+  + DG PL DVDG+P+D+   +  +   I     D+   P          EP+F   PSKWE VD ++ E++ V  S+W+L +  
Sbjct:  113 AAEIYEEFLAAFEGSDGNKV-KTFVRGGVVNAAKEEHETDEKRGKIYKPSSRFADQ-----KNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLS--------RF--EPPQSDSDGQRRS--------MDAPSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK---NPNAPML--PPPKNKEDFEKTLSQAIVKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEE------------------------------QETEAFVEEPSK-----KGALKEEQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESL----------SILKT---PLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLV-----NIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWELFDQH 785          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Human
Match: U2SURP (U2 snRNP associated SURP domain containing [Source:HGNC Symbol;Acc:HGNC:30855])

HSP 1 Score: 496.123 bits (1276), Expect = 1.502e-158
Identity = 320/756 (42.33%), Postives = 436/756 (57.67%), Query Frame = 3
Query:  120 TAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLL-----GKP----KEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSE--TDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEPPALXXXXXXXXXXXXXLLSVKPL-VDYDGDPL-DVDGVPLDSKATEATNSTEIL----DMFANPSSPQTKRITKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQ 2318
             A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GK+Y+P  +  D+     K       N++PP L      KP     E+ K+KSNLE F EELKQ+Q+ER+ R++ +  ++        +F  EP   +S+  R+S             P+    S    D+   S    D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+   N ++  +      + ED  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP F+FLF+ Q+P HVYYRWKLYS L   S   W+T++F M+K G +WRPPPLNP+  G+ EE                              Q  E  +E P       K  L + QR++L EIL  L P K+ IG+AMV+CL +A++AE+++D I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRK+ E  L Q+   LN  Y TI   ++SE  K +V++CFRAW DW +YP  FL KL+N FLG+V     +  +        + L   P+  + DG PL DVDG+P+D+   +  +   I     D+   P          EP+F   PSKWE VD ++ E++ V  S+W+L +  
Sbjct:  113 AAEIYEEFLAAFEGSDGNKV-KTFVRGGVVNAAKEEHETDEKRGKIYKPSSRFADQ-----KNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLS--------RF--EPPQSDSDGQRRSM----------DAPSRRNRSSVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK---NPNAPML--PPPKNKEDFEKTLSQAIVKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQANSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEE------------------------------QETEAFVEEPSK-----KGALKEEQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESL----------SILKT---PLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLV-----NIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWELFDQH 784          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Human
Match: U2SURP (U2 snRNP associated SURP domain containing [Source:HGNC Symbol;Acc:HGNC:30855])

HSP 1 Score: 219.164 bits (557), Expect = 6.298e-62
Identity = 155/340 (45.59%), Postives = 208/340 (61.18%), Query Frame = 3
Query:  120 TAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTH-SSEGAGKLYQPLMKTVDKI--PDKFKEKFQSEF----NKKPPLLGKPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSET-DRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQ 1109
             A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GK+Y+P  +  D+   P++   +          KKPPL     E+ K+KSNLE F EELKQ+Q+ER+ R++ +  ++        +F  EP   +S+  R+S        +  P      S   D   P   +  D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+   N ++  +      + ED  +TL   +VKV IPT+R+
Sbjct:  115 AAEIYEEFLAAFEGSDGNKV-KTFVRGGVVNAAKEEHETDEKRGKIYKPSSRFADQKNPPNQSSNERPPSLLVIETKKPPLKKG--EKEKKKSNLELFKEELKQIQEERDERHKTKGRLS--------RF--EPPQSDSDGQRRS--------MDAPSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK---NPNAPML--PPPKNKEDFEKTLSQAIVKVVIPTERR 428          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Human
Match: U2SURP (U2 snRNP associated SURP domain containing [Source:HGNC Symbol;Acc:HGNC:30855])

HSP 1 Score: 208.764 bits (530), Expect = 1.966e-58
Identity = 144/304 (47.37%), Postives = 188/304 (61.84%), Query Frame = 3
Query:  120 TAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTH-SSEGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLL-----GKP----KEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSET-DRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQ 992
             A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GK+Y+P  +  D+     K       N++PP L      KP     E+ K+KSNLE F EELKQ+Q+ER+ R++ +  ++        +F  EP   +S+  R+S        +  P      S   D   P   +  D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+
Sbjct:  113 AAEIYEEFLAAFEGSDGNKV-KTFVRGGVVNAAKEEHETDEKRGKIYKPSSRFADQ-----KNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLS--------RF--EPPQSDSDGQRRS--------MDAPSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK 392          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Human
Match: PABPC1 (poly(A) binding protein cytoplasmic 1 [Source:HGNC Symbol;Acc:HGNC:8554])

HSP 1 Score: 60.077 bits (144), Expect = 1.888e-8
Identity = 25/81 (30.86%), Postives = 51/81 (62.96%), Query Frame = 3
Query:  636 TNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGK 878
            TN+++ N   ++ +++L +LFG+FGP  SVK+M     +E  + +  GFV+F    D ++A++++ G E+ G ++ +G  +
Sbjct:  159 TNVYIKNFGEDMDDERLKDLFGKFGPALSVKVM----TDESGKSKGFGFVSFERHEDAQKAVDEMNGKELNGKQIYVGRAQ 235          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Celegans
Match: C07H6.4 (pep chromosome:WBcel235:III:7499677:7503241:1 gene:WBGene00015581.1 transcript:C07H6.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C07H6.4)

HSP 1 Score: 280.796 bits (717), Expect = 5.134e-80
Identity = 181/592 (30.57%), Postives = 307/592 (51.86%), Query Frame = 3
Query:  321 KKPPLLG--KPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLP--ATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQP-----REWLQKTGNVDSRKMF-DMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPP-PLNPFTSGIPEEL-------------IEDIDFSKLTLENISQTLNNADS--SKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAK-VRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVE 2015
            ++PP  G  K K+   + S +E F  EL+++Q++RE    K+K +   +E +                     D  ++  + P        +S FD D PY       TTN+++ N+   +TE  L   FG FGPLA++KI++PRS+EE+ R   C FVAFM+R+D +R + ++R   +    ++  + + V IP  P Y+PP+L  +  P P S LPFNAQP     +++L+K                  ED  E ++N  ++V +P DR+L+++++RM  +V+ EG +FEA I  +E +NP F+FL+D  S  HVYYRW++YS L G++ + W+   F M++ G +W PP P+N     +P+EL             ++  D  +      S+   N+D+   +    +  E   +    N      +++D +R++L  ++ +L P K SI   MVWC+++A  A ++ + +   +          +IE+     L + ++ L+L++DIL N   + VR+   YR + E  L ++ V + + Y  I S+IK EQ K +V+  FR + +  VYP D L   +N FLG++E
Sbjct:  122 QRPPKPGSSKAKQDKPKISQMEMFKMELQRVQEDRE----KRKDLRHHLEKVG-------------------MDQAVVERLAPTVERGFQGTSEFDDD-PY-------TTNVYVSNIPHSVTEDDLLFTFGSFGPLAALKILYPRSEEERRRPHICAFVAFMSRADVDRFMAEVRVIIVRNEPIRFAFARPVQIPAIPYYIPPVLHALQHPDPTSNLPFNAQPDCADAKKFLEKYNTFPPMHALPTKGQYGYEDFTELIRNSQIRVVVPPDRKLVRVMDRMAVYVVTEGPQFEAMICAEEFQNPMFQFLWDNTSALHVYYRWRIYSLLQGDTIEEWRRTPFRMFENGSWWIPPYPINELRDAMPKELYHMNCLRTYPDKWMKVRDGGQRRGGESSKNRRNSDAEKEERKMRREEEKERKRREKNEKKRNNRMSDKRRDKLETLIRELTPEKTSIAATMVWCIQNAKYAAEICECVYDSL----------TIED---IPLYKKISRLYLINDILSNCVQRNVRDVFLYRSHFEALLEKIFVAVGKAYRAIPSRIKQEQFKQRVMCVFRNFEEMAVYPTDKLIHNQNVFLGLIE 669          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Celegans
Match: tiar-3 (TIA-1/TIAL RNA binding protein homolog [Source:UniProtKB/TrEMBL;Acc:Q93194])

HSP 1 Score: 51.6026 bits (122), Expect = 2.043e-6
Identity = 27/113 (23.89%), Postives = 57/113 (50.44%), Query Frame = 3
Query:  618 ETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIP-----PHPIYVPPILMEMIKP 941
             T    T++++GN++ + T+  L +LF  +G +A V+I          + +   FV +  +    +A+ ++ G E+ G +++  WG+T  +P     P PI +  ++M  + P
Sbjct:  321 STKADNTSVYVGNISQQTTDADLRDLFSTYGDIAEVRIF---------KTQRYAFVRYEKKECATKAIMEMNGKEMAGNQVRCSWGRTQAVPNQALNPLPIDLSSLMMPTMLP 424          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Fly
Match: CG9346 (gene:FBgn0034572 transcript:FBtr0071526)

HSP 1 Score: 491.5 bits (1264), Expect = 5.256e-158
Identity = 306/783 (39.08%), Postives = 433/783 (55.30%), Query Frame = 3
Query:   87 EEARKLQANEETAIVYQQFIETFEEPPK-VNKTWVKGGTVNPGSSTHSSEGAGKLYQPLMKTV-----DKIPDKFKEKFQSEFNKKPPLLGKPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSD-EDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLG--IVEPP--ALXXXXXXXXXXXXXLLSVKPLVDYDGDPLDVDGVPLDSKAT----------EATNST---------EIL----------DMFANPSSPQTKRITKEPLFVPSKWETVDPADEESE-IVQSRWQLME 2312
            E+ +K +     A  +++F+ETF++ P   +K WVK GT + GS        GKLY+P+ K +     DK+ D + +   S+  K    L K K Q K+KSNLE F EEL+Q+Q+ERE R++ + + +               + +S     S+             ++  S  FD   P        TTNL+LGNLNP+++EQQL E+FGR+GPLAS+KIMWPRS+EEK RGRNCGFVA+M+R D ERAL+ L G  I GYEM+LGWGKTV I   PI+ P  L+EM  PPPPSGLPFNAQP        +V  +K +   +  D E++   L  CVVKV IPT++ +L +I+RM+EFVIREG  FEA IM +EM NP F FLFD +SP H+YYRWKL+S L G++   W+ +EF M+K GP W+PP  N +T G+P+EL+ D D                                       V+K  L+++QR RL +++  L P +  IG+AM++C+EHAD+A+++ + I             +S+ N N     +I A L+L+SDILHN   KV NASF+RK +E  L  +  +L+ YYL I S++K+E  K +V +  R W +W +YP DF+ +L  +FLG   V+P   +   E++    + +  +   PL   + D  D+DGVPLD  A           +A   T         E L          D+   P   +TK   K P F+PSKWETVDP   E++ I  S+W  ++
Sbjct:   45 EDQKKKEDAAAAAHAFKEFVETFQDAPTPSSKVWVKAGTYDAGSRREDKSEKGKLYKPVSKLMEKSSSDKVED-YAKTLASDLKKDSGPLKK-KNQEKKKSNLELFKEELRQIQEEREERHKYKHMASSHSAPAQQPAASAAPVPSSSVSTTSQNSS----------SSKESGSFDTGDP-------NTTNLYLGNLNPKISEQQLMEIFGRYGPLASIKIMWPRSEEEKQRGRNCGFVAYMSRKDAERALKTLNGRYIMGYEMRLGWGKTVPIMNTPIFTPQALLEMTLPPPPSGLPFNAQPP---PSEADVLPKKNYKEFNQEDKENMERILAKCVVKVHIPTEKAVLNVIHRMIEFVIREGPMFEALIMIREMENPLFAFLFDNESPAHIYYRWKLFSLLQGDTPNEWREEEFRMFKNGPVWKPPIANFYTQGMPDELVVDPDAPV------------------------------------VHKGALSNAQRNRLEDLIRHLTPERARIGDAMIFCIEHADAADEICECIA------------ESLSNINTLASKKI-ARLYLISDILHNCTVKVANASFFRKSVEKQLLDIFDNLHNYYLNIESRLKAEGFKSRVCNVIRTWEEWTIYPKDFMAQLTAKFLGKPYVKPVNNSPQAEETRFDEALDEDIDGAPLSGEEKDDEDLDGVPLDGAALLKSALKRAIPDADAGTPKRDTPKKDEYLDEIDGIPLDDDLDGVPLEKETKSTAKLPGFIPSKWETVDPQQVEAQAITTSKWDTLD 756          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Fly
Match: Caper (gene:FBgn0031883 transcript:FBtr0089640)

HSP 1 Score: 54.299 bits (129), Expect = 5.678e-7
Identity = 26/76 (34.21%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  642 LFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLG 869
            L++G+L+  +TE  L  +F  FG + +++++    D E  R +  GF+ + N  D ++ALE+L G E+ G  MK+G
Sbjct:  337 LYVGSLHFNITEDMLRGIFEPFGKIDAIQLIM---DTETGRSKGYGFITYHNADDAKKALEQLNGFELAGRLMKVG 409          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Fly
Match: Caper (gene:FBgn0031883 transcript:FBtr0089636)

HSP 1 Score: 54.299 bits (129), Expect = 5.678e-7
Identity = 26/76 (34.21%), Postives = 46/76 (60.53%), Query Frame = 3
Query:  642 LFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLG 869
            L++G+L+  +TE  L  +F  FG + +++++    D E  R +  GF+ + N  D ++ALE+L G E+ G  MK+G
Sbjct:  337 LYVGSLHFNITEDMLRGIFEPFGKIDAIQLIM---DTETGRSKGYGFITYHNADDAKKALEQLNGFELAGRLMKVG 409          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0084592)

HSP 1 Score: 50.8322 bits (120), Expect = 4.653e-6
Identity = 23/86 (26.74%), Postives = 47/86 (54.65%), Query Frame = 3
Query:  639 NLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPP 896
            ++F+G+L+PE+  + L E F  FG +++ +I+    D    + +   FV+F+ +++ E A++ + G  I    ++  W    L PP
Sbjct:   96 HIFVGDLSPEIETETLREAFAPFGEISNCRIV---RDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPP 178          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Fly
Match: Rox8 (gene:FBgn0005649 transcript:FBtr0084594)

HSP 1 Score: 50.8322 bits (120), Expect = 4.653e-6
Identity = 23/86 (26.74%), Postives = 47/86 (54.65%), Query Frame = 3
Query:  639 NLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPP 896
            ++F+G+L+PE+  + L E F  FG +++ +I+    D    + +   FV+F+ +++ E A++ + G  I    ++  W    L PP
Sbjct:   96 HIFVGDLSPEIETETLREAFAPFGEISNCRIV---RDPHTMKSKGYAFVSFVKKAEAENAIQAMNGQWIGSRSIRTNWSTRKLPPP 178          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Zebrafish
Match: u2surp (U2 snRNP-associated SURP domain containing [Source:ZFIN;Acc:ZDB-GENE-070912-400])

HSP 1 Score: 478.404 bits (1230), Expect = 3.383e-153
Identity = 318/788 (40.36%), Postives = 436/788 (55.33%), Query Frame = 3
Query:   33 IIKMSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFEEPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDK---IPDKFKEKFQSEFNKKPPLLGKPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPAT-------------LPSSPFDIDFPYDSET-DRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIV--EPPALXXXXXXXXXXXXXLLSVKPLV--DYDGDPL-DVDGVPLDSKATEATNSTEILDMFANPSSPQTKRI--TKEPLF--VPSKWETVDPADEESEIV-QSRWQLME 2312
            I KM+   R  T++   ++E +K +     A +Y++F+  FE      KT+V+GG  N      ++ E  GKLY+P  + V+    +P +  ++F    +K+     K  ++ K+KSNLE F EELKQ+Q+ER+ R++ +  V                         SRF+        PLP T              PSS  D   P   +  D TTTNL+LGN+NP++ E+ LC+ FGR+GPLASVKIMWPR+DEE+AR RNCGFVAFM R D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQP+E L+             C    E+  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP ++FLF+ QSP HVYYRWKLY+ L GES   WKT++F M+K G  WRPPPLNP+  G PE                          +   +   E+C           K  L D +R++L E+L  L P K  I   M +CL HAD+AE++++ I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRK+ E  L Q+   LN  Y TI   ++SE  K +V+SCFRAW +W VYP  FL KL+N FLG+V  +P    EE       +   +   P+V  + DG PL DVDG+P+D    +  +  ++  M    +      +   ++P F   PSKWE VD A  E++ V  S+W++ +
Sbjct:   27 IGKMAVAKR--TLSKKEQDEIKKKEDERAAAEIYEEFLAAFEGGEGKVKTFVRGGIANATKEEAAADEKKGKLYKPKSRIVEAKSFLPLETPQQFLP-IDKRNA--SKKGDKEKKKSNLELFKEELKQIQEERDERHRLKGRV-------------------------SRFE--------PLPTTEGRRSSDGSSRRNRPSSVLDDSAPGSHDVGDPTTTNLYLGNINPQMNEEMLCQEFGRYGPLASVKIMWPRTDEERARERNCGFVAFMTRRDAERALKHLNGKMIMNFEMKLGWGKGVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPKERLKNPNAAMPPPP--KCK---EEFEKTLSQAIVKVVIPTERNLLSLIHRMIEFVVREGPMFEAMIMNREINNPLYRFLFENQSPAHVYYRWKLYTILQGESPTKWKTEDFRMFKNGSLWRPPPLNPYLHGTPE------------------------DEEHEDDDDEEICK----------KGSLKDEERDKLEELLRGLTPRKSDIAGGMFFCLTHADAAEEIVECIAESL----------SILKTP---LPKKIARLYLVSDVLYNSSAKVTNASYYRKFFETKLCQIFSDLNATYKTIQGHLQSENFKQRVMSCFRAWEEWAVYPDPFLIKLQNIFLGLVSLDPEKEPEELVPELPEKVEDIDGAPIVEEELDGAPLDDVDGMPIDGAPIDGASMDDLDGMPIKGADDDLDGVPLDQKPGFKVAPSKWEAVDGAALEAQAVTTSKWEIFD 724          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Zebrafish
Match: u2surp (U2 snRNP-associated SURP domain containing [Source:ZFIN;Acc:ZDB-GENE-070912-400])

