F-BAR domain only protein 2

Overview
NameF-BAR domain only protein 2
Smed IDSMED30014362
Length (bp)3154
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of F-BAR domain only protein 2 (SMED30014362) t-SNE clustered cells

Violin plots show distribution of expression levels for F-BAR domain only protein 2 (SMED30014362) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of F-BAR domain only protein 2 (SMED30014362) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for F-BAR domain only protein 2 (SMED30014362) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014362

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30014362SMESG000078045.1 dd_Smed_v4_8587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014362SMESG000078045.1 dd_Smed_v4_8587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014362SMESG000078045.1 dd_Smed_v4_8587_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014362SMESG000078045.1 dd_Smed_v4_8587_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of F-BAR domain only protein 2 vs. Ensembl Human
Match: FCHO2 (FCH and mu domain containing endocytic adaptor 2 [Source:HGNC Symbol;Acc:HGNC:25180])

HSP 1 Score: 172.94 bits (437), Expect = 1.154e-43
Identity = 96/280 (34.29%), Postives = 152/280 (54.29%), Query Frame = 2
Query:  143 METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESS 979
            M    F +NFWG+K+ GFDVLY NMK G  S+ E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K  +EK +  H++L + +Q +IK VQKY +EQ    K TK+    T      + + +  L ++++ Y+A+ +E  +L K     G   R+IE+   K KKA D YK  +EKY      F+ KM E+   FQ+IE  HL  +K+ I   S  + ++  +  +    F       TV++L++ F +SK TGK  P    FE+ +++
Sbjct:    1 MVMAYFVENFWGEKNSGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGTFAPVWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQTIQSITQALQKSKENYNAKCVEQERLKK----EGATQREIEKAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIGQVHEEFINNMANTTVESLIQKFAESKGTGKERPGLIEFEECDTA 276          

HSP 2 Score: 125.946 bits (315), Expect = 9.853e-29
Identity = 90/316 (28.48%), Postives = 163/316 (51.58%), Query Frame = 2
Query: 2126 PSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDI---NIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQS------SIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P+  +   P  +S+ + + +P+A+A TE+VNA F+ +   T   V  +G + +SFP  +++ F S     +     + F +   SRL  +  LP ++ +     Q D+ T D    ++++  +   L  L    PA+ ++NVD+++Y V++N    G  + P++++  W+ + +  + L ++Y +  P   VA       P+   N        ++ +V  DG    MQSLPP+IWN++  +A W+L   + +S      S+++KF LS GP  P  +  QF +EGS  SGV  ++ G  +R+S  K R  +GRY+
Sbjct:  524 PTVGVSRGPSPVSLGNQDTLPVAVALTESVNAYFKGA-DPTKCIVKITGDMTMSFPSGIIKVFTSNPTPAV-----LCFRVKNISRLEQI--LPNAQLVFSDPSQCDSNTKD---FWMNMQAVTVYLKKLSEQNPAASYYNVDVLKYQVSSN----GIQSTPLNLATYWKCSAS-TTDLRVDYKYN-PEAMVA-------PSVLSN--------IQVVVPVDGGVTNMQSLPPAIWNAEQMKAFWKLSSISEKSENGGSGSLRAKFDLSEGPSKPTTLAVQFLSEGSTLSGVDFELVGTGYRLSLIKKRFATGRYL 807          
BLAST of F-BAR domain only protein 2 vs. Ensembl Human
Match: FCHO2 (FCH and mu domain containing endocytic adaptor 2 [Source:HGNC Symbol;Acc:HGNC:25180])

