Low affinity cationic amino acid transporter

Overview
NameLow affinity cationic amino acid transporter
Smed IDSMED30014374
Length (bp)1226
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Low affinity cationic amino acid transporter (SMED30014374) t-SNE clustered cells

Violin plots show distribution of expression levels for Low affinity cationic amino acid transporter (SMED30014374) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Low affinity cationic amino acid transporter (SMED30014374) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Low affinity cationic amino acid transporter (SMED30014374) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014374

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014374SMESG000044626.1 SMESG000044616.1 SMESG000044604.1 Contig3163GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014374SMESG000049007.1 Contig3163GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30014374SMESG000049007.1 dd_Smed_v4_2552_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30014374SMESG000049007.1 dd_Smed_v4_2552_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014374SMESG000049007.1 dd_Smed_v4_2552_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014374SMESG000049007.1 OX_Smed_1.0.08353ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30014374SMESG000049007.1 dd_Smed_v4_2552_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014374SMESG000049007.1 dd_Smed_v4_2552_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Low affinity cationic amino acid transporter vs. Ensembl Fly
Match: cold (gene:FBgn0031268 transcript:FBtr0078069)

HSP 1 Score: 82.4185 bits (202), Expect = 1.491e-18
Identity = 42/113 (37.17%), Postives = 66/113 (58.41%), Query Frame = 3
Query:   66 TNISIVELMECYVCNTQEGNNDKCIKTSMQCLEPEDFCLTEITYETPPYWLYIMERRHFIKKRCIAKAECNQIKNQYASS-CYREYYMDWKCAECCEGELCNYYV--TLSSRQ 395
            + ++ V  +ECYVC+ Q GN +KC+ T   C   E+ C TEI + + PY+     +++++ KRC+ K +C   + +Y    C   +Y DW C ECC+G+ CNY+V     SRQ
Sbjct:   18 SQVNFVAGLECYVCSNQTGNTEKCLNTIKTCEPFENVCGTEIRWGSQPYFSEGALKQYYVSKRCMTKEQCQSKRKRYMQLYCTHIWYEDWACNECCKGDRCNYFVISGAPSRQ 130          
BLAST of Low affinity cationic amino acid transporter vs. Ensembl Fly
Match: cold (gene:FBgn0031268 transcript:FBtr0310022)