HSP 1 Score: 477.633 bits (1228), Expect = 1.982e-152
Identity = 318/788 (40.36%), Postives = 436/788 (55.33%), Query Frame = 3
Query:   33 IIKMSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFEEPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDK---IPDKFKEKFQSEFNKKPPLLGKPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPAT-------------LPSSPFDIDFPYDSET-DRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIV--EPPALXXXXXXXXXXXXXLLSVKPLV--DYDGDPL-DVDGVPLDSKATEATNSTEILDMFANPSSPQTKRI--TKEPLF--VPSKWETVDPADEESEIV-QSRWQLME 2312
            I KM+   R  T++   ++E +K +     A +Y++F+  FE      KT+V+GG  N      ++ E  GKLY+P  + V+    +P +  ++F    +K+     K  ++ K+KSNLE F EELKQ+Q+ER+ R++ +  V                         SRF+        PLP T              PSS  D   P   +  D TTTNL+LGN+NP++ E+ LC+ FGR+GPLASVKIMWPR+DEE+AR RNCGFVAFM R D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQP+E L+             C    E+  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP ++FLF+ QSP HVYYRWKLY+ L GES   WKT++F M+K G  WRPPPLNP+  G PE                          +   +   E+C           K  L D +R++L E+L  L P K  I   M +CL HAD+AE++++ I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRK+ E  L Q+   LN  Y TI   ++SE  K +V+SCFRAW +W VYP  FL KL+N FLG+V  +P    EE       +   +   P+V  + DG PL DVDG+P+D    +  +  ++  M    +      +   ++P F   PSKWE VD A  E++ V  S+W++ +
Sbjct:   27 IGKMAVAKR--TLSKKEQDEIKKKEDERAAAEIYEEFLAAFEGGEGKVKTFVRGGIANATKEEAAADEKKGKLYKPKSRIVEAKSFLPLETPQQFLP-IDKRN--ASKKGDKEKKKSNLELFKEELKQIQEERDERHRLKGRV-------------------------SRFE--------PLPTTEGRRSSDGSSRRNRPSSVLDDSAPGSHDVGDPTTTNLYLGNINPQMNEEMLCQEFGRYGPLASVKIMWPRTDEERARERNCGFVAFMTRRDAERALKHLNGKMIMNFEMKLGWGKGVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPKERLKNPNAAMPPPP--KCK---EEFEKTLSQAIVKVVIPTERNLLSLIHRMIEFVVREGPMFEAMIMNREINNPLYRFLFENQSPAHVYYRWKLYTILQGESPTKWKTEDFRMFKNGSLWRPPPLNPYLHGTPE------------------------DEEHEDDDDEEICK----------KGSLKDEERDKLEELLRGLTPRKSDIAGGMFFCLTHADAAEEIVECIAESL----------SILKTP---LPKKIARLYLVSDVLYNSSAKVTNASYYRKFFETKLCQIFSDLNATYKTIQGHLQSENFKQRVMSCFRAWEEWAVYPDPFLIKLQNIFLGLVSLDPEKEPEELVPELPEKVEDIDGAPIVEEELDGAPLDDVDGMPIDGAPIDGASMDDLDGMPIKGADDDLDGVPLDQKPGFKVAPSKWEAVDGAALEAQAVTTSKWEIFD 724          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Zebrafish
Match: zgc:163098 (zgc:163098 [Source:ZFIN;Acc:ZDB-GENE-070410-141])

HSP 1 Score: 460.685 bits (1184), Expect = 5.453e-147
Identity = 299/804 (37.19%), Postives = 419/804 (52.11%), Query Frame = 3
Query:  120 TAIVYQQFIETFEEPPKVN-KTWVKGGTVNPGSSTHSSE-GAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPL--------LGKPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEP------------PALXXXXXXXXXXXXXLLSVKPLVDYDGDPLD-----VDGVPLDS-KATEATNSTEILDMFA-NPSSPQTKRITKEPLFVPSKWETVD----PADEESEIVQSRWQLMESQSEDKKSSDNEDP----DGYPLSDNDENFNLSMIKSHDL 2420
             A V+++F+  F+   K   KT+V+GG VN      ++E    KLY+P              KF +      P+        + K K + K+KSNLE F EELKQ+Q+ERE R +++K       D    F+ + E       R+S FD +            P+ P              TTNL++G +NP++TE+ LC+ FG++GPLASVKIMWPR++EE+ R  N GFVAFM R D ERAL  L G  + G+EMKLGWGK V IPP P+Y P  +++   PPPPSGLPFNAQPR+  +              S S +D  +TL   VV V IP +R LL LI+RM+EFV+REG  FEA IMN+E  NP+F+FLFD +S EHVYYRWKLYS L GE+  +W+T  F M++GG  W+PP LNP+  G  +E  E+  F                                P       K QL    RE+L  +L  L P +  IG+AM++CLE A++AE+++  I   +  +I +             L + +A L+L+SDIL+NSCAKV NAS+YRK+ E  LP++   +++ Y  I +++++EQ K +++ CFRAW DW VYP  FL +L+N FLG+++P            P L     +    +   +   PL D DG PL      +DGVP+D        NS + +D    +  S +T      P    SKWE VD     A  +S+   +   L E+  +   SSD  D     +G     + +NF LS  K   L
Sbjct:   31 AAEVFEEFLAAFDTNDKSGVKTFVRGGIVNATKEEEAAEVKKSKLYRP------------SAKFSAPLQNTSPVHHAEVKKAVAKKKVEEKKKSNLELFKEELKQIQEEREERYKRKK------GDSGAVFLGDLEPLT----RRSIFDDD------------PAVP-------------NTTNLYIGCINPKMTEEMLCKEFGKYGPLASVKIMWPRTEEERTRVTNRGFVAFMTRKDAERALAALDGKTVMGFEMKLGWGKAVRIPPQPLYTPIGVLKTTAPPPPSGLPFNAQPRDRFRND-------FTKPRSRSQDDFYKTLSEAVVTVVIPPERNLLGLIHRMIEFVVREGPMFEAMIMNREKNNPDFRFLFDNKSQEHVYYRWKLYSILQGENPNNWRTSSFRMFRGGSLWKPPLLNPYLHG--DEEPEEASF--------------------------------PSPEEEPKKGQLKSEHREKLEVLLRGLTPRRDEIGDAMLFCLERAEAAEEIVSCITESL--SIAHTP-----------LQKKIARLYLISDILYNSCAKVANASYYRKFFETKLPEIFGDISEAYRNIQARLQAEQFKQRIMGCFRAWEDWAVYPDSFLIQLQNIFLGLIKPGEEVIERPEPESPDLDGAPLDGVPLDRGEIDGTPLDDLDGSPLTWDPSAIDGVPVDDIDGVPLGNSVDDIDGVPFDEGSDKTL-----PTVALSKWEKVDDSESSAKNDSDNEVNSGGLKENSGDSDTSSDEADSPSRFEGADFKSSLKNFELSESKRTRL 728          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Zebrafish
Match: zgc:163098 (zgc:163098 [Source:ZFIN;Acc:ZDB-GENE-070410-141])

HSP 1 Score: 460.685 bits (1184), Expect = 5.453e-147
Identity = 299/804 (37.19%), Postives = 419/804 (52.11%), Query Frame = 3
Query:  120 TAIVYQQFIETFEEPPKVN-KTWVKGGTVNPGSSTHSSE-GAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPL--------LGKPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEP------------PALXXXXXXXXXXXXXLLSVKPLVDYDGDPLD-----VDGVPLDS-KATEATNSTEILDMFA-NPSSPQTKRITKEPLFVPSKWETVD----PADEESEIVQSRWQLMESQSEDKKSSDNEDP----DGYPLSDNDENFNLSMIKSHDL 2420
             A V+++F+  F+   K   KT+V+GG VN      ++E    KLY+P              KF +      P+        + K K + K+KSNLE F EELKQ+Q+ERE R +++K       D    F+ + E       R+S FD +            P+ P              TTNL++G +NP++TE+ LC+ FG++GPLASVKIMWPR++EE+ R  N GFVAFM R D ERAL  L G  + G+EMKLGWGK V IPP P+Y P  +++   PPPPSGLPFNAQPR+  +              S S +D  +TL   VV V IP +R LL LI+RM+EFV+REG  FEA IMN+E  NP+F+FLFD +S EHVYYRWKLYS L GE+  +W+T  F M++GG  W+PP LNP+  G  +E  E+  F                                P       K QL    RE+L  +L  L P +  IG+AM++CLE A++AE+++  I   +  +I +             L + +A L+L+SDIL+NSCAKV NAS+YRK+ E  LP++   +++ Y  I +++++EQ K +++ CFRAW DW VYP  FL +L+N FLG+++P            P L     +    +   +   PL D DG PL      +DGVP+D        NS + +D    +  S +T      P    SKWE VD     A  +S+   +   L E+  +   SSD  D     +G     + +NF LS  K   L
Sbjct:   31 AAEVFEEFLAAFDTNDKSGVKTFVRGGIVNATKEEEAAEVKKSKLYRP------------SAKFSAPLQNTSPVHHAEVKKAVAKKKVEEKKKSNLELFKEELKQIQEEREERYKRKK------GDSGAVFLGDLEPLT----RRSIFDDD------------PAVP-------------NTTNLYIGCINPKMTEEMLCKEFGKYGPLASVKIMWPRTEEERTRVTNRGFVAFMTRKDAERALAALDGKTVMGFEMKLGWGKAVRIPPQPLYTPIGVLKTTAPPPPSGLPFNAQPRDRFRND-------FTKPRSRSQDDFYKTLSEAVVTVVIPPERNLLGLIHRMIEFVVREGPMFEAMIMNREKNNPDFRFLFDNKSQEHVYYRWKLYSILQGENPNNWRTSSFRMFRGGSLWKPPLLNPYLHG--DEEPEEASF--------------------------------PSPEEEPKKGQLKSEHREKLEVLLRGLTPRRDEIGDAMLFCLERAEAAEEIVSCITESL--SIAHTP-----------LQKKIARLYLISDILYNSCAKVANASYYRKFFETKLPEIFGDISEAYRNIQARLQAEQFKQRIMGCFRAWEDWAVYPDSFLIQLQNIFLGLIKPGEEVIERPEPESPDLDGAPLDGVPLDRGEIDGTPLDDLDGSPLTWDPSAIDGVPVDDIDGVPLGNSVDDIDGVPFDEGSDKTL-----PTVALSKWEKVDDSESSAKNDSDNEVNSGGLKENSGDSDTSSDEADSPSRFEGADFKSSLKNFELSESKRTRL 728          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Zebrafish
Match: zgc:163098 (zgc:163098 [Source:ZFIN;Acc:ZDB-GENE-070410-141])

HSP 1 Score: 459.914 bits (1182), Expect = 1.107e-146
Identity = 299/809 (36.96%), Postives = 416/809 (51.42%), Query Frame = 3
Query:  120 TAIVYQQFIETFEEPPKVN-KTWVKGGTVNPGSSTHSSE-GAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLLGKPKEQSKRK-------------SNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEP------------PALXXXXXXXXXXXXXLLSVKPLVDYDGDPLD-----VDGVPLDS-KATEATNSTEILDMFA-NPSSPQTKRITKEPLFVPSKWETVD----PADEESEIVQSRWQLMESQSEDKKSSDNEDP----DGYPLSDNDENFNLSMIKSHDL 2420
             A V+++F+  F+   K   KT+V+GG VN      ++E    KLY+P              KF +     PP    P   ++ K             SNLE F EELKQ+Q+ERE R +++K       D    F+ + E       R+S FD +            P+ P              TTNL++G +NP++TE+ LC+ FG++GPLASVKIMWPR++EE+ R  N GFVAFM R D ERAL  L G  + G+EMKLGWGK V IPP P+Y P  +++   PPPPSGLPFNAQPR+  +              S S +D  +TL   VV V IP +R LL LI+RM+EFV+REG  FEA IMN+E  NP+F+FLFD +S EHVYYRWKLYS L GE+  +WKT  F M++GG  W+PP LNP+  G  +E  E+  F                                P       K QL    RE+L  +L  L P +  IG+AM++CLE A++AE+++  I   +  +I +             L + +A L+L+SDIL+NSCAKV NAS+YRK+ E  LP++   +++ Y  I +++++EQ K +++ CFRAW DW VYP  FL +L+N FLG+++P            P L     +    +   +   PL D DG PL      +DGVP+D        NS + +D    +  S +T      P    SKWE VD     A  +S+   +   L E+  +   SSD  D     +G     + +NF LS  K   L
Sbjct:   31 AAEVFEEFLAAFDTNDKSGVKTFVRGGIVNATKEEEAAEVKKSKLYRP------------SAKFSA-----PPQNTSPVHHTEVKKAVAKKKVEEKKKSNLELFKEELKQIQEEREERYKRKK------GDSGAVFLGDLEPLT----RRSIFDDD------------PAVP-------------NTTNLYIGCINPKMTEEMLCKEFGKYGPLASVKIMWPRTEEERTRVTNRGFVAFMTRKDAERALAALDGKTVMGFEMKLGWGKAVRIPPQPLYTPIGVLKTTAPPPPSGLPFNAQPRDRFRND-------FTKPRSRSQDDFYKTLSEAVVTVVIPPERNLLGLIHRMIEFVVREGPMFEAMIMNREKNNPDFRFLFDNKSQEHVYYRWKLYSILQGENPNNWKTSSFRMFRGGSLWKPPLLNPYLHG--DEEPEEASF--------------------------------PSPEEEPKKGQLKSEHREKLEVLLRGLTPRRDEIGDAMLFCLERAEAAEEIVSCITESL--SIAHTP-----------LQKKIARLYLISDILYNSCAKVANASYYRKFFETKLPEIFGDISEAYRNIQARLQAEQFKQRIMGCFRAWEDWAVYPDSFLIQLQNIFLGLIKPGEEVIERPEPESPDLDGAPLDGVPLDRGEIDGTPLDDLDGSPLTWDPSAIDGVPVDDIDGVPLGNSVDDIDGVPFDEGSDKTL-----PTVALSKWEKVDDSESSAKNDSDNEVNSGGLKENSGDSDTSSDEADSPSRFEGADFKSSLKNFELSESKRTRL 728          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Xenopus
Match: u2surp (U2 snRNP associated SURP domain containing [Source:NCBI gene;Acc:100216247])

HSP 1 Score: 507.294 bits (1305), Expect = 3.885e-163
Identity = 334/784 (42.60%), Postives = 456/784 (58.16%), Query Frame = 3
Query:   33 IIKMSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDKIPDKFKE-KFQSEFNKKPP---LLGKPKE-------QSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIV-----EPPALXXXXXXXXXXXXXLLSVKPLVDYDGDPLDVDGVPLDSKATEATNSTEILDMFANPSSPQTKRITKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQ 2318
            I KMS  ++ +T++   ++E +K +  +  A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GKLY+P          +F E K Q   N++PP   +LG+PK+       + K+KSNLE F EELKQ+Q+ER+ R+ K K  T R E         P   +++  R+   D       +   A    +P   D       D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  +  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+   N ++  M      + E+  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP F+FLF+ Q+P HVYYRWKLYS L G+S   W+T++F M+K G +WRPPPLNP+  G+ EE                              Q  E  +E P     + K  L + QR++L EIL  L P K+ IGEAM++CL HA++AE+++D I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRKY E  L Q+   LN  Y  I   ++SE  K +V++CFRAW DW +YP  +L +L+N FLG+V     EP  + ++     + EE  L V  + D DG P  +DG P+D        S E  D+   P          EP+F   PSKWE VD ++ ES+ V  S+W+L +  
Sbjct:   65 IGKMSAAAK-RTLSKKEQDELKKKEDEKAAAEIYEEFLAAFEGGDASKV-KTFVRGGIVNATKEEHEADEKRGKLYKP--------SSRFSEPKSQQSSNERPPPPIILGEPKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERH-KTKGRTSRFE---------PPQTDTDTQRRL-MDTPSSRRSRSSGALDDYAPGSHDV-----GDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMVMNFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK---NPNAPMM--PLPKNKEEFEKTLSQAIVKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQAPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMAEE------------------------------QEAEPFVEEP-----IKKGSLKEEQRDKLEEILRGLTPRKNDIGEAMMFCLNHAEAAEEIVDCITESL----------SILKT---PLPKKIARLYLVSDVLYNSSAKVANASYYRKYFEAKLCQIFADLNAAYRAIQGHLQSENFKQRVMACFRAWEDWAIYPEPYLIRLQNIFLGLVNIEDKEPEEVPDDLDGAPIEEE--LDVPLIEDVDGIP--IDGAPIDDLDGVPIKSLED-DLDGVPLDINDDAKKNEPIFKVAPSKWEAVDESELESQAVTTSKWELFDQH 764          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Xenopus
Match: u2surp (U2 snRNP associated SURP domain containing [Source:NCBI gene;Acc:100216247])

HSP 1 Score: 420.239 bits (1079), Expect = 1.132e-133
Identity = 242/525 (46.10%), Postives = 323/525 (61.52%), Query Frame = 3
Query:  597 IDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIV-----EPPALXXXXXXXXXXXXXLLSVKPLVDYDGDPL------DVDGVPLDS 2138
            + F        T ++    +++ ++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  +  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+   N ++  M      + E+  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP F+FLF+ Q+P HVYYRWKLYS L G+S   W+T++F M+K G +WRPPPLNP+  G+ EE                              Q  E  +E P     + K  L + QR++L EIL  L P K+ IGEAM++CL HA++AE+++D I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRKY E  L Q+   LN  Y  I   ++SE  K +V++CFRAW DW +YP  +L +L+N FLG+V     EP  + ++     + EE  L V  + D DG P+      D+DGVP+ S
Sbjct:  153 LSFCIQYHGGATNSDSIFVSMHHQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMVMNFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK---NPNAPMM--PLPKNKEEFEKTLSQAIVKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQAPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMAEE------------------------------QEAEPFVEEP-----IKKGSLKEEQRDKLEEILRGLTPRKNDIGEAMMFCLNHAEAAEEIVDCITESL----------SILKT---PLPKKIARLYLVSDVLYNSSAKVANASYYRKYFEAKLCQIFADLNAAYRAIQGHLQSENFKQRVMACFRAWEDWAIYPEPYLIRLQNIFLGLVNIEDKEPEEVPDDLDGAPIEEE--LDVPLIEDVDGIPIDGAPIDDLDGVPIKS 622          

HSP 2 Score: 54.299 bits (129), Expect = 1.011e-6
Identity = 50/138 (36.23%), Postives = 77/138 (55.80%), Query Frame = 3
Query:   33 IIKMSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDKIPDKFKE-KFQSEFNKKPP---LLGKPKE-------QSKRKSNLEAFSEELKQ 404
            I KMS  ++ +T++   ++E +K +  +  A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GKLY+P          +F E K Q   N++PP   +LG+PK+       + K+KSNLE F EELK 
Sbjct:   19 IGKMSAAAK-RTLSKKEQDELKKKEDEKAAAEIYEEFLAAFEGGDASKV-KTFVRGGIVNATKEEHEADEKRGKLYKP--------SSRFSEPKSQQSSNERPPPPIILGEPKKPPLKKGEKEKKKSNLELFKEELKH 146          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Xenopus
Match: u2surp (U2 snRNP associated SURP domain containing [Source:NCBI gene;Acc:100216247])