HSP 1 Score: 161.77 bits (408), Expect = 1.280e-42
Identity = 96/280 (34.29%), Postives = 152/280 (54.29%), Query Frame = 2
Query:  143 METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESS 979
            M    F +NFWG+K+ GFDVLY NMK G  S+ E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K  +EK +  H++L + +Q +IK VQKY +EQ    K TK+    T      + + +  L ++++ Y+A+ +E  +L K     G   R+IE+   K KKA D YK  +EKY      F+ KM E+   FQ+IE  HL  +K+ I   S  + ++  +  +    F       TV++L++ F +SK TGK  P    FE+ +++
Sbjct:    1 MVMAYFVENFWGEKNSGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGTFAPVWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQTIQSITQALQKSKENYNAKCVEQERLKK----EGATQREIEKAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIGQVHEEFINNMANTTVESLIQKFAESKGTGKERPGLIEFEECDTA 276          
BLAST of F-BAR domain only protein 2 vs. Ensembl Human
Match: FCHO1 (FCH and mu domain containing endocytic adaptor 1 [Source:HGNC Symbol;Acc:HGNC:29002])

HSP 1 Score: 156.377 bits (394), Expect = 2.802e-38
Identity = 83/285 (29.12%), Postives = 154/285 (54.04%), Query Frame = 2
Query:  158 FSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQ 1009
            F ++FWG+K+ GF+VLY ++K G  S+ E  DF+RE  ++E++ +K+  KLSK   N    G+  P W+  +  S+K +  H+EL++ +Q +IK V +Y +EQ    K  K+  + T +   +L   S  L ++R+ Y  R ++  +L +   +     +++++ E K KKA +  +  +EKYN+    F+ KML+S   FQ +E  HL  MK  +  ++  +     +  +    F++    ++V+ LL  F +SK TG+  P    FE   ++ ++    +++
Sbjct:    4 FGEHFWGEKNHGFEVLYHSVKQGPISTKELADFIRERATIEETYSKAMAKLSKLASNGTPMGTFAPLWEVFRVSSDKLALCHLELTRKLQDLIKDVLRYGEEQLKTHKKCKEEVVSTLDAVQVLSGVSQLLPKSRENYLNRCMDQERLRRESTSQ----KEMDKAETKTKKAAESLRRSVEKYNSARADFEQKMLDSALRFQAMEETHLRHMKALLGSYAHSVEDTHVQIGQVHEEFKQNIENVSVEMLLRKFAESKGTGREKPGPLDFEAYSAAALQEAMKRLR 284          

HSP 2 Score: 96.2857 bits (238), Expect = 1.859e-19
Identity = 81/325 (24.92%), Postives = 157/325 (48.31%), Query Frame = 2
Query: 2087 SNSTIESRKFSSIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDV-HTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTD---DSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSL-PPSIWNSDLGRASWRL-DLSTNQSS--IKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISG 3037
            +++ +E   F S   + +   P  + + S + +P+A AFTE V+A FR    ++P  +   +G+L ++FP  +++ F       +     + F L   + + + +P     + ++   +P+    ++   ++++  L + L       P + ++NV ++RY  +   RP G  + P+ +SA+WQ   TL + + + Y ++   T V      P+P    N +I         ++  G P     L P + WN +  R +WRL D+S    S  + + +   +GP TP PV  QF++EG+  SGV L++ G+ +R+S  K R  + 
Sbjct:  594 ASTALERPSFLSQTGHGVSRGPSPVVLGSQDALPIATAFTEYVHAYFR---GHSPSCLARVTGELTMTFPAGIVRVFSGTPPPPV-----LSFRLVHTTAIEHFQP-----NADLLFSDPSQSDPETKDFWLNMAALTEALQRQAEQNPTASYYNVVLLRYQFS---RP-GPQSVPLQLSAHWQCGATL-TQVSVEYGYRPGATAV------PTPLT--NVQI---------LLPVGEPVTNVRLQPAATWNLEEKRLTWRLPDVSEAGGSGRLSASWEPLSGPSTPSPVAAQFTSEGTTLSGVDLELVGSGYRMSLVKRRFATA 883          
BLAST of F-BAR domain only protein 2 vs. Ensembl Human
Match: FCHO1 (FCH and mu domain containing endocytic adaptor 1 [Source:HGNC Symbol;Acc:HGNC:29002])

