SMED30014371

Overview
NameSMED30014371
Smed IDSMED30014371
Length (bp)853
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30014371 (SMED30014371) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30014371 (SMED30014371) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30014371 (SMED30014371) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30014371 (SMED30014371) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014371

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014371SMESG000077296.1 dd_Smed_v4_1778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014371SMESG000077296.1 dd_Smed_v4_1778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014371SMESG000077296.1 dd_Smed_v4_1778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014371SMESG000077296.1 dd_Smed_v4_1778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30014371SMESG000077296.1 dd_Smed_v4_1778_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014371SMESG000077296.1 Contig39196newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014371SMESG000077296.1 Contig39196uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
musculature systemSMED30014371SMESG000077296.1 dd_Smed_v6_1778_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30014371SMESG000077296.1 dd_Smed_v6_1778_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30014371 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000312:98488..99340 +4229
Homology
BLAST of SMED30014371 vs. TrEMBL
Match: A0A4S2LMN0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007772 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 1.055e-49
Identity = 83/195 (42.56%), Postives = 125/195 (64.10%), Query Frame = 3
Query:  120 FLVYSSIPSAFSSTYSPEFTKQVQEYPNVVTDLKKCVP-QGNYHSQVNNVCDPDNLLLIGDINYLNKKIQDIKNYDKENSRECDPDKPRPSIAIALVNEIKSNKKTSEDILNLASVFTYSLYDDWKISSFC--TSDKLIIFYSKKDGALYTYAGTLMNEKLPSKKIIDIAVASKPFFSLGAARGLKYVLERYSKA 695
             L++ S+     + Y  EFT QVQ YPN++ +  +C+P +G Y      VCDPD LL +  IN+LN  +++ +N    +   C P  P P IA+ALVN++K   +  + +L+ AS+FTY L+++W + S C   SDK+IIFYSK DG +YT+AG L+  KLPS++IID AV ++  FS G A GL ++++RY +A
Sbjct:   14 LLLFISLFGFTLAEYPHEFTAQVQSYPNIMRESAQCLPLKGLYDHDQTFVCDPDRLLTVDQINHLNSMLKEFRNLRSRDESMCSPHSPHPVIALALVNKLKVGNENPDRLLSYASIFTYYLFNEWNLPSTCHTGSDKVIIFYSKDDGVIYTFAGNLLERKLPSQRIIDFAVEARIHFSNGIAAGLGFLIQRYREA 208          
BLAST of SMED30014371 vs. TrEMBL
Match: A0A5J4NE80 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0006470 PE=4 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 9.403e-48
Identity = 81/181 (44.75%), Postives = 117/181 (64.64%), Query Frame = 3
Query:  162 YSPEFTKQVQEYPNVVTDLKKCVP-QGNYHSQVNNVCDPDNLLLIGDINYLNKKIQDIKNYDKENSRECDPDKPRPSIAIALVNEIKSNKKTSEDILNLASVFTYSLYDDWKISSFC--TSDKLIIFYSKKDGALYTYAGTLMNEKLPSKKIIDIAVASKPFFSLGAARGLKYVLERYSKA 695
            Y  EFT QVQ YPN++   + C+P +GNY      VCD D LL +  IN LN+ +Q+ +N    +S  C P  P P IAIALVN++K   +  + +L+ AS+F Y L+++W + S C   SDK+IIFYSK DG +YT+AG L+  KLPS ++IDIAV ++ +FS G   GL Y++++Y + 
Sbjct:   26 YPLEFTAQVQSYPNIMRAKEDCLPLKGNYEHAQTYVCDVDRLLTVNQINRLNELLQEFRNLKNRDSSACSPANPNPVIAIALVNKLKVGNENPDRLLSYASIFAYYLFNEWNLPSTCHTGSDKMIIFYSKDDGMIYTFAGNLLERKLPSSRLIDIAVQARLYFSNGIYEGLTYLIQKYRQV 206          
BLAST of SMED30014371 vs. TrEMBL
Match: A0A074ZXD3 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_02101 PE=4 SV=1)