HSP 1 Score: 408.297 bits (1048), Expect = 1.185e-126
Identity = 306/784 (39.03%), Postives = 419/784 (53.44%), Query Frame = 3
Query:   33 IIKMSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDKIPDKFKE-KFQSEFNKKPP---LLGKPKE-------QSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIV-----EPPALXXXXXXXXXXXXXLLSVKPLVDYDGDPLDVDGVPLDSKATEATNSTEILDMFANPSSPQTKRITKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQ 2318
            I KMS  ++ +T++   ++E +K +  +  A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GKLY+P          +F E K Q   N++PP   +LG+PK+       + K+KSNLE F EELKQ+Q+ER+ R+ K K  T R E         P   +++  R+   D       +   A    +P   D       D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  +  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+   N ++  M      + E+  + +K                   +++ FV+REG  FEA IMN+E+ NP F+FLF+ Q+P HVYYRWKLYS L                      RP  LN            DID SK  L  ++    N              C                  QR++L EIL  L P K+ IGEAM++CL HA++AE+++D I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRKY E  L Q+   LN  Y  I   ++SE  K +V++CFRAW DW +YP  +L +L+N FLG+V     EP  + ++     + EE  L V  + D DG P  +DG P+D        S E  D+   P          EP+F   PSKWE VD ++ ES+ V  S+W+L +  
Sbjct:   34 IGKMSAAAK-RTLSKKEQDELKKKEDEKAAAEIYEEFLAAFEGGDASKV-KTFVRGGIVNATKEEHEADEKRGKLYKP--------SSRFSEPKSQQSSNERPPPPIILGEPKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERH-KTKGRTSRFE---------PPQTDTDTQRRL-MDTPSSRRSRSSGALDDYAPGSHDV-----GDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMVMNFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK---NPNAPMM--PLPKNKEEFEKVIKTA-----------------KLLAFVVREGPMFEAMIMNREINNPMFRFLFENQAPAHVYYRWKLYSILQ---------------------RPLYLN------------DIDISK-DLRAVTGINGN-------------FCFR----------------QRDKLEEILRGLTPRKNDIGEAMMFCLNHAEAAEEIVDCITESL----------SILKT---PLPKKIARLYLVSDVLYNSSAKVANASYYRKYFEAKLCQIFADLNAAYRAIQGHLQSENFKQRVMACFRAWEDWAIYPEPYLIRLQNIFLGLVNIEDKEPEEVPDDLDGAPIEEE--LDVPLIEDVDGIP--IDGAPIDDLDGVPIKSLED-DLDGVPLDINDDAKKNEPIFKVAPSKWEAVDESELESQAVTTSKWELFDQH 688          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Xenopus
Match: u2surp (U2 snRNP associated SURP domain containing [Source:NCBI gene;Acc:100216247])

HSP 1 Score: 405.216 bits (1040), Expect = 3.433e-126
Identity = 306/784 (39.03%), Postives = 419/784 (53.44%), Query Frame = 3
Query:   33 IIKMSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDKIPDKFKE-KFQSEFNKKPP---LLGKPKE-------QSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIV-----EPPALXXXXXXXXXXXXXLLSVKPLVDYDGDPLDVDGVPLDSKATEATNSTEILDMFANPSSPQTKRITKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQ 2318
            I KMS  ++ +T++   ++E +K +  +  A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GKLY+P          +F E K Q   N++PP   +LG+PK+       + K+KSNLE F EELKQ+Q+ER+ R+ K K  T R E         P   +++  R+   D       +   A    +P   D       D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  +  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+   N ++  M      + E+  + +K                   +++ FV+REG  FEA IMN+E+ NP F+FLF+ Q+P HVYYRWKLYS L                      RP  LN            DID SK  L  ++    N              C                  QR++L EIL  L P K+ IGEAM++CL HA++AE+++D I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRKY E  L Q+   LN  Y  I   ++SE  K +V++CFRAW DW +YP  +L +L+N FLG+V     EP  + ++     + EE  L V  + D DG P  +DG P+D        S E  D+   P          EP+F   PSKWE VD ++ ES+ V  S+W+L +  
Sbjct:   64 IGKMSAAAK-RTLSKKEQDELKKKEDEKAAAEIYEEFLAAFEGGDASKV-KTFVRGGIVNATKEEHEADEKRGKLYKP--------SSRFSEPKSQQSSNERPPPPIILGEPKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERH-KTKGRTSRFE---------PPQTDTDTQRR-LMDTPSSRRSRSSGALDDYAPGSHDV-----GDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMVMNFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK---NPNAPMM--PLPKNKEEFEKVIKTA-----------------KLLAFVVREGPMFEAMIMNREINNPMFRFLFENQAPAHVYYRWKLYSILQ---------------------RPLYLN------------DIDISK-DLRAVTGINGN-------------FCFR----------------QRDKLEEILRGLTPRKNDIGEAMMFCLNHAEAAEEIVDCITESL----------SILKT---PLPKKIARLYLVSDVLYNSSAKVANASYYRKYFEAKLCQIFADLNAAYRAIQGHLQSENFKQRVMACFRAWEDWAIYPEPYLIRLQNIFLGLVNIEDKEPEEVPDDLDGAPIEEE--LDVPLIEDVDGIP--IDGAPIDDLDGVPIKSLED-DLDGVPLDINDDAKKNEPIFKVAPSKWEAVDESELESQAVTTSKWELFDQH 718          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Xenopus
Match: u2surp (U2 snRNP associated SURP domain containing [Source:NCBI gene;Acc:100216247])

HSP 1 Score: 407.142 bits (1045), Expect = 7.253e-126
Identity = 306/784 (39.03%), Postives = 419/784 (53.44%), Query Frame = 3
Query:   33 IIKMSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDKIPDKFKE-KFQSEFNKKPP---LLGKPKE-------QSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIV-----EPPALXXXXXXXXXXXXXLLSVKPLVDYDGDPLDVDGVPLDSKATEATNSTEILDMFANPSSPQTKRITKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQ 2318
            I KMS  ++ +T++   ++E +K +  +  A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GKLY+P          +F E K Q   N++PP   +LG+PK+       + K+KSNLE F EELKQ+Q+ER+ R+ K K  T R E         P   +++  R+   D       +   A    +P   D       D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  +  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+   N ++  M      + E+  + +K                   +++ FV+REG  FEA IMN+E+ NP F+FLF+ Q+P HVYYRWKLYS L                      RP  LN            DID SK  L  ++    N              C                  QR++L EIL  L P K+ IGEAM++CL HA++AE+++D I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRKY E  L Q+   LN  Y  I   ++SE  K +V++CFRAW DW +YP  +L +L+N FLG+V     EP  + ++     + EE  L V  + D DG P  +DG P+D        S E  D+   P          EP+F   PSKWE VD ++ ES+ V  S+W+L +  
Sbjct:   64 IGKMSAAAK-RTLSKKEQDELKKKEDEKAAAEIYEEFLAAFEGGDASKV-KTFVRGGIVNATKEEHEADEKRGKLYKP--------SSRFSEPKSQQSSNERPPPPIILGEPKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERH-KTKGRTSRFE---------PPQTDTDTQRRL-MDTPSSRRSRSSGALDDYAPGSHDV-----GDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMVMNFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK---NPNAPMM--PLPKNKEEFEKVIKTA-----------------KLLAFVVREGPMFEAMIMNREINNPMFRFLFENQAPAHVYYRWKLYSILQ---------------------RPLYLN------------DIDISK-DLRAVTGINGN-------------FCFR----------------QRDKLEEILRGLTPRKNDIGEAMMFCLNHAEAAEEIVDCITESL----------SILKT---PLPKKIARLYLVSDVLYNSSAKVANASYYRKYFEAKLCQIFADLNAAYRAIQGHLQSENFKQRVMACFRAWEDWAIYPEPYLIRLQNIFLGLVNIEDKEPEEVPDDLDGAPIEEE--LDVPLIEDVDGIP--IDGAPIDDLDGVPIKSLED-DLDGVPLDINDDAKKNEPIFKVAPSKWEAVDESELESQAVTTSKWELFDQH 718          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Mouse
Match: U2surp (U2 snRNP-associated SURP domain containing [Source:MGI Symbol;Acc:MGI:1915208])

HSP 1 Score: 498.819 bits (1283), Expect = 2.929e-160
Identity = 322/755 (42.65%), Postives = 439/755 (58.15%), Query Frame = 3
Query:  120 TAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLL-----GKP----KEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSET-DRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEPPALXXXXXXXXXXXXXLLSVKPL-VDYDGDPL-DVDGVPLDSKATEATNSTEIL----DMFANPSSPQTKRITKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQ 2318
             A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GK+Y+P  +  D+     K       N++PP L      KP     E+ K+KSNLE F EELKQ+Q+ER+ R++ +  ++        +F  EP   +S+  R+S  D+       P      S   D   P   +  D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+   N ++  +      + ED  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP F+FLF+ Q+P HVYYRWKLYS L G+S   W+T++F M+K G +WRPPPLNP+  G+ EE                              Q  E  +E P       K  L + QR++L EIL  L P K+ IG+AMV+CL +A++AE+++D I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRK+ E  L Q+   LN  Y TI   ++SE  K +V++CFRAW DW +YP  FL KL+N FLG+V     +  +        + L   P+  + DG PL DVDG+P+D+   +  +   I     D+   P          EP+F   PSKWE VD ++ E++ V  S+W+L +  
Sbjct:   69 AAEIYEEFLAAFEGSDGNKV-KTFVRGGVVNAAKDEHETDEKRGKIYKPSSRFADQ-----KNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLS--------RF--EPPQSDSDGQRRS-MDV-------PSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK---NPNAPML--PPPKNKEDFEKTLSQAIVKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEE------------------------------QETEAFVEEPSK-----KGALKEEQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESL----------SILKT---PLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLV-----NIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWELFDQH 741          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Mouse
Match: U2surp (U2 snRNP-associated SURP domain containing [Source:MGI Symbol;Acc:MGI:1915208])

HSP 1 Score: 499.975 bits (1286), Expect = 3.073e-160
Identity = 322/755 (42.65%), Postives = 439/755 (58.15%), Query Frame = 3
Query:  120 TAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLL-----GKP----KEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSET-DRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEPPALXXXXXXXXXXXXXLLSVKPL-VDYDGDPL-DVDGVPLDSKATEATNSTEIL----DMFANPSSPQTKRITKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQ 2318
             A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GK+Y+P  +  D+     K       N++PP L      KP     E+ K+KSNLE F EELKQ+Q+ER+ R++ +  ++        +F  EP   +S+  R+S  D+       P      S   D   P   +  D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+   N ++  +      + ED  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP F+FLF+ Q+P HVYYRWKLYS L G+S   W+T++F M+K G +WRPPPLNP+  G+ EE                              Q  E  +E P       K  L + QR++L EIL  L P K+ IG+AMV+CL +A++AE+++D I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRK+ E  L Q+   LN  Y TI   ++SE  K +V++CFRAW DW +YP  FL KL+N FLG+V     +  +        + L   P+  + DG PL DVDG+P+D+   +  +   I     D+   P          EP+F   PSKWE VD ++ E++ V  S+W+L +  
Sbjct:  113 AAEIYEEFLAAFEGSDGNKV-KTFVRGGVVNAAKDEHETDEKRGKIYKPSSRFADQ-----KNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLS--------RF--EPPQSDSDGQRRS-MDV-------PSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK---NPNAPML--PPPKNKEDFEKTLSQAIVKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEE------------------------------QETEAFVEEPSK-----KGALKEEQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESL----------SILKT---PLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLV-----NIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWELFDQH 785          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Mouse
Match: U2surp (U2 snRNP-associated SURP domain containing [Source:MGI Symbol;Acc:MGI:1915208])

HSP 1 Score: 499.975 bits (1286), Expect = 3.092e-160
Identity = 321/756 (42.46%), Postives = 439/756 (58.07%), Query Frame = 3
Query:  120 TAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLL-----GKP----KEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSE--TDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEPPALXXXXXXXXXXXXXLLSVKPL-VDYDGDPL-DVDGVPLDSKATEATNSTEIL----DMFANPSSPQTKRITKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQ 2318
             A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GK+Y+P  +  D+     K       N++PP L      KP     E+ K+KSNLE F EELKQ+Q+ER+ R++ +  ++        +F  EP   +S+  R+S            +P+    S    D+   S    D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+   N ++  +      + ED  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP F+FLF+ Q+P HVYYRWKLYS L G+S   W+T++F M+K G +WRPPPLNP+  G+ EE                              Q  E  +E P       K  L + QR++L EIL  L P K+ IG+AMV+CL +A++AE+++D I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRK+ E  L Q+   LN  Y TI   ++SE  K +V++CFRAW DW +YP  FL KL+N FLG+V     +  +        + L   P+  + DG PL DVDG+P+D+   +  +   I     D+   P          EP+F   PSKWE VD ++ E++ V  S+W+L +  
Sbjct:  113 AAEIYEEFLAAFEGSDGNKV-KTFVRGGVVNAAKDEHETDEKRGKIYKPSSRFADQ-----KNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLS--------RF--EPPQSDSDGQRRSM----------DVPSRRNRSSVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK---NPNAPML--PPPKNKEDFEKTLSQAIVKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEE------------------------------QETEAFVEEPSK-----KGALKEEQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESL----------SILKT---PLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLV-----NIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWELFDQH 784          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Mouse
Match: U2surp (U2 snRNP-associated SURP domain containing [Source:MGI Symbol;Acc:MGI:1915208])

HSP 1 Score: 207.994 bits (528), Expect = 2.699e-58
Identity = 145/304 (47.70%), Postives = 189/304 (62.17%), Query Frame = 3
Query:  120 TAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTH-SSEGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLL-----GKP----KEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSET-DRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQ 992
             A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GK+Y+P  +  D+     K       N++PP L      KP     E+ K+KSNLE F EELKQ+Q+ER+ R++ +  ++        +F  EP   +S+  R+S  D+       P      S   D   P   +  D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+
Sbjct:  113 AAEIYEEFLAAFEGSDGNKV-KTFVRGGVVNAAKDEHETDEKRGKIYKPSSRFADQ-----KNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLS--------RF--EPPQSDSDGQRRS-MDV-------PSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK 392          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Mouse
Match: Pabpc6 (poly(A) binding protein, cytoplasmic 6 [Source:MGI Symbol;Acc:MGI:1914793])

HSP 1 Score: 62.003 bits (149), Expect = 3.251e-9
Identity = 27/78 (34.62%), Postives = 50/78 (64.10%), Query Frame = 3
Query:  636 TNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLG 869
            TN+++ NL  ++ +++L +LFGRFGP  SVK+M     +E  + +  GFV+F    D  +A+E++ G ++ G ++ +G
Sbjct:  191 TNVYIKNLGEDMDDERLQDLFGRFGPALSVKVMT----DESGKSKGFGFVSFERHEDARKAVEEMNGKDLNGKQIYVG 264          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. UniProt/SwissProt
Match: sp|O15042|SR140_HUMAN (U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens OX=9606 GN=U2SURP PE=1 SV=2)

HSP 1 Score: 500.745 bits (1288), Expect = 1.350e-159
Identity = 321/755 (42.52%), Postives = 438/755 (58.01%), Query Frame = 3
Query:  120 TAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLL-----GKP----KEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSET-DRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEPPALXXXXXXXXXXXXXLLSVKPL-VDYDGDPL-DVDGVPLDSKATEATNSTEIL----DMFANPSSPQTKRITKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQ 2318
             A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GK+Y+P  +  D+     K       N++PP L      KP     E+ K+KSNLE F EELKQ+Q+ER+ R++ +  ++        +F  EP   +S+  R+S        +  P      S   D   P   +  D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+   N ++  +      + ED  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP F+FLF+ Q+P HVYYRWKLYS L G+S   W+T++F M+K G +WRPPPLNP+  G+ EE                              Q  E  +E P       K  L + QR++L EIL  L P K+ IG+AMV+CL +A++AE+++D I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRK+ E  L Q+   LN  Y TI   ++SE  K +V++CFRAW DW +YP  FL KL+N FLG+V     +  +        + L   P+  + DG PL DVDG+P+D+   +  +   I     D+   P          EP+F   PSKWE VD ++ E++ V  S+W+L +  
Sbjct:  113 AAEIYEEFLAAFEGSDGNKV-KTFVRGGVVNAAKEEHETDEKRGKIYKPSSRFADQ-----KNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLS--------RF--EPPQSDSDGQRRS--------MDAPSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK---NPNAPML--PPPKNKEDFEKTLSQAIVKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEE------------------------------QETEAFVEEPSK-----KGALKEEQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESL----------SILKT---PLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLV-----NIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWELFDQH 785          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. UniProt/SwissProt
Match: sp|Q6NV83|SR140_MOUSE (U2 snRNP-associated SURP motif-containing protein OS=Mus musculus OX=10090 GN=U2surp PE=1 SV=3)

HSP 1 Score: 499.975 bits (1286), Expect = 2.149e-159
Identity = 322/755 (42.65%), Postives = 439/755 (58.15%), Query Frame = 3
Query:  120 TAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLL-----GKP----KEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSET-DRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEPPALXXXXXXXXXXXXXLLSVKPL-VDYDGDPL-DVDGVPLDSKATEATNSTEIL----DMFANPSSPQTKRITKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQ 2318
             A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GK+Y+P  +  D+     K       N++PP L      KP     E+ K+KSNLE F EELKQ+Q+ER+ R++ +  ++        +F  EP   +S+  R+S  D+       P      S   D   P   +  D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+   N ++  +      + ED  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP F+FLF+ Q+P HVYYRWKLYS L G+S   W+T++F M+K G +WRPPPLNP+  G+ EE                              Q  E  +E P       K  L + QR++L EIL  L P K+ IG+AMV+CL +A++AE+++D I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRK+ E  L Q+   LN  Y TI   ++SE  K +V++CFRAW DW +YP  FL KL+N FLG+V     +  +        + L   P+  + DG PL DVDG+P+D+   +  +   I     D+   P          EP+F   PSKWE VD ++ E++ V  S+W+L +  
Sbjct:  113 AAEIYEEFLAAFEGSDGNKV-KTFVRGGVVNAAKDEHETDEKRGKIYKPSSRFADQ-----KNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLS--------RF--EPPQSDSDGQRRS-MDV-------PSRRNRSSGVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK---NPNAPML--PPPKNKEDFEKTLSQAIVKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEE------------------------------QETEAFVEEPSK-----KGALKEEQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESL----------SILKT---PLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLV-----NIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWELFDQH 785          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. UniProt/SwissProt
Match: sp|Q5R7X2|SR140_PONAB (U2 snRNP-associated SURP motif-containing protein OS=Pongo abelii OX=9601 GN=U2SURP PE=2 SV=1)