HSP 1 Score: 156.377 bits (394), Expect = 3.037e-38
Identity = 83/285 (29.12%), Postives = 154/285 (54.04%), Query Frame = 2
Query:  158 FSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQ 1009
            F ++FWG+K+ GF+VLY ++K G  S+ E  DF+RE  ++E++ +K+  KLSK   N    G+  P W+  +  S+K +  H+EL++ +Q +IK V +Y +EQ    K  K+  + T +   +L   S  L ++R+ Y  R ++  +L +   +     +++++ E K KKA +  +  +EKYN+    F+ KML+S   FQ +E  HL  MK  +  ++  +     +  +    F++    ++V+ LL  F +SK TG+  P    FE   ++ ++    +++
Sbjct:    4 FGEHFWGEKNHGFEVLYHSVKQGPISTKELADFIRERATIEETYSKAMAKLSKLASNGTPMGTFAPLWEVFRVSSDKLALCHLELTRKLQDLIKDVLRYGEEQLKTHKKCKEEVVSTLDAVQVLSGVSQLLPKSRENYLNRCMDQERLRRESTSQ----KEMDKAETKTKKAAESLRRSVEKYNSARADFEQKMLDSALRFQAMEETHLRHMKALLGSYAHSVEDTHVQIGQVHEEFKQNIENVSVEMLLRKFAESKGTGREKPGPLDFEAYSAAALQEAMKRLR 284          

HSP 2 Score: 101.679 bits (252), Expect = 3.320e-21
Identity = 83/328 (25.30%), Postives = 160/328 (48.78%), Query Frame = 2
Query: 2087 SNSTIESRKFSSIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDV-HTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTD---DSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSL-PPSIWNSDLGRASWRL-DLSTNQSS--IKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            +++ +E   F S   + +   P  + + S + +P+A AFTE V+A FR    ++P  +   +G+L ++FP  +++ F       +     + F L   + + + +P     + ++   +P+    ++   ++++  L + L       P + ++NV ++RY  +   RP G  + P+ +SA+WQ   TL + + + Y ++   T V      P+P    N +I         ++  G P     L P + WN +  R +WRL D+S    S  + + +   +GP TP PV  QF++EG+  SGV L++ G+ +R+S  K R  +G Y+
Sbjct:  594 ASTALERPSFLSQTGHGVSRGPSPVVLGSQDALPIATAFTEYVHAYFR---GHSPSCLARVTGELTMTFPAGIVRVFSGTPPPPV-----LSFRLVHTTAIEHFQP-----NADLLFSDPSQSDPETKDFWLNMAALTEALQRQAEQNPTASYYNVVLLRYQFS---RP-GPQSVPLQLSAHWQCGATL-TQVSVEYGYRPGATAV------PTPLT--NVQI---------LLPVGEPVTNVRLQPAATWNLEEKRLTWRLPDVSEAGGSGRLSASWEPLSGPSTPSPVAAQFTSEGTTLSGVDLELVGSGYRMSLVKRRFATGMYL 886          
BLAST of F-BAR domain only protein 2 vs. Ensembl Human
Match: FCHO1 (FCH and mu domain containing endocytic adaptor 1 [Source:HGNC Symbol;Acc:HGNC:29002])