HSP 1 Score: 82.4185 bits (202), Expect = 1.491e-18
Identity = 42/113 (37.17%), Postives = 66/113 (58.41%), Query Frame = 3
Query:   66 TNISIVELMECYVCNTQEGNNDKCIKTSMQCLEPEDFCLTEITYETPPYWLYIMERRHFIKKRCIAKAECNQIKNQYASS-CYREYYMDWKCAECCEGELCNYYV--TLSSRQ 395
            + ++ V  +ECYVC+ Q GN +KC+ T   C   E+ C TEI + + PY+     +++++ KRC+ K +C   + +Y    C   +Y DW C ECC+G+ CNY+V     SRQ
Sbjct:   18 SQVNFVAGLECYVCSNQTGNTEKCLNTIKTCEPFENVCGTEIRWGSQPYFSEGALKQYYVSKRCMTKEQCQSKRKRYMQLYCTHIWYEDWACNECCKGDRCNYFVISGAPSRQ 130          
BLAST of Low affinity cationic amino acid transporter vs. TrEMBL
Match: A0A5K3FB48 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 5.631e-38
Identity = 67/123 (54.47%), Postives = 85/123 (69.11%), Query Frame = 3
Query:   90 MECYVCNTQEGNNDKCIKTSMQCLEPEDFCLTEITYETPPYWLYIMERRHFIKKRCIAKAECNQIKNQYASSCYREYYMDWKCAECCEGELCNYYVTLSSRQVTMH-WAVLMAVT-TITSYLV 452
            MECYVC+ QEGN DKC+KTSMQCL+ ED C+T I+Y  PPYW    +R+HF+ K C   A C   K      C RE+YMDW+C ECC+GELCNYY TL S ++ M+ W +  AV  T+TS+L+
Sbjct:   20 MECYVCHNQEGNRDKCVKTSMQCLQDEDTCMTNISYTVPPYWEPFGDRKHFLWKSCTTAANCESEKQIAGKHCMREWYMDWRCVECCQGELCNYYATLKSSRLVMNPWVLAFAVGITVTSFLL 142          
BLAST of Low affinity cationic amino acid transporter vs. TrEMBL
Match: A0A4Z2D4W9 (Low affinity cationic amino acid transporter isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_004765 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 6.135e-36
Identity = 64/114 (56.14%), Postives = 82/114 (71.93%), Query Frame = 3
Query:   90 MECYVCNTQEGNNDKCIKTSMQCLEPEDFCLTEITYETPPYWLYIMERRHFIKKRCIAKAECNQIKNQYASSCYREYYMDWKCAECCEGELCNYYVTLSSRQVTMHWAVLMAVT 431
            MECYVC  QEGN DKCIKT+MQCLE E  C+T I+Y  PPYW  + ER HF+ K CI+  EC + K     +C RE+YMDW+C ECC+GELCNYY TLSS +V ++  +++ +T
Sbjct:   20 MECYVCRNQEGNKDKCIKTTMQCLEDEHSCITNISYTVPPYWSPMGERTHFLWKACISTEECERQKEIAGKTCQREWYMDWRCVECCQGELCNYYATLSSYRVYLNKNLMILIT 133          
BLAST of Low affinity cationic amino acid transporter vs. TrEMBL
Match: A0A4S2M0B7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003621 PE=4 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.273e-35
Identity = 64/120 (53.33%), Postives = 79/120 (65.83%), Query Frame = 3
Query:   90 MECYVCNTQEGNNDKCIKTSMQCLEPEDFCLTEITYETPPYWLYIMERRHFIKKRCIAKAECNQIKNQYASSCYREYYMDWKCAECCEGELCNYYVTLSSRQVTMHWAVLMAVTTITSYL 449
            MECYVC  QEGN DKCI+T+MQCLE +  C+T ITY  PPYW  + +R HFI K CI   EC ++K      C RE+YMDW+C ECC+GELCNYYVTLS   ++    VL  V   + + 
Sbjct:   21 MECYVCRNQEGNRDKCIRTTMQCLEDQLSCITNITYRIPPYWSPLGDRSHFIWKACITTDECERLKEYSGQFCQREWYMDWQCVECCQGELCNYYVTLSGLSLSPAKLVLTLVVVFSLWF 140          
BLAST of Low affinity cationic amino acid transporter vs. TrEMBL
Match: A0A5J4ND94 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0002671 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.414e-35
Identity = 64/117 (54.70%), Postives = 82/117 (70.09%), Query Frame = 3
Query:   90 MECYVCNTQEGNNDKCIKTSMQCLEPEDFCLTEITYETPPYWLYIMERRHFIKKRCIAKAECNQIKNQYASSCYREYYMDWKCAECCEGELCNYYVTLSSRQVTMHWAVLMAVTTIT 440
            MECYVC  QEGN DKCI+T+MQCLE +  C+T I+Y  PPYW  + ER HFI K CI+ AEC ++  +    C RE++MDW+C ECC+GELCNYYVTLSS  V   W  ++  T ++
Sbjct:   22 MECYVCRNQEGNRDKCIRTTMQCLEDQLSCITNISYTIPPYWSPLGERTHFIWKACISTAECERLMEEAGQYCQREWFMDWRCVECCQGELCNYYVTLSSANV---WPNVLLTTILS 135          
BLAST of Low affinity cationic amino acid transporter vs. TrEMBL
Match: A0A419PCQ5 (Uncharacterized protein (Fragment) OS=Clonorchis sinensis OX=79923 GN=CSKR_1284s PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.006e-35
Identity = 64/120 (53.33%), Postives = 79/120 (65.83%), Query Frame = 3
Query:   90 MECYVCNTQEGNNDKCIKTSMQCLEPEDFCLTEITYETPPYWLYIMERRHFIKKRCIAKAECNQIKNQYASSCYREYYMDWKCAECCEGELCNYYVTLSSRQVTMHWAVLMAVTTITSYL 449
            MECYVC  QEGN DKCI+T+MQCLE +  C+T ITY  PPYW  + +R HFI K CI   EC ++K      C RE+YMDW+C ECC+GELCNYYVTL+   ++    VL  V   T + 
Sbjct:    3 MECYVCRNQEGNRDKCIRTTMQCLEDQLSCITNITYRIPPYWSPLGDRSHFIWKACITTDECERLKEYSGQFCQREWYMDWQCVECCQGELCNYYVTLTGLSLSPARRVLTLVVMFTLWF 122          
BLAST of Low affinity cationic amino acid transporter vs. Planmine SMEST
Match: SMESG000049007.1 (SMESG000049007.1)