HSP 1 Score: 499.204 bits (1284), Expect = 5.090e-159
Identity = 321/756 (42.46%), Postives = 438/756 (57.94%), Query Frame = 3
Query:  120 TAIVYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLL-----GKP----KEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSE--TDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEPPALXXXXXXXXXXXXXLLSVKPL-VDYDGDPL-DVDGVPLDSKATEATNSTEIL----DMFANPSSPQTKRITKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQ 2318
             A +Y++F+  FE  +  KV KT+V+GG VN     H + E  GK+Y+P  +  D+     K       N++PP L      KP     E+ K+KSNLE F EELKQ+Q+ER+ R++ +  ++        +F  EP   +S+  R+S             P+    S    D+   S    D +TTNL+LGN+NP++ E+ LC+ FGRFGPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+   N ++  +      + ED  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP F+FLF+ Q+P HVYYRWKLYS L G+S   W+T++F M+K G +WRPPPLNP+  G+ EE                              Q  E  +E P       K  L + QR++L EIL  L P K+ IG+AMV+CL +A++AE+++D I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRK+ E  L Q+   LN  Y TI   ++SE  K +V++CFRAW DW +YP  FL KL+N FLG+V     +  +        + L   P+  + DG PL DVDG+P+D+   +  +   I     D+   P          EP+F   PSKWE VD ++ E++ V  S+W+L +  
Sbjct:  113 AAEIYEEFLAAFEGSDGNKV-KTFVRGGVVNAAKEEHETDEKRGKIYKPSSRFADQ-----KNPPNQSSNERPPSLLVIETKKPPLKKGEKEKKKSNLELFKEELKQIQEERDERHKTKGRLS--------RF--EPPQSDSDGQRRSM----------DAPSRRNRSSVLDDYAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRFGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKNLNGKMIMSFEMKLGWGKAVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLK---NPNAPML--PPPKNKEDFEKTLSQAIVKVVIPTERNLLALIHRMIEFVVREGPMFEAMIMNREINNPMFRFLFENQTPAHVYYRWKLYSILQGDSPTKWRTEDFRMFKNGSFWRPPPLNPYLHGMSEE------------------------------QETEAFVEEPSK-----KGALKEEQRDKLEEILRGLTPRKNDIGDAMVFCLNNAEAAEEIVDCITESL----------SILKT---PLPKKIARLYLVSDVLYNSSAKVANASYYRKFFETKLCQIFSDLNATYRTIQGHLQSENFKQRVMTCFRAWEDWAIYPEPFLIKLQNIFLGLV-----NIIEEKETEDVPDDLDGAPIEEELDGAPLEDVDGIPIDATPIDDLDGVPIKSLDDDLDGVPLDATEDSKKNEPIFKVAPSKWEAVDESELEAQAVTTSKWELFDQH 784          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. UniProt/SwissProt
Match: sp|Q9C5J3|RRC1_ARATH (Protein RRC1 OS=Arabidopsis thaliana OX=3702 GN=RRC1 PE=1 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 3.626e-95
Identity = 220/647 (34.00%), Postives = 327/647 (50.54%), Query Frame = 3
Query:   84 EEEARKLQANEETAIVYQQFIETFEEPPKVNKTWVKGGTVNPG------SSTHSSEGAGKLYQPLMKTVDK-IPDKFKEKFQSEFNKKPPLLGKPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFL 2003
            EEEARK +A +ETA +YQ+F+E+F+      KT+V+GGT+NPG      S    S+  G + +   + V   +P     K +    K+     + +E+ K + N++ F EELK+ Q+ RE RNQ          D + +    P  +  E P    FD          P+  P S FD       + D  TTNL++GNL+P++ E  L   FGRFGP+ASVKIMWPR+DEEK R RNCGFV+FMNR+DG+ A ++++G  +  YE+K+GWGK V +P   +  PP     I+      L F+ Q       TG      +       + +L  T     + V  P D  L  +I+ +  +V+     FE  IM +   NP FKF+F+  S EH YY W+LYS   G++ + W+T+ +IM  G   W PPPL P T                     +Q      +S  +A ++    +E          R LTD QR+   ++L  L   +  I EAM + L++AD+A +V++++   +        + SI           VA L LVSDILHNS A+V+NAS YR   E +LP +M   N  Y +IT +I +E LK +VL   + W DW+++   ++  L++ FL
Sbjct:   19 EEEARKKKAEDETARLYQEFVESFQGDNATTKTFVRGGTINPGDKPKVDSEGEKSKDGGSVSKKGSRYVPSFLPPPLASKGKEPEKKREEERPREREKGKTR-NIDNFMEELKREQEMRERRNQ----------DRDRQGDSSPSSRFDELP--DDFD----------PSGRPGS-FD-------DGDPQTTNLYVGNLSPKVDENFLLRTFGRFGPIASVKIMWPRTDEEKRRQRNCGFVSFMNRADGQAAKDEMQGIIVYEYELKIGWGKAVSLPSQALPAPPPGHMAIRSKEGCNLVFSGQ-------TGP----PIITSVPNQNSELVLTPNVPDITVVTPEDEHLRHVIDTLALYVLDGECAFEQAIMERGRGNPLFKFMFELGSKEHTYYVWRLYSFAQGDTLQRWRTEPYIMITGSGRWIPPPL-PVTR--------------------TQEHEKESASTYAAGRTRRAEVE----------RTLTDPQRDEFEDMLRALTLERSQIKEAMGFALDNADAAGEVVEVLTESL-----TLKETSIPTK--------VARLMLVSDILHNSSARVKNASAYRTKFEATLPDIMESFNDLYRSITGRITAEALKERVLKVLQVWADWFLFSDAYIYGLRSTFL 579          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. UniProt/SwissProt
Match: sp|F4KIA8|RRC1L_ARATH (Protein RRC1-like OS=Arabidopsis thaliana OX=3702 GN=At5g10800 PE=2 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 3.235e-74
Identity = 191/557 (34.29%), Postives = 274/557 (49.19%), Query Frame = 3
Query:  342 KPKEQSKRKS-NLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDS--ETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFL 2003
            + KE  K K+ N++ F EELK+ Q+ RE RNQ +    E   D            NS+    SRFD             LP   FD      S  + D  TTNL++ NL+ ++ E  L   FGRFGP+ASVKIMWPR++EEK R R+CGFVAFMNR+DGE A EK++G  +  YE+K+GWGK V +P   +  PP     I+      L F+      +    N +S            +L  T     + V  P D  L Q+I+ M   V+  G  FE  IM +   NP F FLF+  S EH YY W+LYS   G++ + W+T+ +IM  G   W PPPL P T   PE                     +   S+ +       C E         ++ LTDSQR+   ++L  L   +  I EAM + L++A++A +V++++   +        + SI           VA L LVSDI+HNS A+V+NAS YR   E +LP +M   N  Y ++  +I +E L+ +VL   + W DW+++   ++  L+  FL
Sbjct:  114 RSKEMEKGKTRNIDHFVEELKREQEIRERRNQDR----ENSRD-----------HNSDNTSSSRFD------------ELPDY-FDPSGRLGSLDDGDPQTTNLYVVNLSSKVDENFLLRTFGRFGPIASVKIMWPRTEEEKRRERHCGFVAFMNRADGEAAKEKMQGIIVYEYELKIGWGKVVFLPSQALPAPPPGHMAIRSKEGCNLIFSVTSGPPMNSVPNQNS------------ELVLTPNVPDITVISPEDEHLKQIIDTMALNVLDGGCAFEQAIMERGRGNPLFNFLFELGSKEHTYYVWRLYSFAQGDTLQRWRTEPYIMIAGSGRWIPPPL-PATRS-PE---------------------HGKESRGTYAAGKSRCTE--------AEQTLTDSQRDEFEDMLRALTLERSQIREAMGFALDNAEAAGEVVEVLTESL-----TLKETSIPTK--------VARLMLVSDIIHNSSARVKNASAYRTKFEATLPDIMESFNDLYHSVHGRITAEALRERVLKVLQVWADWFLFSDAYINGLRATFL 586          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. TrEMBL
Match: A0A4S2M2L5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003175 PE=4 SV=1)

HSP 1 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 388/906 (42.83%), Postives = 531/906 (58.61%), Query Frame = 3
Query:   63 KTVADTIEEEARKLQANEETAIVYQQFIETFEEPPKVNKTWVKGGTVNPGSSTHSSEGAG--KLYQPLMKTVDKI--PDKFKEKFQSEFNKKPPLLGKPKEQSKRKSNLEAFSEELKQLQQEREMRN---QKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSS----------PFDI-----------DFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQK------------TGNVD---------SRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIV------TQIDKTIGYATDKSI-----ENSNAA---GLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVE-----------PPALXXXXXXXXXXXX--------XLLSVKPLVDYDGDPLDVDGVPLDSKATE-----------ATNSTEILDMFANPSSPQTKRITKEPLFVPSKWETVDPADEESEIV--QSRWQLMESQSEDKKSSDNEDPDGYPLSDNDENFNLSMIKSHDLSPKNKKNDEN------RNITSLVSY 2477
            K +   +E+  +K +  E+T  V+Q F+ TFE   K  +TWVKGG VNPGS   SS  +   ++Y+P+ K  +K    D  K + +    +KPP LGK + + ++KS LE F EELK +QQ+RE R+   Q + +       I++      E+  S+   +SR   N      PL  T  SS          P +I           D+PYD + DRTTTNLFLGNLNP++TEQQLCE FGR+GPLASVKIMWPR+DEE++RGRNCGFVAFMNR DGERAL+ +RG E+ G+EMKLGWGK+V IP +PIY+PP L+E+IKPPPPSGLPFNAQPR+WL+             T  VD          RK FD+  MS+++L E LK+ +VKV IP+DR +L LI+RM+EFV+ EG +FEA IM++E  NP FKFLFD+QS EH YYRWKL+S LHGES  +W+TDEF M++ GP WRPPP+N F+ G+PE+L+E+ D+               D+  + A   +  C              LT++QR R  ++L+DLEP + ++G+ MVWCLEHAD+A D+ D +V      + +D++   ++ K++     + S A     +++ VA LFL+SDILHNS AKV NAS++RK  E  LP V ++L+  Y ++  K+K+EQLK KV+ CF AW DW +YP D+L +L+N FLG+V            P  L         S+          +L  +PLV YDGDPLDVDG PLD    E             N  +++   A+ SS +        LFVPSKWETVDPA  ES+ V   SRW+L+   +  + +  N    G   S  + +  L   +  DLS +N  ND+         I +LV+Y
Sbjct:   19 KNILKKLEDHHKKKEEEEQTQKVFQDFVATFEGDSK-QRTWVKGGVVNPGSDGGSSGSSSESRIYKPVSKISEKQSNADSAKPESKPSLPEKPPSLGKRRGKEQKKSKLEQFKEELKLIQQQREQRHALRQGKNVSPSAASTIHS------ELDLSDVGSRSREYRN-----PPLGFTQQSSGVGLLGDSGSPSNIYGRRSQRDRRDDYPYDFDGDRTTTNLFLGNLNPKMTEQQLCEAFGRYGPLASVKIMWPRTDEERSRGRNCGFVAFMNRKDGERALDNIRGKELMGFEMKLGWGKSVPIPLYPIYIPPALLELIKPPPPSGLPFNAQPRDWLKSLRSAIKERAKLVTDGVDPEATRPPAADRKPFDVNKMSEDELGEVLKDAIVKVVIPSDRSILALIHRMIEFVVLEGPQFEAAIMHREQNNPQFKFLFDYQSSEHTYYRWKLWSVLHGESVNNWRTDEFRMFENGPLWRPPPMNLFSGGMPEDLVEEDDYPYAPGYVPPLQARRHDAELDEAMALSRQC-------------GLTEAQRGRFTQMLVDLEPSRANVGDVMVWCLEHADAASDITDCVVDALSFTSSLDQSEAVSSPKNVVSEMPDESKAKPSLSVSKAVARLFLISDILHNSSAKVPNASYFRKCFERRLPDVFLNLHALYESVDGKLKAEQLKQKVMLCFHAWDDWAIYPNDYLIRLQNIFLGLVSEIDDESDLAGVPLELEGAAVIDVSSKSLPTLDPDVEMLQGQPLVQYDGDPLDVDGSPLDDTDQEDKPIAKKPKESVINEPKVVSPDADSSSTR--------LFVPSKWETVDPATVESQAVTTTSRWELLTDGAPTQLTEPNNHVRGVRESGMERSVKLG--RWDDLS-QNSTNDDELDGQPLTGIGALVAY 888          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. TrEMBL
Match: A0A4V3SG04 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003175 PE=4 SV=1)

HSP 1 Score: 654.055 bits (1686), Expect = 0.000e+0
Identity = 388/906 (42.83%), Postives = 531/906 (58.61%), Query Frame = 3
Query:   63 KTVADTIEEEARKLQANEETAIVYQQFIETFEEPPKVNKTWVKGGTVNPGSSTHSSEGAG--KLYQPLMKTVDKI--PDKFKEKFQSEFNKKPPLLGKPKEQSKRKSNLEAFSEELKQLQQEREMRN---QKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSS----------PFDI-----------DFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQK------------TGNVD---------SRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIV------TQIDKTIGYATDKSI-----ENSNAA---GLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVE-----------PPALXXXXXXXXXXXX--------XLLSVKPLVDYDGDPLDVDGVPLDSKATE-----------ATNSTEILDMFANPSSPQTKRITKEPLFVPSKWETVDPADEESEIV--QSRWQLMESQSEDKKSSDNEDPDGYPLSDNDENFNLSMIKSHDLSPKNKKNDEN------RNITSLVSY 2477
            K +   +E+  +K +  E+T  V+Q F+ TFE   K  +TWVKGG VNPGS   SS  +   ++Y+P+ K  +K    D  K + +    +KPP LGK + + ++KS LE F EELK +QQ+RE R+   Q + +       I++      E+  S+   +SR   N      PL  T  SS          P +I           D+PYD + DRTTTNLFLGNLNP++TEQQLCE FGR+GPLASVKIMWPR+DEE++RGRNCGFVAFMNR DGERAL+ +RG E+ G+EMKLGWGK+V IP +PIY+PP L+E+IKPPPPSGLPFNAQPR+WL+             T  VD          RK FD+  MS+++L E LK+ +VKV IP+DR +L LI+RM+EFV+ EG +FEA IM++E  NP FKFLFD+QS EH YYRWKL+S LHGES  +W+TDEF M++ GP WRPPP+N F+ G+PE+L+E+ D+               D+  + A   +  C              LT++QR R  ++L+DLEP + ++G+ MVWCLEHAD+A D+ D +V      + +D++   ++ K++     + S A     +++ VA LFL+SDILHNS AKV NAS++RK  E  LP V ++L+  Y ++  K+K+EQLK KV+ CF AW DW +YP D+L +L+N FLG+V            P  L         S+          +L  +PLV YDGDPLDVDG PLD    E             N  +++   A+ SS +        LFVPSKWETVDPA  ES+ V   SRW+L+   +  + +  N    G   S  + +  L   +  DLS +N  ND+         I +LV+Y
Sbjct:   19 KNILKKLEDHHKKKEEEEQTQKVFQDFVATFEGDSK-QRTWVKGGVVNPGSDGGSSGSSSESRIYKPVSKISEKQSNADSAKPESKPSLPEKPPSLGKRRGKEQKKSKLEQFKEELKLIQQQREQRHALRQGKNVSPSAASTIHS------ELDLSDVGSRSREYRN-----PPLGFTQQSSGVGLLGDSGSPSNIYGRRSQRDRRDDYPYDFDGDRTTTNLFLGNLNPKMTEQQLCEAFGRYGPLASVKIMWPRTDEERSRGRNCGFVAFMNRKDGERALDNIRGKELMGFEMKLGWGKSVPIPLYPIYIPPALLELIKPPPPSGLPFNAQPRDWLKSLRSAIKERAKLVTDGVDPEATRPPAADRKPFDVNKMSEDELGEVLKDAIVKVVIPSDRSILALIHRMIEFVVLEGPQFEAAIMHREQNNPQFKFLFDYQSSEHTYYRWKLWSVLHGESVNNWRTDEFRMFENGPLWRPPPMNLFSGGMPEDLVEEDDYPYAPGYVPPLQARRHDAELDEAMALSRQC-------------GLTEAQRGRFTQMLVDLEPSRANVGDVMVWCLEHADAASDITDCVVDALSFTSSLDQSEAVSSPKNVVSEMPDESKAKPSLSVSKAVARLFLISDILHNSSAKVPNASYFRKCFERRLPDVFLNLHALYESVDGKLKAEQLKQKVMLCFHAWDDWAIYPNDYLIRLQNIFLGLVSEIDDESDLAGVPLELEGAAVIDVSSKSLPTLDPDVEMLQGQPLVQYDGDPLDVDGSPLDDTDQEDKPIAKKPKESVINEPKVVSPDADSSSTR--------LFVPSKWETVDPATVESQAVTTTSRWELLTDGAPTQLTEPNNHVRGVRESGMERSVKLG--RWDDLS-QNSTNDDELDGQPLTGIGALVAY 888          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. TrEMBL
Match: A0A4Z2DBL8 (U2 snRNP-associated SURP motif-containing protein OS=Schistosoma japonicum OX=6182 GN=EWB00_002578 PE=4 SV=1)