HSP 1 Score: 156.377 bits (394), Expect = 3.037e-38
Identity = 83/285 (29.12%), Postives = 154/285 (54.04%), Query Frame = 2
Query:  158 FSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQ 1009
            F ++FWG+K+ GF+VLY ++K G  S+ E  DF+RE  ++E++ +K+  KLSK   N    G+  P W+  +  S+K +  H+EL++ +Q +IK V +Y +EQ    K  K+  + T +   +L   S  L ++R+ Y  R ++  +L +   +     +++++ E K KKA +  +  +EKYN+    F+ KML+S   FQ +E  HL  MK  +  ++  +     +  +    F++    ++V+ LL  F +SK TG+  P    FE   ++ ++    +++
Sbjct:    4 FGEHFWGEKNHGFEVLYHSVKQGPISTKELADFIRERATIEETYSKAMAKLSKLASNGTPMGTFAPLWEVFRVSSDKLALCHLELTRKLQDLIKDVLRYGEEQLKTHKKCKEEVVSTLDAVQVLSGVSQLLPKSRENYLNRCMDQERLRRESTSQ----KEMDKAETKTKKAAESLRRSVEKYNSARADFEQKMLDSALRFQAMEETHLRHMKALLGSYAHSVEDTHVQIGQVHEEFKQNIENVSVEMLLRKFAESKGTGREKPGPLDFEAYSAAALQEAMKRLR 284          

HSP 2 Score: 101.679 bits (252), Expect = 3.320e-21
Identity = 83/328 (25.30%), Postives = 160/328 (48.78%), Query Frame = 2
Query: 2087 SNSTIESRKFSSIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDV-HTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTD---DSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSL-PPSIWNSDLGRASWRL-DLSTNQSS--IKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            +++ +E   F S   + +   P  + + S + +P+A AFTE V+A FR    ++P  +   +G+L ++FP  +++ F       +     + F L   + + + +P     + ++   +P+    ++   ++++  L + L       P + ++NV ++RY  +   RP G  + P+ +SA+WQ   TL + + + Y ++   T V      P+P    N +I         ++  G P     L P + WN +  R +WRL D+S    S  + + +   +GP TP PV  QF++EG+  SGV L++ G+ +R+S  K R  +G Y+
Sbjct:  594 ASTALERPSFLSQTGHGVSRGPSPVVLGSQDALPIATAFTEYVHAYFR---GHSPSCLARVTGELTMTFPAGIVRVFSGTPPPPV-----LSFRLVHTTAIEHFQP-----NADLLFSDPSQSDPETKDFWLNMAALTEALQRQAEQNPTASYYNVVLLRYQFS---RP-GPQSVPLQLSAHWQCGATL-TQVSVEYGYRPGATAV------PTPLT--NVQI---------LLPVGEPVTNVRLQPAATWNLEEKRLTWRLPDVSEAGGSGRLSASWEPLSGPSTPSPVAAQFTSEGTTLSGVDLELVGSGYRMSLVKRRFATGMYL 886          
BLAST of F-BAR domain only protein 2 vs. Ensembl Celegans
Match: fcho-1 (FCH domain Only (FCH stands for Fes/CIP4 homology domain) [Source:UniProtKB/TrEMBL;Acc:Q9TXS0])

HSP 1 Score: 131.339 bits (329), Expect = 8.789e-31
Identity = 79/284 (27.82%), Postives = 149/284 (52.46%), Query Frame = 2
Query:  146 ETLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQIN--VNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKS 991
            E L ++D+FWGDKH GF VL +N+K   ++ +E   F++E  S+ED   K+ N+   +++  + +  S+   W   K   E  +  H+ L +N+Q + + V KY ++    +K  K    Q     +L+  T+T L +A++ Y  R  E  K+ K    N    ++I ++E K+ +A ++YK  ++KY      F++KM +SC  FQ  +      ++ F+  F+ H  ++    ++    F+++ + L  D  +  F+K+KSTG   P   +FE++E+  + +
Sbjct:    4 EGLLYADHFWGDKHHGFQVLQENLKKSEETVAEVAQFVKERLSVEDEYVKAINRSVNKVSHYIQNGSSIDAMWLLTKGTMELMAEIHVMLVKNLQDLSREVLKYKEDVNRTRKELKQP--QVAEAVNLMQTTTTCLQKAKETYQHRCQELEKVKKETNVN---VKEISKVELKVARAREEYKSYVDKYELVREDFETKMSDSCKKFQTFDRSLYASIQQFMLLFANHSTEMSSASHQVAEQFKESIQHLNADEFVRKFVKTKSTGTEKPPRVLFEESENGQLPA 282          
BLAST of F-BAR domain only protein 2 vs. Ensembl Celegans
Match: fcho-1 (FCH domain Only (FCH stands for Fes/CIP4 homology domain) [Source:UniProtKB/TrEMBL;Acc:Q9TXS0])