HSP 1 Score: 172.17 bits (435), Expect = 1.049e-47
Identity = 84/192 (43.75%), Postives = 120/192 (62.50%), Query Frame = 3
Query:  162 YSPEFTKQVQEYPNVVTDLKKCVP-QGNYHSQVNNVCDPDNLLLIGDINYLNKKIQDIKNYDKENSRECDPDKPRPSIAIALVNEIKSNKKTSEDILNLASVFTYSLYDDWKISSFCT--SDKLIIFYSKKDGALYTYAGTLMNEKLPSKKIIDIAVASKPFFSLGAARGLKYVLERYSKAFLGRDKGVLGN 728
            Y  EFT QVQ YPN++ +  +C+P +G Y      VCDPD LL +  IN+LN  +++ +N    +   C P  P P IA+ALVN++K   +  + +L+ AS+FTY L+++W + S C   SDK+IIFYSK DG +YT+AG L+  KLPS++IID AV S+  FS G A GL ++++RY           LGN
Sbjct:   28 YPHEFTAQVQSYPNIMRESAQCLPLKGLYDHDQTFVCDPDRLLTVDQINHLNSMLKEFRNLRSRDESMCSPHSPHPVIALALVNKLKVGNENPDRLLSYASIFTYYLFNEWNLPSTCHTGSDKVIIFYSKDDGVIYTFAGNLLERKLPSQRIIDFAVESRIHFSNGIAAGLGFLIQRYRMLCRSFCASALGN 219          
BLAST of SMED30014371 vs. TrEMBL
Match: A0A419QCC8 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_23s PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 2.479e-47
Identity = 86/196 (43.88%), Postives = 123/196 (62.76%), Query Frame = 3
Query:  108 LFGLFLVYSSIPSAFSSTYSPEFTKQVQEYPNVVTDLKKCVP-QGNYHSQVNNVCDPDNLLLIGDINYLNKKIQDIKNYDKENSRECDPDKPRPSIAIALVNEIKSNKKTSEDILNLASVFTYSLYDDWKISSFC--TSDKLIIFYSKKDGALYTYAGTLMNEKLPSKKIIDIAVASKPFFSLGAARGLKYVLERY 686
            LFGL L          + Y  EFT QVQ YPN++ +  +C+P +G Y      VCDPD LL +  IN+LN  +++ +N    +   C P  P P IA+ALVN++K   +  + +L+ AS+FTY L+++W + S C   SDK+IIFYSK DG +YT+AG L+  KLPS++IID AV S+  FS G A GL ++++RY
Sbjct:   20 LFGLTL----------AEYPHEFTAQVQSYPNIMRESAQCLPLKGLYDHDQTFVCDPDRLLTVDQINHLNSMLKEFRNLRSRDESMCSPHSPHPVIALALVNKLKVGNENPDRLLSYASIFTYYLFNEWNLPSTCHTGSDKVIIFYSKDDGVIYTFAGNLLERKLPSQRIIDFAVESRIHFSNGIAAGLGFLIQRY 205          
BLAST of SMED30014371 vs. TrEMBL
Match: A0A183AD73 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS4908 PE=4 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 4.286e-44
Identity = 85/206 (41.26%), Postives = 124/206 (60.19%), Query Frame = 3
Query:   78 FMMIMHWNSVLFGLFLVYSSIPSAFSSTYSPEFTKQVQEYPNVVTDLKKCVP-QGNYHSQVNNVCDPDNLLLIGDINYLNKKIQDIKNYDKENSRECDPDKPRPSIAIALVNEIKSNKKTSEDILNLASVFTYSLYDDWKISSFC--TSDKLIIFYSKKDGALYTYAGTLMNEKLPSKKIIDIAVASKPFFSLGAARGLKYVLERY 686
            F++++ W     GLF           + Y PEFT QVQ YPNV+    +C+P +GNY      VCDP  LL +  IN LNK +QD  +Y ++ S +C    P P I +AL N +K   ++ + +L+ AS+F Y L+ +W +   C   SDK+IIFYSK DG LYT+AG L+  KL S+++IDIAV S+ +FS G   G+ Y++++Y
Sbjct:    8 FLLLITW----IGLF------GHVIQAEYPPEFTHQVQNYPNVIDSKDQCLPLKGNYDHPTTFVCDPFRLLTVDQINRLNKLLQD--DYSRDGS-QCSVTNPNPVIGVALTNRLKVGNESPDRLLDYASIFAYYLFREWNLPFKCHTGSDKIIIFYSKDDGVLYTFAGDLIERKLSSQQLIDIAVQSRVYFSNGIYEGIAYLIQQY 200          
BLAST of SMED30014371 vs. Ensembl Nematostella
Match: EDO30764 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZU4])