HSP 1 Score: 650.588 bits (1677), Expect = 0.000e+0
Identity = 362/817 (44.31%), Postives = 506/817 (61.93%), Query Frame = 3
Query:   96 RKLQANEETAIVYQQFIETFEEPPKVNKTWVKGGTVNPGS-STHSSEGAGKLYQPLMKTVDKIPDKFKEKFQSEFNK---KPPLLGKPKEQSKRKSNLEAFSEELKQLQQERE----MRNQKQKLVTERVEDINNKFVKEPEIK-----NSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQK--------------TGNVDS-------RKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDK-----------------------SIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVE------------PPALXXXXXXXXXXXX--------XLLSVKPLVDYDGDPLDVDGVPLDSKATEATNSTEILD--MFANPSSPQTK--RITKEPLFVPSKWETVDPADEESEIVQSRWQ 2303
            +K +  E T  V+++F+ TFEEP K ++ WVKGG VNP S S   S+G+G+LY+P+ K   K+ +K +++ +++  K   KPP LGK K Q ++KS LE F EELK +QQ+RE    +R  + +  T+   D+++  ++  E +     N      + F   +            +   D+D+PYD + DRTTTNLFLGNLNP++TEQQLCE FGR+GPLASVKIMWPR++EE++RGRNCGFVAFMNR DGERAL+ +RG E+ G+EMKLGWGK+V IP +P+Y+PP L+E++KPPPPSGLPFNAQPREWL+                G+ D+       RK +D+  MS E+L E L++ VVKV +P+DR +L LI+RM+EFV+ EG +FEA IM++E+ NP FKFLFD+QS +HVYYRWKL+S LHGES   W+T+EF M++GGP WRPPP+N F+ G+PE+L+E+ D+              +   +ES +   E+ +E   ++       LT++QR R  ++L DLEP +  IGE MVWCLEHADSA D+   IV  +     + +++                         E S +  +N++VA LFL SDIL+NS AKV NASF+RK  E  LP +  +LN +Y  +  K+K+EQLK KV+ CFRAW DW VYP +FL KL+N FLG+V             P  + E++ N  ++++         +L  +PLV YDGD LDVDG PLD++   + +     D     NP   + K    T   LFVPSKWET++  + E+  V S W+
Sbjct:   30 KKKKDEEHTQQVFEEFVATFEEPSK-SRAWVKGGVVNPSSGSVEDSKGSGRLYRPVSKLDSKL-NKTEDQNKTDLKKSTEKPPALGKRKGQEQKKSKLEQFKEELKLIQQQREQRHALRQGRNQPSTQSELDLSDVGMRNREYRRGFSNNQGGDSGAGFHNTVSTPPSFYSKRSQNDRHDVDYPYDYDGDRTTTNLFLGNLNPKMTEQQLCEAFGRYGPLASVKIMWPRTEEERSRGRNCGFVAFMNRKDGERALDNIRGKELMGFEMKLGWGKSVPIPLYPVYIPPALLELVKPPPPSGLPFNAQPREWLKSFRLAIKERAKLVTDGGDSDNALPPAPDRKPYDINKMSSEELTEVLRDAVVKVVMPSDRSILALIHRMIEFVVLEGPQFEAAIMHREVNNPMFKFLFDYQSSDHVYYRWKLWSVLHGESVTKWRTEEFRMFEGGPLWRPPPVNLFSGGMPEDLVEEDDYPYAP----GYVPPPSGRRRESEDLQEEIRLEAAAASRRC---GLTEAQRGRFTQMLEDLEPCRIKIGEVMVWCLEHADSASDIALCIVDSVAPNSSFTSNQLEKETNSVDENLAADFKSDQDTTDHEKSQSISINKLVARLFLASDILYNSSAKVPNASFFRKCFETCLPDMFKNLNSHYKNVEGKLKAEQLKQKVMLCFRAWEDWAVYPNEFLIKLQNIFLGLVSDVVDYETDLSGVPLNMDEDEQNQDLTKKIGFLNPDVEVLESQPLVQYDGDLLDVDGSPLDNEDDRSPSPIRSKDSQFNVNPVEDEVKPSGDTSNRLFVPSKWETIETTEPETVSVSSIWE 837          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. TrEMBL
Match: A0A3Q0KRB0 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 369/837 (44.09%), Postives = 513/837 (61.29%), Query Frame = 3
Query:   96 RKLQANEETAIVYQQFIETFEEPPKVNKTWVKGGTVNPGS-STHSSEGAGKLYQPLMKTVDKIPDKFKEKFQSEFNK---KPPLLGKPKEQSKRKSNLEAFSEELKQLQQERE----MRNQKQKLVTERVEDINNKFVKEPEIK-NSEEPRKSRFDLNIIPIIKPLPATLPSSP----FDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQK------------TGNVDS----------RKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIV-----------TQIDKTIGYATDKSI------------ENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVE------------PPALXXXXXXXXXXXX--------XLLSVKPLVDYDGDPLDVDGVPLDSKATEATNSTEILD-MFANPSSPQTKRI---TKEPLFVPSKWETVDPADEESEIVQSRWQL-----MESQSEDKKSSDN 2345
            +K +  E T  V+++F+ TFEEP K ++ WVKGG VNP S S+  ++G G++Y+P+ K   K+ +K + + +++  K   KPP LGK K Q ++KS LE F EELK +QQ+RE    +R  + +  T+   D+++  ++  E +  S   +     +     +   P+           D+D+PYD + DRTTTNLFLGNLNP++TEQQLCE FGR+GPLASVKIMWPR++EE++RGRNCGFVAFMNR DGERAL+ +RG E+ G+EMKLGWGK+V IP +P+Y+PP L+E++KPPPPSGLPFNAQPREWL+             T   D           RK +D+  MS E+L E L+  VVKV +P+DR +L LI+RM+EFV+ EG +FEA +M++E  NP FKFLFD+QS +HVYYRWKL+S LHGES   W+T+EF M++GGP WRPPP+N F+ G+PE+L+E+ D+              +   +ES +   E+ +E   ++       LT++QR R  ++L DLEP +  IGE MVWCLEHADSA D+   IV             ++K I    +  I            E S +  +N++VA LFL SDIL+NS AKV NASF+RK  E  LP +  +LN +Y  +  K+K+EQLK KV+ CFRAW DW VYP +FL KL+N FLG+V             P  L E++ N  ++++         +L  +PLV YDGDPLDVDG PLD++   + +     +  F+ P++    +    T   LFVPSKWETV+  + E+  V S W+      M+      KSSDN
Sbjct:   30 KKKKEEEHTQQVFEEFVATFEEPSK-SRAWVKGGVVNPSSGSSEDTKGTGRIYRPVSKLDSKL-NKTEGQNKADLKKSTEKPPALGKRKGQEQKKSKLEQFKEELKLIQQQREQRHALRQGRNQPSTQSELDLSDVGMRNREYRRGSSNNQGGDSGMGFHNTVSTPPSFYSKRSQNDRHDVDYPYDYDGDRTTTNLFLGNLNPKMTEQQLCEAFGRYGPLASVKIMWPRTEEERSRGRNCGFVAFMNRKDGERALDNIRGKELMGFEMKLGWGKSVPIPLYPVYIPPALLELVKPPPPSGLPFNAQPREWLKSFRLAIKERAKLVTDGADGESAPPPPAPDRKPYDINKMSSEELTEVLREAVVKVVMPSDRSILALIHRMIEFVVLEGPQFEAAVMHREANNPMFKFLFDYQSSDHVYYRWKLWSVLHGESVTKWRTEEFRMFEGGPLWRPPPVNLFSGGMPEDLVEEDDYPYAP----GYVPPPSGRRRESEDLQEEIRLEAAAASRRC---GLTEAQRGRFTQMLEDLEPCRIKIGEVMVWCLEHADSASDIALCIVDSVAPNSNFTSNHLEKEINSVDENPISDFKSDQGSTEHEKSQSISINKLVARLFLASDILYNSSAKVPNASFFRKCFETCLPDMFKNLNSHYKNVEGKLKAEQLKQKVMLCFRAWEDWAVYPNEFLIKLQNIFLGLVSEAVDYEADLSGVPLNLDEDEQNQDLAKKVGFLNPDVEVLESQPLVQYDGDPLDVDGSPLDNEDDRSPSPVRPKNSQFSAPATEDEVKPSGDTSNRLFVPSKWETVETTEPETLTVASIWESASTLDMKKDQPISKSSDN 857          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. TrEMBL
Match: A0A183QJ42 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 370/840 (44.05%), Postives = 514/840 (61.19%), Query Frame = 3
Query:   96 RKLQANEETAIVYQQFIETFEEPPKVNKTWVKGGTVNPGS----STHSSEGAGKLYQPLMKTVDKIPDKFKEKFQSEFNK---KPPLLGKPKEQSKRKSNLEAFSEELKQLQQERE----MRNQKQKLVTERVEDINNKFVKEPEIK-NSEEPRKSRFDLNIIPIIKPLPATLPSSP----FDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQK------------TGNVDS----------RKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIV-----------TQIDKTIGYATDKSI------------ENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVE------------PPALXXXXXXXXXXXX--------XLLSVKPLVDYDGDPLDVDGVPLDSKATEATNSTEILD-MFANPSSPQTKRI---TKEPLFVPSKWETVDPADEESEIVQSRWQL-----MESQSEDKKSSDN 2345
            +K +  E T  V+++F+ TFEEP K ++ WVKGG VNP S    S+  ++G G++Y+P+ K   K+ +K +++ +++  K   KPP LGK K Q ++KS LE F EELK +QQ+RE    +R  + +  T+   D+++  ++  E +  S   +     +     +   P+           D+D+PYD + DRTTTNLFLGNLNP++TEQQLCE FGR+GPLASVKIMWPR++EE++RGRNCGFVAFMNR DGERAL+ +RG E+ G+EMKLGWGK+V IP +P+Y+PP L+E++KPPPPSGLPFNAQPREWL+             T   D           RK +D+  MS E+L E L+  VVKV +P+DR +L LI+RM+EFVI EG +FEA +M++E  NP FKFLFD+QS +HVYYRWKL+S LHGES   W+T+EF M++GGP WRPPP+N F+ G+PE+L+E+ D+              +   +ES +   E+ +E   ++       LT++QR R  ++L DLEP +  IGE MVWCLEHADSA D+   IV             ++K I    +  I            E S +  +N++VA LFL SDIL+NS AKV NASF+RK  E  LP +  +LN +Y  +  K+K+EQLK KV+ CFRAW DW VYP +FL KL+N FLG+V             P  L E++ N  ++++         +L  +PLV YDGDPLDVDG PLD++   + +     +  F+ P++    +    T   LFVPSKWETV+  + E+  V S W+      M+      KSSDN
Sbjct:   30 KKKKEEEHTQQVFEEFVATFEEPSK-SRAWVKGGVVNPSSAAIGSSEDTKGTGRIYRPVSKLDSKL-NKTEDQNKADLKKSTEKPPALGKRKGQEQKKSKLEQFKEELKLIQQQREQRHALRQGRNQPSTQSELDLSDVGMRNREYRRGSSNNQGGDSGMGFHNTVSTPPSFYSKRSQNDRHDVDYPYDYDGDRTTTNLFLGNLNPKMTEQQLCEAFGRYGPLASVKIMWPRTEEERSRGRNCGFVAFMNRKDGERALDNIRGKELMGFEMKLGWGKSVPIPLYPVYIPPALLELVKPPPPSGLPFNAQPREWLKSFRLAIKERAKLVTDGADGESAPPPPAPDRKPYDINKMSSEELTEVLREAVVKVVMPSDRSILALIHRMIEFVILEGPQFEAAVMHREANNPMFKFLFDYQSSDHVYYRWKLWSVLHGESVTKWRTEEFRMFEGGPLWRPPPVNLFSGGMPEDLVEEDDYPYAP----GYVPPPSGRRRESEDLQEEIRLEAAAASRRC---GLTEAQRGRFTQMLEDLEPCRIKIGEVMVWCLEHADSASDIALCIVDSVAPNSNFTSNHLEKEINSVDENPISELKSDQGSTEHEKSQSISINKLVARLFLASDILYNSSAKVPNASFFRKCFETCLPDMFKNLNWHYKNVEGKLKAEQLKQKVMLCFRAWEDWAVYPNEFLIKLQNIFLGLVSEAVDYEADLSGIPLNLDEDEQNQDLAKKLGFLNPDVEVLESQPLVQYDGDPLDVDGSPLDNEDDRSPSPVRPKNSQFSAPATEDEVKPSGDTSNRLFVPSKWETVETTEPETLTVASIWESASTLDMKKDQPINKSSDN 860          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Cavefish
Match: u2surp (U2 snRNP-associated SURP domain containing [Source:ZFIN;Acc:ZDB-GENE-070912-400])

HSP 1 Score: 466.077 bits (1198), Expect = 1.579e-148
Identity = 312/784 (39.80%), Postives = 426/784 (54.34%), Query Frame = 3
Query:   33 IIKMSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFEEPPKVNKTWVKGGTVNPGSS-THSSEGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLLGKPKEQSKRK-------SNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIV----EPPALXXXXXXXXXXXXXLLSVKPLV--DYDGDPL-DVDGVPLDSKATEATNSTEILDMFANPSSPQTKRITKEPL--------FVPSKWETVDPADEESEIV-QSRWQLME 2312
            I KM+   R  T++   ++E +K +  +  A +Y++F+  FE      KT+V+GG  N         E  GKLY+P  + ++        K        P  L   K  + +K       SNLE F EELKQ+Q+ER+ R++ +  V+ R E ++           + E R+S  D               S+P   D       D +TTNL+LGN+NP++ E+ LC+ FGR+GPLASVKIMWPR+DEE+AR RNCGFVAFM R D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQP+E L+ T              S E+  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP ++FLF+ QSP HVYYRWKLYS L G+S   WKT++F ++K G  WRPPPLNP+  G PE             E   +     + SK                     K  L D +R++L E L  L P +  I EAM++CL HAD+AE++++ I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRK+ E  L Q+   LN  + TI   ++SE  K +V+SCFRAW DW VYP  FL KL+N FLG+V    E     E     +      +   P+V  + DG PL DVDG+P+D    +      + D+   P       +   P           PSKWE VD +  E++ V  S+W++++
Sbjct:   27 IGKMAVAKR--TLSKKEQDELKKKEDEKAAAEIYEEFLAAFEGGEGRVKTFVRGGIANATKEEVAVDEKKGKLYKPKSRVLEA-------KSFLPLETPPQFLAIDKRNASKKGEKEKKKSNLELFKEELKQIQEERDERHRLKGRVS-RFEPLS-----------AMEGRRSFLD--------------DSAPGSHDV-----GDPSTTNLYLGNINPQMNEEMLCQEFGRYGPLASVKIMWPRTDEERARERNCGFVAFMTRRDAERALKHLNGKMIMNFEMKLGWGKGVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPKERLKNTNAP-----MPPPPKSKEEFEKTLSQAIVKVVIPTERNLLSLIHRMIEFVVREGPMFEAMIMNREISNPLYRFLFENQSPAHVYYRWKLYSILQGDSPTKWKTEDFRLFKNGSLWRPPPLNPYLHGTPE-----------EEEGEEEEEEEEEGSK---------------------KGSLKDEERDKLEETLRGLTPRRGDIAEAMLFCLTHADAAEEIVECITESL----------SILKTP---LPKKIARLYLVSDVLYNSSAKVSNASYYRKFFETKLCQIFSDLNATFRTIQGHLQSEHFKQRVMSCFRAWEDWAVYPDPFLIKLQNIFLGLVSLDPEKETPVEVPMPEEPPPTEDIDGAPIVEEELDGAPLEDVDGMPIDGAPLDG---APLDDLDGVPIKGAEDELDGVPFDGPKPTFKMAPSKWEEVDGSALEAQAVTTSKWEVVD 717          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Cavefish
Match: u2surp (U2 snRNP-associated SURP domain containing [Source:ZFIN;Acc:ZDB-GENE-070912-400])

HSP 1 Score: 465.692 bits (1197), Expect = 2.472e-148
Identity = 313/785 (39.87%), Postives = 428/785 (54.52%), Query Frame = 3
Query:   33 IIKMSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFEEPPKVNKTWVKGGTVNPGSS-THSSEGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLLGKPKEQSKRK-------SNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSET-DRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIV----EPPALXXXXXXXXXXXXXLLSVKPLV--DYDGDPL-DVDGVPLDSKATEATNSTEILDMFANPSSPQTKRITKEPL--------FVPSKWETVDPADEESEIV-QSRWQLME 2312
            I KM+   R  T++   ++E +K +  +  A +Y++F+  FE      KT+V+GG  N         E  GKLY+P  + ++        K        P  L   K  + +K       SNLE F EELKQ+Q+ER+ R++ +  V+ R E ++     E    +    R++R                PSS  D   P   +  D +TTNL+LGN+NP++ E+ LC+ FGR+GPLASVKIMWPR+DEE+AR RNCGFVAFM R D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQP+E L+ T              S E+  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP ++FLF+ QSP HVYYRWKLYS L G+S   WKT++F ++K G  WRPPPLNP+  G PE             E   +     + SK                     K  L D +R++L E L  L P +  I EAM++CL HAD+AE++++ I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRK+ E  L Q+   LN  + TI   ++SE  K +V+SCFRAW DW VYP  FL KL+N FLG+V    E     E     +      +   P+V  + DG PL DVDG+P+D    +      + D+   P       +   P           PSKWE VD +  E++ V  S+W++++
Sbjct:   27 IGKMAVAKR--TLSKKEQDELKKKEDEKAAAEIYEEFLAAFEGGEGRVKTFVRGGIANATKEEVAVDEKKGKLYKPKSRVLEA-------KSFLPLETPPQFLAIDKRNASKKGEKEKKKSNLELFKEELKQIQEERDERHRLKGRVS-RFEPLS---AMEGRRSSDGSSRRNR----------------PSSVLDDSAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRYGPLASVKIMWPRTDEERARERNCGFVAFMTRRDAERALKHLNGKMIMNFEMKLGWGKGVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPKERLKNTNAP-----MPPPPKSKEEFEKTLSQAIVKVVIPTERNLLSLIHRMIEFVVREGPMFEAMIMNREISNPLYRFLFENQSPAHVYYRWKLYSILQGDSPTKWKTEDFRLFKNGSLWRPPPLNPYLHGTPE-----------EEEGEEEEEEEEEGSK---------------------KGSLKDEERDKLEETLRGLTPRRGDIAEAMLFCLTHADAAEEIVECITESL----------SILKTP---LPKKIARLYLVSDVLYNSSAKVSNASYYRKFFETKLCQIFSDLNATFRTIQGHLQSEHFKQRVMSCFRAWEDWAVYPDPFLIKLQNIFLGLVSLDPEKETPVEVPMPEEPPPTEDIDGAPIVEEELDGAPLEDVDGMPIDGAPLDG---APLDDLDGVPIKGAEDELDGVPFDGPKPTFKMAPSKWEEVDGSALEAQAVTTSKWEVVD 729          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Cavefish
Match: zgc:163098 (zgc:163098 [Source:ZFIN;Acc:ZDB-GENE-070410-141])