HSP 1 Score: 101.679 bits (252), Expect = 1.476e-21
Identity = 68/266 (25.56%), Postives = 135/266 (50.75%), Query Frame = 2
Query:  200 VLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQIN--VNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKS 991
            VL +N+K   ++ +E   F++E  S+ED   K+ N+   +++  + +  S+   W   K   E  +  H+ L +N+Q + + V KY ++    +K  K    Q     +L+  T+T L +A++ Y  R  E  K+ K    N    ++I ++E K+ +A ++YK  ++KY      F++KM +SC  FQ  +      ++ F+  F+ H  ++    ++    F+++ + L  D  +  F+K+KSTG   P   +FE++E+  + +
Sbjct:    5 VLQENLKKSEETVAEVAQFVKERLSVEDEYVKAINRSVNKVSHYIQNGSSIDAMWLLTKGTMELMAEIHVMLVKNLQDLSREVLKYKEDVNRTRKELKQP--QVAEAVNLMQTTTTCLQKAKETYQHRCQELEKVKKETNVN---VKEISKVELKVARAREEYKSYVDKYELVREDFETKMSDSCKKFQTFDRSLYASIQQFMLLFANHSTEMSSASHQVAEQFKESIQHLNADEFVRKFVKTKSTGTEKPPRVLFEESENGQLPA 265          
BLAST of F-BAR domain only protein 2 vs. Ensembl Fly
Match: CG8176 (gene:FBgn0037702 transcript:FBtr0334650)

HSP 1 Score: 178.333 bits (451), Expect = 3.595e-45
Identity = 96/272 (35.29%), Postives = 160/272 (58.82%), Query Frame = 2
Query:  149 TLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFE 964
            T+ F+D FWG+K+ G+DVLY NMK G+ +S E  +FLRE  ++E+  +K  +KL+ +    +S +  P W  ++  +EK ST H+++ Q +  ++K V KY DE   K KS K+ + QT      +  ++  + + RD+Y ++  E  KL K   +NG+  +D E++E+KLKK  ++YK L++K+N    +F+ +M ++C  FQEIE  HL QMK+F+S +   L        +  + F++    ++VD LLE F+ +K TG   P+    E
Sbjct:    2 TVDFNDYFWGEKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAGTLNS-TFAPVWTILRTSAEKLSTLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEESQTLECVQAIQTSTVAVQKLRDLYASKVQELEKLRK---DNGSH-KDAEKLESKLKKLQEEYKALLDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKRQFVDMSVDKLLEQFVLNKYTGLEKPEMPELE 268          

HSP 2 Score: 112.079 bits (279), Expect = 1.352e-24
Identity = 90/310 (29.03%), Postives = 150/310 (48.39%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRR---NEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL-DLSTNQ-----SSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWE 3052
            P  L+I   + IPLA+AF E ++A FR S   +   V  SG +++SFP  +         N  N A+ + F +     L N+  +P  K +  QID     S S  ++ F +      LRR   N P + +FNVDI++Y V    +P G+ + P  + + W+     +S+  +  ++++ N  +AS +              P   V   V  +GS   +QS P S W  +  R  W   D+S N       +++++  L++GP TP  +  QF+ EG+  SG+  ++ G+ +R+S  K R +SG+YV E
Sbjct:  829 PSPLTIGISDTIPLAVAFHEIIHAYFRGS-DESRCQVKVSGDMMLSFPAGIAGLLA----NNPNPAK-LGFRIKHVQNLENL--VPNGKLV--QIDRQQSSSVSTMLE-FNMGALTALLRRQAENNPTASYFNVDILKYQV--RTKP-GASSCPFQLVSYWKCE---SSYTALKVDYKYNNHAMASAS--------------PLLNVTLSVPVNGSVRNVQSKPHSAWLGESNRLVWNFTDISQNSQDGGVGTLRARLELNDGPSTPALLATQFNCEGTTLSGIEFELQGSGYRLSLVKRRFVSGKYVCE 1107          
BLAST of F-BAR domain only protein 2 vs. Ensembl Fly
Match: CG8176 (gene:FBgn0037702 transcript:FBtr0082065)