HSP 1 Score: 274.248 bits (700), Expect = 4.130e-92
Identity = 143/145 (98.62%), Postives = 145/145 (100.00%), Query Frame = 3
Query:   27 MKXXXXXXXXXXXTNISIVELMECYVCNTQEGNNDKCIKTSMQCLEPEDFCLTEITYETPPYWLYIMERRHFIKKRCIAKAECNQIKNQYASSCYREYYMDWKCAECCEGELCNYYVTLSSRQVTMHWAVLMAVTTITSYLVVAH 461
            MKLYFLAIFLL+LTNISIVELMECYVCNTQEGNNDKCIKTSMQCLEPEDFCLTEITYETPPYWLYIMERRHFIKKRCIAKAECNQIK+QYASSCYREYYMDWKCAECCEGELCNYYVTLSSRQVTMHWAVLMAVTTITSYLVVAH
Sbjct:    1 MKLYFLAIFLLILTNISIVELMECYVCNTQEGNNDKCIKTSMQCLEPEDFCLTEITYETPPYWLYIMERRHFIKKRCIAKAECNQIKDQYASSCYREYYMDWKCAECCEGELCNYYVTLSSRQVTMHWAVLMAVTTITSYLVVAH 145          
BLAST of Low affinity cationic amino acid transporter vs. Planmine SMEST
Match: SMESG000073991.1 (SMESG000073991.1)