HSP 1 Score: 408.297 bits (1048), Expect = 6.468e-128
Identity = 273/756 (36.11%), Postives = 379/756 (50.13%), Query Frame = 3
Query:  120 TAIVYQQFIETFEEPPKVN-KTWVKGGTVNPGSSTHSSE-GAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLLGKPKEQSK----------RKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEP------------PALXXXXXXXXXXXXXLLSVKPLVDYDG-----DPLDVDGVPLDSKATEATNSTEILDMFANPSSPQTKRITKEPL------FVP----SKWETVDPAD 2270
             A V+++F+ +F+   K   KT+V+GG VN      ++E    KLY+P  K            F        P+  +P E  K          +KSNLE F EELKQ+Q+ERE R +++K         N+     P+I  S   R+S FD                         D  T  TTTNL++G +NP++TE+ LC+ FG++GPLASVKIMWPR++EE+ R  N GFVAFM R D ERAL  L G  + G+EMKLGWGK V IPP P+Y P  +++   PPPPSGLPFNAQPR+  +        +       S ED  +TL + VV V IP++R  L      +  +++   E  +          + +FLFD +S EHVYYRWKLYS L G+ST  WKT  F M++GG  WRPP LNP+  G                       +     + S     E+            K QL    RE+L  +L  L P +  IG+AM++CLE A++AE+V+  I   +          SI ++    L + VA L+LVSDIL+NSCAKV NAS+YRKY E+ LPQ+   + + Y  I +++++EQ K ++++CFRAW DW +YP  FL +L+N FLG+++P            P L     +    +   +   PL D DG     DP  +DGVP+D             D+   P  P    +   P        VP    SKWE VD A+
Sbjct:   31 AAEVFEEFLASFDSNEKSGVKTFVRGGIVNATKDEEAAEVKKNKLYRPAAK------------FTPVLQNASPV--QPTEHKKSVVKKKTEEKKKSNLELFKEELKQIQEEREERYKRKK---------NDPGGVYPDIDPSLT-RRSIFD-------------------------DDPTVPTTTNLYIGCINPKMTEEMLCKEFGKYGPLASVKIMWPRTEEERTRVTNRGFVAFMTRKDAERALAALDGKTVMGFEMKLGWGKAVRIPPQPLYTPIGVLKTTAPPPPSGLPFNAQPRDRFRNDFTKPRGR-------SQEDFYKTLYDAVVTVVIPSERYTL-----FIHLILQYDSETHS----------HSRFLFDNKSQEHVYYRWKLYSILQGDSTSEWKTSHFRMFRGGSLWRPPVLNPYLHG-----------------------DEEPEEESSPTHEEEL-----------RKGQLKTEHREQLEALLRSLTPRRVEIGDAMLFCLEKAEAAEEVVSCISESL----------SILHTP---LQKKVARLYLVSDILYNSCAKVSNASYYRKYFESRLPQIFSDVGEAYRNIQARLQAEQFKQRIMTCFRAWEDWAIYPESFLIQLQNIFLGLIKPGEEVIEQPEPPSPDLDGAPLDGTPLDGVEIDGTPLDDLDGSPMPWDPQSIDGVPVD-------------DLDGVPLGPPMDDLDGVPFEESLDKTVPSVALSKWERVDDAE 655          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Cavefish
Match: zgc:163098 (zgc:163098 [Source:ZFIN;Acc:ZDB-GENE-070410-141])

HSP 1 Score: 209.92 bits (533), Expect = 1.207e-59
Identity = 137/345 (39.71%), Postives = 185/345 (53.62%), Query Frame = 3
Query:  114 EETAIVYQQFIETFEEPPKVN-KTWVKGGTVNPGSSTHSSE-GAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLLGKPKEQSK----------RKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQL 1112
            E+ A V+++F+ +F+   K   KT+V+GG VN      ++E    KLY+P  K            F        P+  +P E  K          +KSNLE F EELKQ+Q+ERE R +++K         N+     P+I  S   R+S FD                         D  T  TTTNL++G +NP++TE+ LC+ FG++GPLASVKIMWPR++EE+ R  N GFVAFM R D ERAL  L G  + G+EMKLGWGK V IPP P+Y P  +++   PPPPSGLPFNAQPR+  +        +       S ED  +TL + VV V IP++R L
Sbjct:   52 EKAAEVFEEFLASFDSNEKSGVKTFVRGGIVNATKDEEAAEVKKNKLYRPAAK------------FTPVLQNASPV--QPTEHKKSVVKKKTEEKKKSNLELFKEELKQIQEEREERYKRKK---------NDPGGVYPDIDPSLT-RRSIFD-------------------------DDPTVPTTTNLYIGCINPKMTEEMLCKEFGKYGPLASVKIMWPRTEEERTRVTNRGFVAFMTRKDAERALAALDGKTVMGFEMKLGWGKAVRIPPQPLYTPIGVLKTTAPPPPSGLPFNAQPRDRFRNDFTKPRGR-------SQEDFYKTLYDAVVTVVIPSERNL 340          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Cavefish
Match: zgc:163098 (zgc:163098 [Source:ZFIN;Acc:ZDB-GENE-070410-141])

HSP 1 Score: 208.764 bits (530), Expect = 2.232e-59
Identity = 136/343 (39.65%), Postives = 183/343 (53.35%), Query Frame = 3
Query:  120 TAIVYQQFIETFEEPPKVN-KTWVKGGTVNPGSSTHSSE-GAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLLGKPKEQSK----------RKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQL 1112
             A V+++F+ +F+   K   KT+V+GG VN      ++E    KLY+P  K            F        P+  +P E  K          +KSNLE F EELKQ+Q+ERE R +++K         N+     P+I  S   R+S FD                         D  T  TTTNL++G +NP++TE+ LC+ FG++GPLASVKIMWPR++EE+ R  N GFVAFM R D ERAL  L G  + G+EMKLGWGK V IPP P+Y P  +++   PPPPSGLPFNAQPR+  +        +       S ED  +TL + VV V IP++R L
Sbjct:   31 AAEVFEEFLASFDSNEKSGVKTFVRGGIVNATKDEEAAEVKKNKLYRPAAK------------FTPVLQNASPV--QPTEHKKSVVKKKTEEKKKSNLELFKEELKQIQEEREERYKRKK---------NDPGGVYPDIDPSLT-RRSIFD-------------------------DDPTVPTTTNLYIGCINPKMTEEMLCKEFGKYGPLASVKIMWPRTEEERTRVTNRGFVAFMTRKDAERALAALDGKTVMGFEMKLGWGKAVRIPPQPLYTPIGVLKTTAPPPPSGLPFNAQPRDRFRNDFTKPRGR-------SQEDFYKTLYDAVVTVVIPSERNL 317          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Sea Lamprey
Match: pabpc4 (poly(A) binding protein, cytoplasmic 4 (inducible form) [Source:ZFIN;Acc:ZDB-GENE-030131-9663])

HSP 1 Score: 52.7582 bits (125), Expect = 3.315e-7
Identity = 26/78 (33.33%), Postives = 44/78 (56.41%), Query Frame = 3
Query:  636 TNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLG 869
            TN+++ N   ++ E +L E FG+FG   SV +M     +E  + R  GFV+F    D +RA+ ++ G E+ G  + +G
Sbjct:  194 TNVYIKNFGDDMDEDKLREFFGKFGKALSVCVM----SDECGKSRGFGFVSFEQHEDAQRAVNEMNGKELNGRTVFVG 267          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Sea Lamprey
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 49.6766 bits (117), Expect = 1.322e-6
Identity = 23/88 (26.14%), Postives = 47/88 (53.41%), Query Frame = 3
Query:  639 NLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHP 902
            ++F+G+L+PE++   L   F  FG ++  +++    D    + +  GFV+F  + D E A++++ G  + G +++  W      PP P
Sbjct:    4 HVFVGDLSPEISTDDLRAAFAPFGKISDARVV---KDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNW--ATRKPPAP 86          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 50.8322 bits (120), Expect = 1.420e-6
Identity = 27/76 (35.53%), Postives = 43/76 (56.58%), Query Frame = 3
Query:  642 LFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLG 869
            L++G+L+  +TE  L  +F  FG + + ++M    D +  R R  GFV F +     +ALE+L G E+ G  MK+G
Sbjct:  261 LYVGSLHFNITEDMLKGIFEPFGKIENCQLMM---DSDTGRSRGYGFVTFADAECARKALEQLNGFELAGRPMKVG 333          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Sea Lamprey
Match: rbm22 (RNA binding motif protein 22 [Source:NCBI gene;Acc:406495])

HSP 1 Score: 49.6766 bits (117), Expect = 2.110e-6
Identity = 32/95 (33.68%), Postives = 47/95 (49.47%), Query Frame = 3
Query:  612 DSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEIC-GYEMKLGWGKTVLIP 893
            D  +DRT T L++G L+  + E QL   F +FG L SV ++ PR        + C FV F  R   E+A +K     I  G  + + WG++   P
Sbjct:  134 DLPSDRTITTLYVGGLDDSIGETQLRNHFYQFGELRSVTVV-PR--------QQCAFVQFTTRHSAEQAADKSFNKLIINGRRLNIKWGRSQGAP 219          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 49.6766 bits (117), Expect = 3.020e-6
Identity = 25/77 (32.47%), Postives = 45/77 (58.44%), Query Frame = 3
Query:  642 LFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGW 872
            L++G+L+  +TE  L  +F  FG + ++++M    D E  R +  GF+ F +    ++ALE+L G E+ G  MK+ +
Sbjct:  274 LYVGSLHFNITEAMLMGIFEPFGKIDNIQLMM---DPETGRSKGFGFITFSSADCAKKALEQLNGFELAGRPMKVNY 347          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Yeast
Match: NGR1 (RNA binding protein that negatively regulates growth rate; interacts with the 3' UTR of the mitochondrial porin (POR1) mRNA and enhances its degradation; overexpression impairs mitochondrial function; interacts with Dhh1p to mediate POR1 mRNA decay; expressed in stationary phase [Source:SGD;Acc:S000000416])

HSP 1 Score: 68.5514 bits (166), Expect = 3.106e-12
Identity = 38/102 (37.25%), Postives = 57/102 (55.88%), Query Frame = 3
Query:  573 TLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGK 878
            +LPS+ ++        TD T T +F+G L P+ TE QL  LF  FGP+ +V+I           G+NCGFV F  R D E +++ L+G  + G  ++L WG+
Sbjct:  347 SLPSNTYN--------TDPTNTTVFVGGLVPKTTEFQLRSLFKPFGPILNVRI---------PNGKNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWGR 431          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Yeast
Match: PAB1 (Poly(A) binding protein; part of the 3'-end RNA-processing complex, mediates interactions between the 5' cap structure and the 3' mRNA poly(A) tail, involved in control of poly(A) tail length, interacts with translation factor eIF-4G; stimulates, but is not required for the deadenylation activity of the Pan2p-Pan3p poly(A)-ribonuclease complex [Source:SGD;Acc:S000000967])

HSP 1 Score: 54.6842 bits (130), Expect = 5.821e-8
Identity = 30/86 (34.88%), Postives = 48/86 (55.81%), Query Frame = 3
Query:  618 ETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARG--RNCGFVAFMNRSDGERALEKLRGNEICGYEMKLG 869
            ET    TNL++ N+N E T++Q  ELF +FGP+ S  +      E+ A G  +  GFV +    D  +A+E L  +E+ G ++ +G
Sbjct:  213 ETKAHYTNLYVKNINSETTDEQFQELFAKFGPIVSASL------EKDADGKLKGFGFVNYEKHEDAVKAVEALNDSELNGEKLYVG 292          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 53.9138 bits (128), Expect = 7.462e-8
Identity = 24/81 (29.63%), Postives = 44/81 (54.32%), Query Frame = 3
Query:  633 TTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWG 875
            T NLF+G+LN  + ++ L   F  F    S  +MW   D +    R  GFV+F ++ D + A++ ++G ++ G  +++ W 
Sbjct:  161 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMW---DMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWA 238          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Yeast
Match: NAM8 (RNA binding protein, component of the U1 snRNP protein; mutants are defective in meiotic recombination and in formation of viable spores, involved in the formation of DSBs through meiosis-specific splicing of REC107 pre-mRNA; Nam8p regulon embraces the meiotic pre-mRNAs of REC107, HFM1, AMA1 SPO22 and PCH2; the putative RNA binding domains RRM2 and RRM3 are required for Nam8p meiotic function [Source:SGD;Acc:S000001128])

HSP 1 Score: 51.2174 bits (121), Expect = 5.719e-7
Identity = 28/88 (31.82%), Postives = 45/88 (51.14%), Query Frame = 3
Query:  621 TDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTV 884
            TD   T +F+G L+  +TE +L   F  FG +  VKI           G+ CGFV +++R   E A+  ++G  I    ++L WG++ 
Sbjct:  308 TDPNNTTVFIGGLSSLVTEDELRAYFQPFGTIVYVKI---------PVGKCCGFVQYVDRLSAEAAIAGMQGFPIANSRVRLSWGRSA 386          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Nematostella
Match: EDO34857 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN56])

HSP 1 Score: 360.533 bits (924), Expect = 2.986e-112
Identity = 193/469 (41.15%), Postives = 275/469 (58.64%), Query Frame = 3
Query:  732 MWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSR--KMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEPPALXXXXXXXXXXXXXLLSVKPLVDYDGDPLDVDGVPL 2132
            MWPR++EEK+R RNCGFVA+M R DG++A++ L G +I G+EMKLGWGK V +PPHPIYVPP + E   PPPPSGLPFNAQP      + N ++     FD          ETL N VVKV IP +R +L +I+R+VEFV+REG  FEA IMN+E+ NP  +FLFD QS EH YYRW+LYS L G+S   W T++F M++GG +W+PPP + +   I              ++ ++  +     +   + + +E    +   +    K  L+  QR++L ++L +L   +  I +AMVWCLEHAD A+++ + I   +       T   ++          +A LFL+SDILHN   K+ N S++RK  +  L QV  H+N  +  I ++IK+EQL+ +V  C  AW DW +Y  DFL  L+N FLG  E  A + +        +  ++     D DG PL++DGVPL
Sbjct:    1 MWPRTEEEKSRNRNCGFVAYMRRKDGDKAIKHLTGKDIMGFEMKLGWGKAVPLPPHPIYVPPDMEEDNTPPPPSGLPFNAQPDNNTPSSENSENLDPNGFDR---------ETLANAVVKVVIPKERGVLSMIHRVVEFVVREGPMFEAMIMNREINNPKMRFLFDNQSHEHTYYRWRLYSILQGDSPTKWCTEKFRMFEGGSWWKPPPCSQYQPTI---------LPPAAVQPVAPVVEEPPKAPTPSRRHHESSSSSSSRDK---KGGLSSRQRDKLEDMLRNLTVDRAKIADAMVWCLEHADCADEISECIAESLSL---LETPPQVK----------IARLFLLSDILHNCSVKIPNVSYFRKCFQARLVQVFTHMNATFKAINARIKAEQLRKQVTRCLSAWMDWAIYQPDFLVNLQNIFLGQQESLATTFKTLMGDSGVDAAIA-----DVDGLPLNLDGVPL 430          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Nematostella
Match: EDO28276 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6X8])

HSP 1 Score: 168.318 bits (425), Expect = 2.045e-47
Identity = 84/153 (54.90%), Postives = 104/153 (67.97%), Query Frame = 3
Query:  819 LEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLH 1277
            L + +G +I G+EMKLGWGK V +PPHPIYVPP + E   PPPPSGLPFNAQP      T + ++ +  D          ETL N VVKV IP +R +L +I+R+VEFV+REG  FEA IMN+E+ NP  +FLFD QS EH YYRW+LYS L 
Sbjct:   79 LAQPKGKDIMGFEMKLGWGKAVPLPPHPIYVPPDMEEDNTPPPPSGLPFNAQPD---NNTPSSENSENLDPNGFD----RETLANAVVKVVIPKERGVLSMIHRVVEFVVREGPMFEAMIMNREINNPKMRFLFDNQSHEHTYYRWRLYSILQ 224          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Nematostella
Match: EDO34858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN57])

HSP 1 Score: 80.8777 bits (198), Expect = 3.824e-17
Identity = 66/198 (33.33%), Postives = 109/198 (55.05%), Query Frame = 3
Query:   84 EEEARKLQANEETAIVYQQFIETFEEPPKVNKTWVKGGTVNPGSSTHS-SEGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLLGKPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPAT-LPSSPFDIDFPYDSET--DRTTTNLFLGNLNP 665
            E E RK +  E+ A V+  F+ +F++     KT+V+G T+NP +   + SE +G+LY+P+ K    +    +EK ++E + KP L  K KE+ K+KSNLE F EELK+ Q+ERE+R++ +K  T  +                  P++         +++ LP++ L + P D  F + S    D  TTNL++GN++P
Sbjct:   54 EVEERKKRDEEKCAEVFADFVASFDDSRVHGKTFVRGSTINPDTKEETISEDSGRLYKPMAKLSASL---IEEKLKAELSPKPDLKKKMKEKEKKKSNLELFKEELKRNQEERELRHKLKKGETTDI------------------PKE---------VLEALPSSFLLAQPKDDAFGFGSHDTGDPNTTNLYIGNISP 221          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Nematostella
Match: EDO33926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQW0])

HSP 1 Score: 52.373 bits (124), Expect = 7.640e-7
Identity = 26/78 (33.33%), Postives = 46/78 (58.97%), Query Frame = 3
Query:  636 TNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLG 869
            T L++G+L+  +TE  +  +F  FG + SV++++   D E  R +  GFV F      +RA+E++ G E+ G  +K+G
Sbjct:  215 TRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIY---DSETNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKIG 289          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Nematostella
Match: EDO31981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWC6])

HSP 1 Score: 51.2174 bits (121), Expect = 1.317e-6
Identity = 36/101 (35.64%), Postives = 54/101 (53.47%), Query Frame = 3
Query:  612 DSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNR----SDGERALEKLRGNEICGYEMKLGWGKTVLIPPHP 902
            D+ TDR+ T L++G L  ++TEQ L + F +FG L S+  M PR        +NC FV F +R    +  +R+  KL    + G  +K+ WGK+    P P
Sbjct:  225 DTPTDRSITTLYVGGLEGKVTEQDLRDHFYQFGELRSIS-MVPR--------QNCAFVCFTSRAAAEAAADRSFNKL---ILKGRRLKIMWGKSQGQQPAP 313          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Medaka
Match: u2surp (U2 snRNP associated SURP domain containing [Source:NCBI gene;Acc:101172204])