HSP 1 Score: 63.1586 bits (152), Expect = 2.486e-12
Identity = 45/158 (28.48%), Postives = 74/158 (46.84%), Query Frame = 3
Query:  171 EFTKQVQEYPNVVTDLKKCVPQGNYHSQVNNVCDPDNLLLIGDINYLNKKIQDIKNYDKENSRECDPD-KPRPSIAIALVNEIKSNKKTSEDILNLASVFTYSLYDDWKISSFCTSDKLIIFYSKKDGALYTYAGTLMNEKLPSKKIIDIAVASKPFF 641
            E++K+   +PN + D + C  +G      + +CDPD +L   D N L + +   +N +++ +  C+   KP   IA+AL+ +IK +   S +   LA  F   L+D W +      D  +   S  D  +Y   G +  E L S +I  I    KPF 
Sbjct:    4 EWSKE--NFPNPIKDTEMCGRRG----VSSWICDPDEVLSYADANTLEEML---RNIEQKTTSGCEHSRKPGYQIAVALMKKIKHHYGISGE--ELARDFAVHLHDSWGVGHRGCGDGAVFLLSVTDRTMYISTGRVAKEVLTSDQIGIIFDEMKPFL 150          
BLAST of SMED30014371 vs. Planmine SMEST
Match: SMESG000077296.1 (SMESG000077296.1)

HSP 1 Score: 432.18 bits (1110), Expect = 2.050e-155
Identity = 211/213 (99.06%), Postives = 211/213 (99.06%), Query Frame = 3
Query:   90 MHWNSVLFGLFLVYSSIPSAFSSTYSPEFTKQVQEYPNVVTDLKKCVPQGNYHSQVNNVCDPDNLLLIGDINYLNKKIQDIKNYDKENSRECDPDKPRPSIAIALVNEIKSNKKTSEDILNLASVFTYSLYDDWKISSFCTSDKLIIFYSKKDGALYTYAGTLMNEKLPSKKIIDIAVASKPFFSLGAARGLKYVLERYSKAFLGRDKGVLGN 728
            MHWNSVLFGLFLVYSSIPS FSSTYSPEFTKQVQEYPNVVTDLKKCVPQGNYHSQVNNVCDPDNLLLIGDINYLNKKIQDIKNYDKENSRECDPDKPRPSIAIALVNEIKSNKKTSEDILNLASVFTYSLYDDWKISS CTSDKLIIFYSKKDGALYTYAGTLMNEKLPSKKIIDIAVASKPFFSLGAARGLKYVLERYSKAFLGRDKGVLGN
Sbjct:    1 MHWNSVLFGLFLVYSSIPSTFSSTYSPEFTKQVQEYPNVVTDLKKCVPQGNYHSQVNNVCDPDNLLLIGDINYLNKKIQDIKNYDKENSRECDPDKPRPSIAIALVNEIKSNKKTSEDILNLASVFTYSLYDDWKISSVCTSDKLIIFYSKKDGALYTYAGTLMNEKLPSKKIIDIAVASKPFFSLGAARGLKYVLERYSKAFLGRDKGVLGN 213          
BLAST of SMED30014371 vs. Planmine SMEST
Match: SMESG000021837.1 (SMESG000021837.1)