HSP 1 Score: 78.9518 bits (193), Expect = 1.796e-17
Identity = 38/103 (36.89%), Postives = 55/103 (53.40%), Query Frame = 3
Query:   90 MECYVCNTQEGNNDKCIKTSMQCLEPEDFCLTEITYETPPYWLYIMERRHFIKKRCIAKAECNQIKNQYASSCYREYYMDWKCAECCEGELCNYYVTLSSRQV 398
            ++CY C   EGN   CI++S QC   +D C++ + Y TP YW    ERR F+ K C  K++C  ++      C  +   DW C ECC  + CNY V   S ++
Sbjct:   20 LQCYKCANVEGNYYDCIRSSTQCNPNQDACISNVIYTTPTYWTQSTERRAFVTKGCSTKSQCEGMQRVIQERCTYDMKSDWACIECCFSDNCNYAVKNHSGKI 122          
The following BLAST results are available for this feature:
BLAST of Low affinity cationic amino acid transporter vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cold1.491e-1837.17gene:FBgn0031268 transcript:FBtr0078069[more]
cold1.491e-1837.17gene:FBgn0031268 transcript:FBtr0310022[more]
back to top
BLAST of Low affinity cationic amino acid transporter vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3FB485.631e-3854.47Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A4Z2D4W96.135e-3656.14Low affinity cationic amino acid transporter isofo... [more]
A0A4S2M0B71.273e-3553.33Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5J4ND941.414e-3554.70Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A419PCQ52.006e-3553.33Uncharacterized protein (Fragment) OS=Clonorchis s... [more]
back to top
BLAST of Low affinity cationic amino acid transporter vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low affinity cationic amino acid transporter vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000049007.14.130e-9298.62SMESG000049007.1[more]
SMESG000073991.11.796e-1736.89SMESG000073991.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014374 ID=SMED30014374|Name=Low affinity cationic amino acid transporter|organism=Schmidtea mediterranea sexual|type=transcript|length=1226bp
AATGAACTATTTTTTAAAATAGGGAAATGAAATTATATTTTCTTGCTATA
TTTTTGTTGTTACTTACTAATATCTCCATAGTTGAATTAATGGAATGTTA
TGTTTGTAATACTCAAGAAGGAAATAATGATAAATGTATAAAGACATCTA
TGCAGTGTCTCGAACCTGAAGATTTCTGTTTAACGGAAATAACATATGAA
ACACCTCCATATTGGTTATATATTATGGAGAGGCGTCATTTTATTAAAAA
GCGATGCATCGCGAAAGCTGAATGTAATCAAATTAAAAATCAGTACGCAT
CTTCTTGCTATAGAGAATATTACATGGATTGGAAATGCGCTGAATGCTGT
GAAGGAGAATTGTGTAATTATTATGTCACATTATCAAGCAGACAAGTTAC
AATGCATTGGGCAGTACTGATGGCCGTCACAACGATTACGAGCTACCTCG
TGGTTGCCCATTAAATGATATAGGTCCCTCTCACGGATCTATCAAGGCTG
TGTTTTACATTTCATATCAATTTGTATATTTATTTCGTATGGATATTTTT
TATGGTCTGTATTTATTATTGAAATTGTTTTTCTTTGATTTGTGTCTGTG
AAATTTGTTGGTGTGCGACCAATCAGAATGTGATATTTAATATTTGGTTA
TATTTACTTATGATCATTTTTATTTGACTGATTTATTCGTCAGTGGCTTG
CTATTAGACCGCCGCTTTCTTTTCAGTGGAATAATTCTACTTATCCGGGT
ACTTTCGAGGCTGTGACGTTACAATTTAATTGATTTAGAAAATCGATATA
TAACAGTGTTGTTTCAGTCCCTCCTTGCGTTTTTTAACATATAACAAATT
TTGTGGCAAACCTTTACAAAAAATGTATAGCTCCTCATTATCATTGGTTC
TTTAGTATTGGCCCGTTTCTGTACCTCTGTCTGTTTTTTGTTACTCGTGG
CGTCGACAATTCAAGGAAAATAATCCGAAACCTTAGATATTGATAATAGA
ATCTGCTTTAATGCACAGATTTCCCATGTGGAAGAAGAGCTCTAGAAAGA
GGACAATTTCAAAGGTTTGATAATGGACGTTATTAGTAAAGTTCAAACAA
CGAAATATTCTATCGTGTTTATAAGTCTCGCTGTGCGGTTAACCATTGAT
ATAACGGCTGATATCCGATATAGAAGGCAGGTGAACATTTTGTAAATTTC
AATTAAGTATTTTCACGAATTTACGC
back to top

protein sequence of SMED30014374-orf-1

>SMED30014374-orf-1 ID=SMED30014374-orf-1|Name=SMED30014374-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=146bp
MKLYFLAIFLLLLTNISIVELMECYVCNTQEGNNDKCIKTSMQCLEPEDF
CLTEITYETPPYWLYIMERRHFIKKRCIAKAECNQIKNQYASSCYREYYM
DWKCAECCEGELCNYYVTLSSRQVTMHWAVLMAVTTITSYLVVAH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF16975UPAR_LY6_2coord: 22..121
e-value: 1.4E-4
score: 22.0
NoneNo IPR availablePANTHERPTHR20914:SF21COILED, ISOFORM Acoord: 5..141
NoneNo IPR availablePANTHERPTHR20914EP1/ROBO-1coord: 5..141
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.859
NoneNo IPR availableSUPERFAMILYSSF57302Snake toxin-likecoord: 23..114
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 124..143