HSP 1 Score: 495.738 bits (1275), Expect = 3.278e-159
Identity = 331/844 (39.22%), Postives = 469/844 (55.57%), Query Frame = 3
Query:   33 IIKMSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFEEPPKVN-KTWVKGGTVNPGSSTHSS-EGAGKLYQPL----MKTVDKIPDKFKEKFQSEFNKKPPLLGKPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSET-DRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIV------EPPALXXXXXXXXXXXXXLLSVKPLVDYDGDPL----------DVDGVPLDSKAT--EATNSTEILDMFANPSSPQTKRI-------TKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQSEDKKSSDNEDPDGYPLSDNDENFNLSMIKSHDLSPKNKK-NDENRN 2456
            I KM+   R  T++   ++E +K +     A +Y++F+  FE   +   K +V+GG  N      ++ E  GKLY+P      +T   +P +   +F + F++K   + K  E+ K+KSNLE F EELKQ+Q+ER+ R++ +  V+ R E +     +     +S   R                   PSS  D   P   +  D +TTNL+LGN+NP++ E+ LC+ FGR+GPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+                + E+  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP ++FLF+ QSP HVYYRWKL++ L GEST  W+TD+F M+K G +WRPPPLNP+  G                       ++ +  +E    S + C              L + +R++L E+L  L P +  + EAM++CL HA++AE++++ I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRKY E  L Q+   LN  Y TI   ++SE  K +V+SCFRAW DW VYP  +L KL+N FLG+V      EPP +             ++  +P  D DG P+          DVDGVP+D      E  +   + D+   P  P  + I       +KE  F   PSKWE VD A+ +++ V  S+W++ E   E KK  D++D D  P S+ +++++  +    D   K+   N+E R 
Sbjct:   36 IGKMAVAKR--TLSKKEQDELKKKEDERAAAEIYEEFLAAFEGGGEGKVKAFVRGGIANATKEEAAADEKKGKLYKPKSRFDAQTKSILPLETPPQFLA-FDRKQ-TVKKNTEKEKKKSNLELFKEELKQIQEERDERHKLKGRVS-RFEPLAGMEGRRSSDGSSRRNR-------------------PSSVLDDCAPGSHDVGDPSTTNLYLGNINPQMNEEMLCQEFGRYGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKHLNGKMIMNFEMKLGWGKGVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPLLPP-----PKNKEEFEKTLSQAIVKVVIPTERNLLSLIHRMIEFVVREGPMFEAMIMNREINNPMYRFLFENQSPAHVYYRWKLFTILQGESTAKWRTDDFRMFKNGSFWRPPPLNPYLHG---------------------PYDDGEEEEEEEEGSKKGC--------------LKEDERDKLEEMLRGLSPKRGDVAEAMLFCLNHAEAAEEIVECIAESL----------SILKTP---LPKKIARLYLVSDVLYNSSAKVSNASYYRKYFETKLCQIFSDLNATYKTIQGHLQSENFKQRVMSCFRAWEDWAVYPDPYLIKLQNIFLGLVNLSADKEPPTV-------------IVEPEPAEDIDGAPIGEFVESTLLEDVDGVPIDGAPIDGEPIDGAPLDDIDGIPIKPMEEDIDGIPFDQSKEATFKVAPSKWEAVDEAELQAQAVTTSKWEIFEQPEETKKGEDSDD-DRSPRSEENQSYSNPIKDDADTKAKSSGMNEEKRT 788          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Medaka
Match: u2surp (U2 snRNP associated SURP domain containing [Source:NCBI gene;Acc:101172204])

HSP 1 Score: 494.967 bits (1273), Expect = 3.809e-159
Identity = 331/843 (39.26%), Postives = 468/843 (55.52%), Query Frame = 3
Query:   33 IIKMSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFEEPPKVN-KTWVKGGTVNPGSSTHSS-EGAGKLYQPL----MKTVDKIPDKFKEKFQSEFNKKPPLLGKPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIV------EPPALXXXXXXXXXXXXXLLSVKPLVDYDGDPL----------DVDGVPLDSKAT--EATNSTEILDMFANPSSPQTKRI-------TKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQSEDKKSSDNEDPDGYPLSDNDENFNLSMIKSHDLSPKNKK-NDENRN 2456
            I KM+   R  T++   ++E +K +     A +Y++F+  FE   +   K +V+GG  N      ++ E  GKLY+P      +T   +P +   +F + F++K   + K  E+ K+KSNLE F EELKQ+Q+ER+ R++ +  V+ R E +              E R+S  D              P S  D+  P       +TTNL+LGN+NP++ E+ LC+ FGR+GPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+                + E+  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP ++FLF+ QSP HVYYRWKL++ L GEST  W+TD+F M+K G +WRPPPLNP+  G                       ++ +  +E    S + C              L + +R++L E+L  L P +  + EAM++CL HA++AE++++ I   +          SI  +    L + +A L+LVSD+L+NS AKV NAS+YRKY E  L Q+   LN  Y TI   ++SE  K +V+SCFRAW DW VYP  +L KL+N FLG+V      EPP +             ++  +P  D DG P+          DVDGVP+D      E  +   + D+   P  P  + I       +KE  F   PSKWE VD A+ +++ V  S+W++ E   E KK  D++D D  P S+ +++++  +    D   K+   N+E R 
Sbjct:   36 IGKMAVAKR--TLSKKEQDELKKKEDERAAAEIYEEFLAAFEGGGEGKVKAFVRGGIANATKEEAAADEKKGKLYKPKSRFDAQTKSILPLETPPQFLA-FDRKQ-TVKKNTEKEKKKSNLELFKEELKQIQEERDERHKLKGRVS-RFEPLAGM-----------EGRRSFLD-----------DCAPGS-HDVGDP-------STTNLYLGNINPQMNEEMLCQEFGRYGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKHLNGKMIMNFEMKLGWGKGVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPLLPP-----PKNKEEFEKTLSQAIVKVVIPTERNLLSLIHRMIEFVVREGPMFEAMIMNREINNPMYRFLFENQSPAHVYYRWKLFTILQGESTAKWRTDDFRMFKNGSFWRPPPLNPYLHG---------------------PYDDGEEEEEEEEGSKKGC--------------LKEDERDKLEEMLRGLSPKRGDVAEAMLFCLNHAEAAEEIVECIAESL----------SILKTP---LPKKIARLYLVSDVLYNSSAKVSNASYYRKYFETKLCQIFSDLNATYKTIQGHLQSENFKQRVMSCFRAWEDWAVYPDPYLIKLQNIFLGLVNLSADKEPPTV-------------IVEPEPAEDIDGAPIGEFVESTLLEDVDGVPIDGAPIDGEPIDGAPLDDIDGIPIKPMEEDIDGIPFDQSKEATFKVAPSKWEAVDEAELQAQAVTTSKWEIFEQPEETKKGEDSDD-DRSPRSEENQSYSNPIKDDADTKAKSSGMNEEKRT 776          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Medaka
Match: zgc:163098 (U2 snRNP-associated SURP motif-containing protein [Source:NCBI gene;Acc:101156759])

HSP 1 Score: 417.542 bits (1072), Expect = 6.280e-131
Identity = 279/761 (36.66%), Postives = 378/761 (49.67%), Query Frame = 3
Query:  129 VYQQFIETFE--EPPKVNKTWVKGGTVNPGSSTHSSE-GAGKLYQPLMK----TVDKIPDKFKEKFQSEFNKKPPLLGKPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPY-SNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVE-----------------------------PPALXXXXXXXXXXXXXLLSVKPLVDYDGDPL-----DVDGVPLDSKATEATNSTEILDMFANPSS-PQTKRITKEPLFVPSKWETVDPADEESE 2282
            V+++F+ +FE  +  KV KT+V+GG VN      ++E    KLY+P  K    T         E  ++ F +K           KRKSNLE F EELK +Q+ERE R++++K          N      E            DL+I     PL              YD  T   TTNL++  ++P++ E+ LC  F ++GPLASVKIMWPR++EE+ R  N  FVAFM R D ERA+  L G  I G+EMKLGWGK   IPP P+Y P  +     PPPPSGLPFNAQPR+  +              S S  +L +TL   VVKV IPT+R LL LI+RM+EFV+REG  FEA IMNKE  NP+++FLFD +S +HVYYRWKL+S L GE+   W+T +F +++GG  WRPP LN +                                      S  M +E+P      + K QL    ++RL  +L +L P +  I  AM++CL  AD+AE+V+ +I                       L   +A L+LVSD+LHNSCAKV  AS+YRKY E  LPQ+   LN  +  I +++++EQ K KV+ CFRAW DW +YP  +L  L+N FLG  +                             P   S +  +      + L   P+ D DG PL     D+DGVPLD   T +       +   +  + PQ K          SKW+T+   D E E
Sbjct:   34 VFEEFLASFESNDDRKV-KTFVRGGIVNATKEEEAAEVKKSKLYRPATKFSPVTHHVSASSSAESKKAAFKRK--------ADEKRKSNLELFKEELKLIQEEREERHKRKK----------NDAGGGAEGGTCA-------DLDI-----PLSGR--------SMLYDDLTVPVTTNLYINCISPKMNEEMLCREFCKYGPLASVKIMWPRTEEERGRTSNRAFVAFMTRKDAERAMAALDGKVIMGFEMKLGWGKPARIPPQPLYTP--IGVRAAPPPPSGLPFNAQPRDRFRND-------FTKPLSSSKSELDKTLSEAVVKVVIPTERNLLFLIHRMIEFVVREGPMFEAIIMNKEKSNPDYRFLFDNKSQDHVYYRWKLFSILQGETPSKWRTADFRLFRGGSLWRPPVLNSY--------------------------------------SESMEVEDPVPPEEELKKGQLRAEHKQRLETLLKELTPSREDIANAMLFCLGRADAAEEVVGLIADSFSLL-------------QTPLQIKMARLYLVSDVLHNSCAKVAGASYYRKYFETKLPQIFGDLNAAHKNIQARLQAEQFKQKVMICFRAWEDWAIYPEPYLIHLQNIFLGYAKAGEEVTETVEEESAEIDGAPLDRTALDGLPLGRSVDDIDGCPLGWDPLDGVPVDDIDGVPLGVSSDDIDGVPLDEGNTLSRIPLSKWEKMGDSKTFPQAK--------TESKWDTIGDQDSEDE 687          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Medaka
Match: u2surp (U2 snRNP associated SURP domain containing [Source:NCBI gene;Acc:101172204])

HSP 1 Score: 400.593 bits (1028), Expect = 1.406e-123
Identity = 293/844 (34.72%), Postives = 426/844 (50.47%), Query Frame = 3
Query:   33 IIKMSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFEEPPKVN-KTWVKGGTVNPGSSTHSS-EGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLLGKPK--------EQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEPPALXXXXXXXXXXXXXLLSVKPLVDYDGDPL----------DVDGVPLDSKAT--EATNSTEILDMFANPSSPQTKRI-------TKEPLF--VPSKWETVDPADEESEIV-QSRWQLMESQSEDKKS---SDNEDPDGYPLSDNDENFNLSMIKSHDLSPKNKK-NDENRN 2456
            I KM+   R  T++   ++E +K +     A +Y++F+  FE   +   K +V+GG  N      ++ E  GKLY+P            K +F ++     PL   P+        E+ K+KSNLE F EELKQ+Q+ER+ R++ +  V+ R E +            S+  R++    + +  +  +         D+  P       +TTNL+LGN+NP++ E+ LC+ FGR+GPLASVKIMWPR+DEE+AR RNCGFVAFMNR D ERAL+ L G  I  +EMKLGWGK V IPPHPIY+PP +ME   PPPPSGLPFNAQPRE L+                + E+  +TL   +VKV IPT+R LL LI+RM+EFV+REG  FEA IMN+E+ NP ++  +D       Y+         GEST  W+TD+F M+K G +WRPPPLNP+  G                       ++ +  +E    S + C              L + +R++L E+L  L P +  + EAM++CL HA++AE++++ I   +         K+        L+Q +  + L          K+             L Q+   LN  Y TI   ++SE  K +V+SCFRAW DW VYP  +L KL+N FLG+V   A                  +P  D DG P+          DVDGVP+D      E  +   + D+   P  P  + I       +KE  F   PSKWE VD A+ +++ V  S+W++ E   E KKS    ++ D D  P S+ +++++  +    D   K+   N+E R 
Sbjct:   40 IGKMAVAKR--TLSKKEQDELKKKEDERAAAEIYEEFLAAFEGGGEGKVKAFVRGGIANATKEEAAADEKKGKLYKP------------KSRFDAQTKSILPLETPPQFLTVKKNTEKEKKKSNLELFKEELKQIQEERDERHKLKGRVS-RFEPL------------SDLCRRTATGHSFLSFVSAVLDDCAPGSHDVGDP-------STTNLYLGNINPQMNEEMLCQEFGRYGPLASVKIMWPRTDEERARERNCGFVAFMNRRDAERALKHLNGKMIMNFEMKLGWGKGVPIPPHPIYIPPSMMEHTLPPPPSGLPFNAQPRERLKNPNAPLLPP-----PKNKEEFEKTLSQAIVKVVIPTERNLLSLIHRMIEFVVREGPMFEAMIMNREINNPMYRSSYD------CYF-------FQGESTAKWRTDDFRMFKNGSFWRPPPLNPYLHG---------------------PYDDGEEEEEEEEGSKKGC--------------LKEDERDKLEEMLRGLSPKRGDVAEAMLFCLNHAEAAEEIVECIAESLSILKTPLPKKA--RCAVQLLSQSIQCILL---------QKI-----------TKLCQIFSDLNATYKTIQGHLQSENFKQRVMSCFRAWEDWAVYPDPYLIKLQNIFLGLVNLSA----------------DKEPPTDIDGAPIGEFVESTLLEDVDGVPIDGAPIDGEPIDGAPLDDIDGIPIKPMEEDIDGIPFDQSKEATFKVAPSKWEAVDEAELQAQAVTTSKWEIFEQPEETKKSVFQGEDSDDDRSPRSEENQSYSNPIKDDADTKAKSSGMNEEKRT 758          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Medaka
Match: zgc:163098 (U2 snRNP-associated SURP motif-containing protein [Source:NCBI gene;Acc:101156759])

HSP 1 Score: 383.259 bits (983), Expect = 1.522e-118
Identity = 232/601 (38.60%), Postives = 313/601 (52.08%), Query Frame = 3
Query:  342 KPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPY-SNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEPPALXXXXXXXXXXXXXLLSVKPLVDYDGDPLD---VDGVPL 2132
            K K   KRKSNLE F EELK +Q+ERE R++++K          N      E            DL+I     PL              YD  T   TTNL++  ++P++ E+ LC  F ++GPLASVKIMWPR++EE+ R  N  FVAFM R D ERA+  L G  I G+EMKLGWGK   IPP P+Y P  +     PPPPSGLPFNAQPR+  +     D  K         + L +   +   ++ +   R LL LI+RM+EFV+REG  FEA IMNKE  NP+++FLFD +S +HVYYRWKL+S L GE+   W+T +F +++GG  WRPP LN +                                      S  M +E+P      + K QL    ++RL  +L +L P +  I  AM++CL  AD+AE+V+ +I                       L   +A L+LVSD+LHNSCAKV  AS+YRKY E  LPQ+   LN  +  I +++++EQ K KV+ CFRAW DW +YP  +L  L+N FLG  +      E    +             + DG PLD   +DG+PL
Sbjct:   74 KRKADEKRKSNLELFKEELKLIQEEREERHKRKK----------NDAGGGAEGGTCA-------DLDI-----PLSGR--------SMLYDDLTVPVTTNLYINCISPKMNEEMLCREFCKYGPLASVKIMWPRTEEERGRTSNRAFVAFMTRKDAERAMAALDGKVIMGFEMKLGWGKPARIPPQPLYTP--IGVRAAPPPPSGLPFNAQPRDRFRN----DFTKPLSSSKSELDKLKKKKTHSDARLFV--HRNLLFLIHRMIEFVVREGPMFEAIIMNKEKSNPDYRFLFDNKSQDHVYYRWKLFSILQGETPSKWRTADFRLFRGGSLWRPPVLNSY--------------------------------------SESMEVEDPVPPEEELKKGQLRAEHKQRLETLLKELTPSREDIANAMLFCLGRADAAEEVVGLIADSFSLL-------------QTPLQIKMARLYLVSDVLHNSCAKVAGASYYRKYFETKLPQIFGDLNAAHKNIQARLQAEQFKQKVMICFRAWEDWAIYPEPYLIHLQNIFLGYAKAGEEVTETVEEES-----------AEIDGAPLDRTALDGLPL 574          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Planmine SMEST
Match: SMESG000026341.1 (SMESG000026341.1)

HSP 1 Score: 1788.08 bits (4630), Expect = 0.000e+0
Identity = 913/917 (99.56%), Postives = 915/917 (99.78%), Query Frame = 3
Query:   42 MSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFEEPPKVNKTWVKGGTVNPGSSTHSSEGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLLGKPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEPPALXXXXXXXXXXXXXLLSVKPLVDYDGDPLDVDGVPLDSKATEATNSTEILDMFANPSSPQTKRITKEPLFVPSKWETVDPADEESEIVQSRWQLMESQSEDKKSSDNEDPDGYPLSDNDENFNLSMIKSHDLSPKNKKNDENRNITSLVSYGXXXXXXXXXXXXXXXXXXXLLPKLDVRLDKEYKSTKNKPDRRSNISPYNDNTYXXXXXXXXXXXXHDYDSSYSRSNKSETVEIRSRVIRLDHRDDSDKNRLRDP 2792
            MSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFEEPPKVNKTWVKGGTVNPGSSTHSSEGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLLGKPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKS+ENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEPPALSEEKSNVKVSEENLLSVKPLVDYDGDPLDVDGVPLDSKATEATNSTEILDMFANPSSPQTKRITKEPLFVPSKWETVDPADEESEIVQSRWQLMESQSEDKKSSDNEDPDGYPLSDNDENFNLSMIKSHDLSPKNKKNDENRNITSLVSYGNESSEEDREANDD+DDVDNLL KLD RLDKEYKSTKNKPDRRSNISPYNDNTYRSSPSKRSKTKRHDYDSSYSRSNKSETVEIRSRVIRLDHRDDSDKNRLRDP
Sbjct:    1 MSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFEEPPKVNKTWVKGGTVNPGSSTHSSEGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLLGKPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKEPEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKPPPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVTIPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEHVYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELIEDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLTDSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTIGYATDKSVENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENSLPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLKNQFLGIVEPPALSEEKSNVKVSEENLLSVKPLVDYDGDPLDVDGVPLDSKATEATNSTEILDMFANPSSPQTKRITKEPLFVPSKWETVDPADEESEIVQSRWQLMESQSEDKKSSDNEDPDGYPLSDNDENFNLSMIKSHDLSPKNKKNDENRNITSLVSYGNESSEEDREANDDDDDVDNLLSKLDARLDKEYKSTKNKPDRRSNISPYNDNTYRSSPSKRSKTKRHDYDSSYSRSNKSETVEIRSRVIRLDHRDDSDKNRLRDP 917          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Planmine SMEST
Match: SMESG000077958.1 (SMESG000077958.1)

HSP 1 Score: 54.6842 bits (130), Expect = 3.007e-7
Identity = 29/83 (34.94%), Postives = 46/83 (55.42%), Query Frame = 3
Query:  633 TTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKT 881
            T  LF+GNL   +TE  L ELFG+FG +  + I  P S+ +   G +  F+ F N     +A  ++ G+ I   ++K+G+GK 
Sbjct:  217 TRTLFVGNLPCSVTESNLKELFGKFGQVTDIDIKKPTSNRQ---GNSYAFIKFENLDIANQAKNEMSGHMIGKCQIKIGFGKV 296          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Planmine SMEST
Match: SMESG000077958.1 (SMESG000077958.1)

HSP 1 Score: 54.299 bits (129), Expect = 3.519e-7
Identity = 29/83 (34.94%), Postives = 46/83 (55.42%), Query Frame = 3
Query:  633 TTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKT 881
            T  LF+GNL   +TE  L ELFG+FG +  + I  P S+ +   G +  F+ F N     +A  ++ G+ I   ++K+G+GK 
Sbjct:   88 TRTLFVGNLPCSVTESNLKELFGKFGQVTDIDIKKPTSNRQ---GNSYAFIKFENLDIANQAKNEMSGHMIGKCQIKIGFGKV 167          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Planmine SMEST
Match: SMESG000062663.1 (SMESG000062663.1)