HSP 1 Score: 133.265 bits (334), Expect = 5.478e-38
Identity = 76/207 (36.71%), Postives = 118/207 (57.00%), Query Frame = 3
Query:  105 VLFGLF-LVYSSIPSAFSSTYSPEFTKQVQEYPNVVTDLKKCVP-QGNYHSQVNNVCDPDNLLLIGDINYLNKKIQDIKNYDKENSRECDPDKPRPSIAIALVNE--IKSNKKTSEDILNLASVFTYSLYDDWKISSFCTS--DKLIIFYSKKDGALYTYAGTLMNEKLPSKKIIDIAVASKPFFSLGAARGLKYVLERYSKAFLGR 707
            ++FGLF L+ +  P         +  +Q+Q YP+++T   KC P +GNY S +  VCDPD LL +  IN LN  I+ ++        +C  + P+P+IAIALV +  I  N K  E++++  S+F+YSL+ +W +   C S  DK+IIFYSK D  LY + G  +  +L + K+++I   SKP F+ G  +GL  V+ R     + R
Sbjct:    7 LIFGLFSLIVAESPI--------DLDEQIQGYPHIITQTSKCRPIEGNYKSLITYVCDPDKLLDVNQINSLNDMIESVRKDINVGEPDCSAENPKPTIAIALVKKMIIPENSKV-EELMSFGSLFSYSLFTNWNLQVNCKSDPDKIIIFYSKDDSVLYIFVGKKLKARLDTNKLMEIINDSKPAFTNGLYQGLTAVIARLKDTMIRR 204          
The following BLAST results are available for this feature:
BLAST of SMED30014371 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014371 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014371 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014371 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014371 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014371 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014371 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014371 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LMN01.055e-4942.56Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5J4NE809.403e-4844.75Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A074ZXD31.049e-4743.75Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A419QCC82.479e-4743.88Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A183AD734.286e-4441.26Uncharacterized protein OS=Echinostoma caproni OX=... [more]
back to top
BLAST of SMED30014371 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014371 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014371 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014371 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO307642.486e-1228.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30014371 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014371 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000077296.12.050e-15599.06SMESG000077296.1[more]
SMESG000021837.15.478e-3836.71SMESG000021837.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014371 ID=SMED30014371|Name=SMED30014371|organism=Schmidtea mediterranea sexual|type=transcript|length=853bp
ATTTCGAATGATGATTTAATATTAACATGAGGAATTCTTCAGTATAATTA
CTAAAATTCTAGATTTTAAAACCAGTTTTCATGATGATTATGCATTGGAA
TTCTGTACTATTTGGATTGTTTTTAGTCTACAGCAGCATCCCTTCGGCTT
TCAGTAGCACATATTCTCCAGAATTTACTAAACAAGTTCAAGAATATCCT
AATGTAGTTACTGATTTAAAGAAATGCGTACCTCAAGGCAATTATCACAG
CCAAGTAAACAACGTCTGTGATCCAGATAATTTACTATTAATAGGAGATA
TCAATTATCTGAACAAGAAGATCCAAGATATCAAAAATTATGACAAAGAA
AACTCAAGAGAATGTGATCCAGACAAACCGAGACCTAGCATTGCAATCGC
TCTGGTTAATGAAATAAAGAGCAACAAGAAAACCAGTGAAGACATTTTAA
ATTTGGCTTCGGTTTTTACTTATTCCCTTTATGATGATTGGAAAATTAGT
TCCTTTTGCACTTCCGATAAATTAATTATCTTTTATTCGAAAAAAGATGG
AGCACTTTATACTTATGCAGGAACTCTTATGAATGAAAAGTTACCTAGCA
AAAAGATAATCGACATCGCAGTAGCATCAAAACCGTTTTTCAGTTTGGGC
GCAGCCCGTGGATTGAAATACGTTTTGGAGCGATATTCGAAAGCTTTCTT
GGGTCGAGATAAAGGGGTTTTAGGAAATTAATTTGACCTAATATCATCGT
GAATACCCCGTGAAGCTGTTAATGATGTGGTGAAAAGTTGACAATATATT
TGATATTTTCATTATTTCTTATGTCATTATTCTGTTGCATCAGTTTTCAT
AAT
back to top

protein sequence of SMED30014371-orf-1

>SMED30014371-orf-1 ID=SMED30014371-orf-1|Name=SMED30014371-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=217bp
MMIMHWNSVLFGLFLVYSSIPSAFSSTYSPEFTKQVQEYPNVVTDLKKCV
PQGNYHSQVNNVCDPDNLLLIGDINYLNKKIQDIKNYDKENSRECDPDKP
RPSIAIALVNEIKSNKKTSEDILNLASVFTYSLYDDWKISSFCTSDKLII
FYSKKDGALYTYAGTLMNEKLPSKKIIDIAVASKPFFSLGAARGLKYVLE
RYSKAFLGRDKGVLGN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
Vocabulary: INTERPRO
TermDefinition
IPR033438MOLO1
Vocabulary: cellular component
TermDefinition
GO:0005892acetylcholine-gated channel complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.10.310.50coord: 53..210
e-value: 5.9E-6
score: 27.6
NoneNo IPR availablePANTHERPTHR33748:SF5coord: 20..210
NoneNo IPR availablePANTHERPTHR33748FAMILY NOT NAMEDcoord: 20..210
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.76
IPR033438Modulator of levamisole receptor-1PFAMPF17175MOLO1coord: 35..156
e-value: 2.5E-18
score: 66.3