HSP 1 Score: 178.333 bits (451), Expect = 3.595e-45
Identity = 96/272 (35.29%), Postives = 160/272 (58.82%), Query Frame = 2
Query:  149 TLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFE 964
            T+ F+D FWG+K+ G+DVLY NMK G+ +S E  +FLRE  ++E+  +K  +KL+ +    +S +  P W  ++  +EK ST H+++ Q +  ++K V KY DE   K KS K+ + QT      +  ++  + + RD+Y ++  E  KL K   +NG+  +D E++E+KLKK  ++YK L++K+N    +F+ +M ++C  FQEIE  HL QMK+F+S +   L        +  + F++    ++VD LLE F+ +K TG   P+    E
Sbjct:    2 TVDFNDYFWGEKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAGTLNS-TFAPVWTILRTSAEKLSTLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEESQTLECVQAIQTSTVAVQKLRDLYASKVQELEKLRK---DNGSH-KDAEKLESKLKKLQEEYKALLDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKRQFVDMSVDKLLEQFVLNKYTGLEKPEMPELE 268          

HSP 2 Score: 112.079 bits (279), Expect = 1.352e-24
Identity = 90/310 (29.03%), Postives = 150/310 (48.39%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRR---NEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL-DLSTNQ-----SSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWE 3052
            P  L+I   + IPLA+AF E ++A FR S   +   V  SG +++SFP  +         N  N A+ + F +     L N+  +P  K +  QID     S S  ++ F +      LRR   N P + +FNVDI++Y V    +P G+ + P  + + W+     +S+  +  ++++ N  +AS +              P   V   V  +GS   +QS P S W  +  R  W   D+S N       +++++  L++GP TP  +  QF+ EG+  SG+  ++ G+ +R+S  K R +SG+YV E
Sbjct:  829 PSPLTIGISDTIPLAVAFHEIIHAYFRGS-DESRCQVKVSGDMMLSFPAGIAGLLA----NNPNPAK-LGFRIKHVQNLENL--VPNGKLV--QIDRQQSSSVSTMLE-FNMGALTALLRRQAENNPTASYFNVDILKYQV--RTKP-GASSCPFQLVSYWKCE---SSYTALKVDYKYNNHAMASAS--------------PLLNVTLSVPVNGSVRNVQSKPHSAWLGESNRLVWNFTDISQNSQDGGVGTLRARLELNDGPSTPALLATQFNCEGTTLSGIEFELQGSGYRLSLVKRRFVSGKYVCE 1107          
BLAST of F-BAR domain only protein 2 vs. Ensembl Fly
Match: CG8176 (gene:FBgn0037702 transcript:FBtr0334651)

HSP 1 Score: 177.563 bits (449), Expect = 7.270e-45
Identity = 96/272 (35.29%), Postives = 160/272 (58.82%), Query Frame = 2
Query:  149 TLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFE 964
            T+ F+D FWG+K+ G+DVLY NMK G+ +S E  +FLRE  ++E+  +K  +KL+ +    +S +  P W  ++  +EK ST H+++ Q +  ++K V KY DE   K KS K+ + QT      +  ++  + + RD+Y ++  E  KL K   +NG+  +D E++E+KLKK  ++YK L++K+N    +F+ +M ++C  FQEIE  HL QMK+F+S +   L        +  + F++    ++VD LLE F+ +K TG   P+    E
Sbjct:    2 TVDFNDYFWGEKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAGTLNS-TFAPVWTILRTSAEKLSTLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEESQTLECVQAIQTSTVAVQKLRDLYASKVQELEKLRK---DNGSH-KDAEKLESKLKKLQEEYKALLDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKRQFVDMSVDKLLEQFVLNKYTGLEKPEMPELE 268          