HSP 1 Score: 52.7582 bits (125), Expect = 8.488e-7
Identity = 30/83 (36.14%), Postives = 42/83 (50.60%), Query Frame = 3
Query:  627 RTTTNLFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWG 875
            +T TN+++ N    L  Q L ELF  FG + SVK+M      EK   +  GFV F N SD  +++EKL    I    + +G  
Sbjct:  180 KTFTNVYVKNFGIHLNNQSLEELFSPFGEIISVKVMAT----EKGISKGFGFVCFKNHSDALKSIEKLNETTIIDKVIYVGLA 258          
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Planmine SMEST
Match: SMESG000022369.1 (SMESG000022369.1)

HSP 1 Score: 48.9062 bits (115), Expect = 3.653e-6
Identity = 28/81 (34.57%), Postives = 45/81 (55.56%), Query Frame = 3
Query:  642 LFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAFMNRSDGERALEKLRGNEICGYEMKLGWGKTV 884
            L + NL+ E TE+ L E+F R+G +  V ++    D+   R R  GFV F N  D E A EK+ G  + G ++++ +  T+
Sbjct:   20 LGIFNLSLETTEKDLHEMFFRYGEIEDVSLVI---DKVTKRSRGFGFVYFKNIDDAEIAKEKVHGTIVQGKQIRVDYSVTL 97          
The following BLAST results are available for this feature:
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
U2SURP2.812e-16042.52U2 snRNP associated SURP domain containing [Source... [more]
U2SURP1.502e-15842.33U2 snRNP associated SURP domain containing [Source... [more]
U2SURP6.298e-6245.59U2 snRNP associated SURP domain containing [Source... [more]
U2SURP1.966e-5847.37U2 snRNP associated SURP domain containing [Source... [more]
PABPC11.888e-830.86poly(A) binding protein cytoplasmic 1 [Source:HGNC... [more]
back to top
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C07H6.45.134e-8030.57pep chromosome:WBcel235:III:7499677:7503241:1 gene... [more]
tiar-32.043e-623.89TIA-1/TIAL RNA binding protein homolog [Source:Un... [more]
back to top
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG93465.256e-15839.08gene:FBgn0034572 transcript:FBtr0071526[more]
Caper5.678e-734.21gene:FBgn0031883 transcript:FBtr0089640[more]
Caper5.678e-734.21gene:FBgn0031883 transcript:FBtr0089636[more]
Rox84.653e-626.74gene:FBgn0005649 transcript:FBtr0084592[more]
Rox84.653e-626.74gene:FBgn0005649 transcript:FBtr0084594[more]
back to top
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
u2surp3.383e-15340.36U2 snRNP-associated SURP domain containing [Source... [more]
u2surp1.982e-15240.36U2 snRNP-associated SURP domain containing [Source... [more]
zgc:1630985.453e-14737.19zgc:163098 [Source:ZFIN;Acc:ZDB-GENE-070410-141][more]
zgc:1630985.453e-14737.19zgc:163098 [Source:ZFIN;Acc:ZDB-GENE-070410-141][more]
zgc:1630981.107e-14636.96zgc:163098 [Source:ZFIN;Acc:ZDB-GENE-070410-141][more]
back to top
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
u2surp3.885e-16342.60U2 snRNP associated SURP domain containing [Source... [more]
u2surp1.132e-13346.10U2 snRNP associated SURP domain containing [Source... [more]
u2surp1.185e-12639.03U2 snRNP associated SURP domain containing [Source... [more]
u2surp3.433e-12639.03U2 snRNP associated SURP domain containing [Source... [more]
u2surp7.253e-12639.03U2 snRNP associated SURP domain containing [Source... [more]
back to top
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
U2surp2.929e-16042.65U2 snRNP-associated SURP domain containing [Source... [more]
U2surp3.073e-16042.65U2 snRNP-associated SURP domain containing [Source... [more]
U2surp3.092e-16042.46U2 snRNP-associated SURP domain containing [Source... [more]
U2surp2.699e-5847.70U2 snRNP-associated SURP domain containing [Source... [more]
Pabpc63.251e-934.62poly(A) binding protein, cytoplasmic 6 [Source:MGI... [more]
back to top
BLAST of U2 snRNP-associated SURP motif-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O15042|SR140_HUMAN1.350e-15942.52U2 snRNP-associated SURP motif-containing protein ... [more]
sp|Q6NV83|SR140_MOUSE2.149e-15942.65U2 snRNP-associated SURP motif-containing protein ... [more]
sp|Q5R7X2|SR140_PONAB5.090e-15942.46U2 snRNP-associated SURP motif-containing protein ... [more]
sp|Q9C5J3|RRC1_ARATH3.626e-9534.00Protein RRC1 OS=Arabidopsis thaliana OX=3702 GN=RR... [more]
sp|F4KIA8|RRC1L_ARATH3.235e-7434.29Protein RRC1-like OS=Arabidopsis thaliana OX=3702 ... [more]
back to top
BLAST of U2 snRNP-associated SURP motif-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M2L50.000e+042.83Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4V3SG040.000e+042.83Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4Z2DBL80.000e+044.31U2 snRNP-associated SURP motif-containing protein ... [more]
A0A3Q0KRB00.000e+044.09Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A183QJ420.000e+044.05Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
back to top
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
u2surp1.579e-14839.80U2 snRNP-associated SURP domain containing [Source... [more]
u2surp2.472e-14839.87U2 snRNP-associated SURP domain containing [Source... [more]
zgc:1630986.468e-12836.11zgc:163098 [Source:ZFIN;Acc:ZDB-GENE-070410-141][more]
zgc:1630981.207e-5939.71zgc:163098 [Source:ZFIN;Acc:ZDB-GENE-070410-141][more]
zgc:1630982.232e-5939.65zgc:163098 [Source:ZFIN;Acc:ZDB-GENE-070410-141][more]
back to top
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pabpc43.315e-733.33poly(A) binding protein, cytoplasmic 4 (inducible ... [more]
tia1l1.322e-626.14cytotoxic granule-associated RNA binding protein 1... [more]
RBM391.420e-635.53RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
rbm222.110e-633.68RNA binding motif protein 22 [Source:NCBI gene;Acc... [more]
RBM393.020e-632.47RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
back to top
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
NGR13.106e-1237.25RNA binding protein that negatively regulates grow... [more]
PAB15.821e-834.88Poly(A) binding protein; part of the 3'-end RNA-pr... [more]
PUB17.462e-829.63Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
NAM85.719e-731.82RNA binding protein, component of the U1 snRNP pro... [more]
back to top
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348572.986e-11241.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282762.045e-4754.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348583.824e-1733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339267.640e-733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319811.317e-635.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
u2surp3.278e-15939.22U2 snRNP associated SURP domain containing [Source... [more]
u2surp3.809e-15939.26U2 snRNP associated SURP domain containing [Source... [more]
zgc:1630986.280e-13136.66U2 snRNP-associated SURP motif-containing protein ... [more]
u2surp1.406e-12334.72U2 snRNP associated SURP domain containing [Source... [more]
zgc:1630981.522e-11838.60U2 snRNP-associated SURP motif-containing protein ... [more]
back to top
BLAST of U2 snRNP-associated SURP motif-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026341.10.000e+099.56SMESG000026341.1[more]
SMESG000077958.13.007e-734.94SMESG000077958.1[more]
SMESG000077958.13.519e-734.94SMESG000077958.1[more]
SMESG000062663.18.488e-736.14SMESG000062663.1[more]
SMESG000022369.13.653e-634.57SMESG000022369.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014392 ID=SMED30014392|Name=U2 snRNP-associated SURP motif-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3003bp
CTGTATTTCTTATGAATTTTTATTTCTATTAAATAATTAAGATGTCATAT
CGATCTCGATTTAAAACTGTTGCTGATACTATTGAAGAGGAAGCTCGTAA
ACTACAAGCAAATGAAGAAACTGCAATTGTTTATCAACAGTTTATTGAAA
CTTTTGAGGAGCCACCGAAAGTCAATAAAACTTGGGTAAAGGGTGGCACA
GTCAATCCTGGAAGTTCCACCCATAGTTCTGAAGGAGCTGGTAAATTATA
TCAGCCATTAATGAAAACCGTTGACAAAATTCCCGATAAATTCAAAGAAA
AATTTCAGTCTGAATTTAATAAAAAACCACCACTTCTTGGAAAACCAAAG
GAACAAAGTAAGAGAAAGTCGAATTTAGAAGCATTTAGCGAGGAATTAAA
ACAACTACAACAAGAAAGAGAAATGCGAAATCAAAAACAAAAACTTGTGA
CTGAACGAGTTGAAGACATAAATAATAAATTTGTTAAAGAACCCGAAATA
AAGAACAGCGAAGAGCCACGAAAATCACGATTTGATTTAAACATAATTCC
AATAATTAAGCCTTTACCTGCTACTCTTCCTTCCTCTCCTTTTGACATTG
ATTTTCCTTATGACTCTGAAACAGATCGAACGACTACAAATTTATTTCTC
GGAAATCTTAATCCCGAACTTACAGAACAGCAATTATGTGAATTATTTGG
CAGATTCGGACCGTTGGCCAGCGTAAAAATAATGTGGCCACGAAGTGACG
AAGAGAAAGCTCGAGGTCGCAATTGCGGTTTTGTAGCGTTCATGAATCGT
TCTGATGGAGAACGCGCATTGGAAAAGTTGCGGGGAAATGAAATTTGTGG
CTATGAAATGAAATTAGGTTGGGGGAAAACGGTATTGATTCCGCCTCATC
CGATTTACGTGCCGCCGATATTGATGGAAATGATAAAACCGCCACCACCA
AGCGGATTGCCATTCAATGCCCAACCGAGAGAATGGTTACAAAAAACCGG
AAATGTGGACAGCCGAAAAATGTTCGACATGTGTTCAATGAGCGATGAGG
ATTTGGCGGAAACATTGAAAAATTGCGTCGTTAAAGTGACTATCCCAACA
GATCGGCAGTTGCTCCAGTTGATTAATCGAATGGTCGAATTCGTCATCAG
AGAAGGTGTCGAATTCGAAGCGTTTATTATGAATAAGGAAATGAGAAATC
CTAATTTTAAGTTCCTATTTGATTTCCAATCGCCCGAGCACGTTTATTAT
CGTTGGAAATTGTATTCGACACTCCATGGAGAAAGTACTAAAAGCTGGAA
GACAGACGAATTTATTATGTACAAAGGAGGTCCGTATTGGCGGCCTCCTC
CACTAAATCCTTTCACTAGTGGAATCCCAGAGGAATTGATTGAGGATATT
GATTTCTCCAAGTTGACACTTGAGAACATTTCTCAAACGCTGAATAACGC
TGATTCATCAAAAGAATCAGCCAATCAATCAAATGAGATGTGCATGGAAA
ATCCATACAGTAACAATCACGTTTACAAGCGACAACTGACTGACAGTCAA
CGGGAACGATTGATTGAGATATTGATTGATTTGGAACCGATCAAACATTC
AATCGGCGAGGCAATGGTCTGGTGCTTGGAACACGCCGATTCTGCAGAGG
ACGTGTTGGATATCATTGTCACTCAGATTGACAAAACGATTGGATACGCT
ACTGACAAATCTATAGAGAACTCAAATGCCGCCGGTCTCAATCAAATTGT
CGCTTTGTTATTTCTCGTGTCGGATATCCTCCACAATTCATGTGCCAAAG
TGCGAAATGCTTCATTTTATCGGAAATACATCGAAAATAGTCTGCCTCAG
GTTATGGTGCACCTAAATCAATATTACCTAACAATTACCAGTAAAATTAA
ATCCGAGCAGCTCAAGTATAAAGTACTTTCTTGTTTTCGTGCTTGGGGCG
ACTGGTACGTTTATCCATTTGACTTCCTACAGAAACTAAAGAACCAGTTC
CTTGGTATTGTTGAACCGCCGGCTTTATCAGAAGAAAAATCCAATGTAAA
AGTTTCCGAAGAAAATCTACTCAGTGTTAAACCACTTGTCGATTATGACG
GGGACCCACTAGACGTTGACGGTGTCCCATTGGACAGTAAAGCCACAGAA
GCAACAAATAGCACGGAAATATTGGATATGTTTGCCAATCCTTCATCGCC
CCAAACGAAACGAATCACCAAAGAACCGTTGTTTGTACCCAGTAAATGGG
AAACAGTTGATCCAGCAGATGAAGAAAGTGAAATCGTTCAAAGTCGTTGG
CAGTTAATGGAATCTCAATCGGAAGATAAGAAATCATCAGACAATGAAGA
TCCCGATGGATATCCATTGTCAGATAATGATGAGAATTTCAATTTGTCAA
TGATCAAATCTCACGATCTCAGTCCTAAGAATAAGAAAAATGATGAGAAT
AGAAATATCACGAGTTTGGTTTCTTATGGAAATGAATCTTCGGAAGAAGA
TCGGGAAGCAAACGATGACGAGGACGACGTCGACAATTTATTGCCCAAAC
TTGATGTTCGCCTAGACAAAGAATACAAATCCACTAAAAACAAACCAGAC
CGACGGAGCAATATCAGCCCGTATAATGACAATACTTATCGATCGTCACC
ATCGAAACGATCAAAAACTAAACGACATGACTATGATTCGTCTTATAGTA
GATCGAATAAAAGTGAAACAGTTGAAATTCGTTCTAGAGTTATTCGACTG
GATCATAGGGATGATTCGGATAAAAATCGATTGAGGGATCCTAAACGGCA
TCATGATAGTGATCAACAATCAAGCCATTCTCAAAGTAAACGGTCGAGAA
GGTCACGTAGTAGATCGAGGTCAAGCAGAAAATCACACAAAAGGAAATCC
AACAAGCGTTAATAAATCAATTTTTGTTTTAATACAATGTAGTCTTGTTT
TGCAGTATATTTGAAAGACTGAAATTGTGTATGAAAGAATGATTAGAAAT
CAC
back to top

protein sequence of SMED30014392-orf-1

>SMED30014392-orf-1 ID=SMED30014392-orf-1|Name=SMED30014392-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=957bp
MSYRSRFKTVADTIEEEARKLQANEETAIVYQQFIETFEEPPKVNKTWVK
GGTVNPGSSTHSSEGAGKLYQPLMKTVDKIPDKFKEKFQSEFNKKPPLLG
KPKEQSKRKSNLEAFSEELKQLQQEREMRNQKQKLVTERVEDINNKFVKE
PEIKNSEEPRKSRFDLNIIPIIKPLPATLPSSPFDIDFPYDSETDRTTTN
LFLGNLNPELTEQQLCELFGRFGPLASVKIMWPRSDEEKARGRNCGFVAF
MNRSDGERALEKLRGNEICGYEMKLGWGKTVLIPPHPIYVPPILMEMIKP
PPPSGLPFNAQPREWLQKTGNVDSRKMFDMCSMSDEDLAETLKNCVVKVT
IPTDRQLLQLINRMVEFVIREGVEFEAFIMNKEMRNPNFKFLFDFQSPEH
VYYRWKLYSTLHGESTKSWKTDEFIMYKGGPYWRPPPLNPFTSGIPEELI
EDIDFSKLTLENISQTLNNADSSKESANQSNEMCMENPYSNNHVYKRQLT
DSQRERLIEILIDLEPIKHSIGEAMVWCLEHADSAEDVLDIIVTQIDKTI
GYATDKSIENSNAAGLNQIVALLFLVSDILHNSCAKVRNASFYRKYIENS
LPQVMVHLNQYYLTITSKIKSEQLKYKVLSCFRAWGDWYVYPFDFLQKLK
NQFLGIVEPPALSEEKSNVKVSEENLLSVKPLVDYDGDPLDVDGVPLDSK
ATEATNSTEILDMFANPSSPQTKRITKEPLFVPSKWETVDPADEESEIVQ
SRWQLMESQSEDKKSSDNEDPDGYPLSDNDENFNLSMIKSHDLSPKNKKN
DENRNITSLVSYGNESSEEDREANDDEDDVDNLLPKLDVRLDKEYKSTKN
KPDRRSNISPYNDNTYRSSPSKRSKTKRHDYDSSYSRSNKSETVEIRSRV
IRLDHRDDSDKNRLRDPKRHHDSDQQSSHSQSKRSRRSRSRSRSSRKSHK
RKSNKR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035967SWAP/Surp_sf
IPR008942ENTH_VHS
IPR035009SR140_RRM
IPR035979RBD_domain_sf
IPR006569CID_dom
IPR000504RRM_dom
IPR000061Surp
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003723RNA binding
GO:0000166nucleotide binding
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 4..24
NoneNo IPR availableCOILSCoilCoilcoord: 105..132
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 854..869
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 833..853
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 875..931
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 91..111
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 932..956
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 757..771
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 755..956
NoneNo IPR availablePANTHERPTHR23140:SF0SWAP/SURP DOMAIN-CONTAINING PROTEINcoord: 12..944
NoneNo IPR availablePANTHERPTHR23140RNA PROCESSING PROTEIN LD23810Pcoord: 12..944
NoneNo IPR availableCDDcd16981CID_RPRD_likecoord: 527..651
e-value: 5.89532E-4
score: 38.716
IPR006569CID domainSMARTSM00582558neu5coord: 506..654
e-value: 5.0E-13
score: 59.3
IPR006569CID domainPROSITEPS51391CIDcoord: 499..657
score: 30.779
IPR000061SWAP/SurpSMARTSM00648surpneu2coord: 358..412
e-value: 3.6E-19
score: 79.7
IPR000061SWAP/SurpPFAMPF01805Surpcoord: 359..409
e-value: 6.3E-17
score: 61.3
IPR000061SWAP/SurpPROSITEPS50128SURPcoord: 360..403
score: 13.999
IPR000504RNA recognition motif domainSMARTSM00360rrm1_1coord: 200..276
e-value: 4.4E-18
score: 76.1
IPR000504RNA recognition motif domainPFAMPF00076RRM_1coord: 201..273
e-value: 5.6E-14
score: 51.7
IPR000504RNA recognition motif domainPROSITEPS50102RRMcoord: 199..280
score: 16.432
IPR035967SWAP/Surp superfamilyGENE3DG3DSA:1.10.10.790coord: 332..416
e-value: 2.9E-19
score: 70.4
IPR035967SWAP/Surp superfamilySUPERFAMILYSSF109905Surp module (SWAP domain)coord: 334..413
IPR008942ENTH/VHSGENE3DG3DSA:1.25.40.90coord: 498..655
e-value: 1.4E-26
score: 95.0
IPR035009SR140, RNA recognition motifCDDcd12223RRM_SR140coord: 198..281
e-value: 1.10527E-52
score: 176.3
IPR035979RNA-binding domain superfamilySUPERFAMILYSSF54928RNA-binding domain, RBDcoord: 185..280