HSP 2 Score: 112.464 bits (280), Expect = 1.150e-24
Identity = 90/310 (29.03%), Postives = 150/310 (48.39%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRR---NEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL-DLSTNQ-----SSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWE 3052
            P  L+I   + IPLA+AF E ++A FR S   +   V  SG +++SFP  +         N  N A+ + F +     L N+  +P  K +  QID     S S  ++ F +      LRR   N P + +FNVDI++Y V    +P G+ + P  + + W+     +S+  +  ++++ N  +AS +              P   V   V  +GS   +QS P S W  +  R  W   D+S N       +++++  L++GP TP  +  QF+ EG+  SG+  ++ G+ +R+S  K R +SG+YV E
Sbjct:  916 PSPLTIGISDTIPLAVAFHEIIHAYFRGS-DESRCQVKVSGDMMLSFPAGIAGLLA----NNPNPAK-LGFRIKHVQNLENL--VPNGKLV--QIDRQQSSSVSTMLE-FNMGALTALLRRQAENNPTASYFNVDILKYQV--RTKP-GASSCPFQLVSYWKCE---SSYTALKVDYKYNNHAMASAS--------------PLLNVTLSVPVNGSVRNVQSKPHSAWLGESNRLVWNFTDISQNSQDGGVGTLRARLELNDGPSTPALLATQFNCEGTTLSGIEFELQGSGYRLSLVKRRFVSGKYVCE 1194          
BLAST of F-BAR domain only protein 2 vs. Ensembl Fly
Match: CG8176 (gene:FBgn0037702 transcript:FBtr0113207)

HSP 1 Score: 177.563 bits (449), Expect = 7.270e-45
Identity = 96/272 (35.29%), Postives = 160/272 (58.82%), Query Frame = 2
Query:  149 TLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFE 964
            T+ F+D FWG+K+ G+DVLY NMK G+ +S E  +FLRE  ++E+  +K  +KL+ +    +S +  P W  ++  +EK ST H+++ Q +  ++K V KY DE   K KS K+ + QT      +  ++  + + RD+Y ++  E  KL K   +NG+  +D E++E+KLKK  ++YK L++K+N    +F+ +M ++C  FQEIE  HL QMK+F+S +   L        +  + F++    ++VD LLE F+ +K TG   P+    E
Sbjct:    2 TVDFNDYFWGEKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAGTLNS-TFAPVWTILRTSAEKLSTLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEESQTLECVQAIQTSTVAVQKLRDLYASKVQELEKLRK---DNGSH-KDAEKLESKLKKLQEEYKALLDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKRQFVDMSVDKLLEQFVLNKYTGLEKPEMPELE 268          

HSP 2 Score: 112.464 bits (280), Expect = 1.150e-24
Identity = 90/310 (29.03%), Postives = 150/310 (48.39%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRR---NEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL-DLSTNQ-----SSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWE 3052
            P  L+I   + IPLA+AF E ++A FR S   +   V  SG +++SFP  +         N  N A+ + F +     L N+  +P  K +  QID     S S  ++ F +      LRR   N P + +FNVDI++Y V    +P G+ + P  + + W+     +S+  +  ++++ N  +AS +              P   V   V  +GS   +QS P S W  +  R  W   D+S N       +++++  L++GP TP  +  QF+ EG+  SG+  ++ G+ +R+S  K R +SG+YV E
Sbjct:  916 PSPLTIGISDTIPLAVAFHEIIHAYFRGS-DESRCQVKVSGDMMLSFPAGIAGLLA----NNPNPAK-LGFRIKHVQNLENL--VPNGKLV--QIDRQQSSSVSTMLE-FNMGALTALLRRQAENNPTASYFNVDILKYQV--RTKP-GASSCPFQLVSYWKCE---SSYTALKVDYKYNNHAMASAS--------------PLLNVTLSVPVNGSVRNVQSKPHSAWLGESNRLVWNFTDISQNSQDGGVGTLRARLELNDGPSTPALLATQFNCEGTTLSGIEFELQGSGYRLSLVKRRFVSGKYVCE 1194          
BLAST of F-BAR domain only protein 2 vs. Ensembl Fly
Match: CG8176 (gene:FBgn0037702 transcript:FBtr0334652)

HSP 1 Score: 177.178 bits (448), Expect = 7.678e-45
Identity = 96/272 (35.29%), Postives = 160/272 (58.82%), Query Frame = 2
Query:  149 TLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFE 964
            T+ F+D FWG+K+ G+DVLY NMK G+ +S E  +FLRE  ++E+  +K  +KL+ +    +S +  P W  ++  +EK ST H+++ Q +  ++K V KY DE   K KS K+ + QT      +  ++  + + RD+Y ++  E  KL K   +NG+  +D E++E+KLKK  ++YK L++K+N    +F+ +M ++C  FQEIE  HL QMK+F+S +   L        +  + F++    ++VD LLE F+ +K TG   P+    E
Sbjct:    2 TVDFNDYFWGEKNNGYDVLYHNMKFGLIASKELSEFLREKSNIEEQNSKMMSKLAHKAGTLNS-TFAPVWTILRTSAEKLSTLHLQMVQKLTELVKDVAKYADELHKKHKSVKEEESQTLECVQAIQTSTVAVQKLRDLYASKVQELEKLRK---DNGSH-KDAEKLESKLKKLQEEYKALLDKHNPIKNEFERRMTQTCKRFQEIEEVHLRQMKEFLSTYLEMLQNNHDMVGQVHSDFKRQFVDMSVDKLLEQFVLNKYTGLEKPEMPELE 268          

HSP 2 Score: 112.079 bits (279), Expect = 1.308e-24
Identity = 90/310 (29.03%), Postives = 150/310 (48.39%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRR---NEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL-DLSTNQ-----SSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWE 3052
            P  L+I   + IPLA+AF E ++A FR S   +   V  SG +++SFP  +         N  N A+ + F +     L N+  +P  K +  QID     S S  ++ F +      LRR   N P + +FNVDI++Y V    +P G+ + P  + + W+     +S+  +  ++++ N  +AS +              P   V   V  +GS   +QS P S W  +  R  W   D+S N       +++++  L++GP TP  +  QF+ EG+  SG+  ++ G+ +R+S  K R +SG+YV E
Sbjct:  857 PSPLTIGISDTIPLAVAFHEIIHAYFRGS-DESRCQVKVSGDMMLSFPAGIAGLLA----NNPNPAK-LGFRIKHVQNLENL--VPNGKLV--QIDRQQSSSVSTMLE-FNMGALTALLRRQAENNPTASYFNVDILKYQV--RTKP-GASSCPFQLVSYWKCE---SSYTALKVDYKYNNHAMASAS--------------PLLNVTLSVPVNGSVRNVQSKPHSAWLGESNRLVWNFTDISQNSQDGGVGTLRARLELNDGPSTPALLATQFNCEGTTLSGIEFELQGSGYRLSLVKRRFVSGKYVCE 1135          
BLAST of F-BAR domain only protein 2 vs. Ensembl Zebrafish
Match: fcho2 (FCH and mu domain containing endocytic adaptor 2 [Source:NCBI gene;Acc:553949])

HSP 1 Score: 177.178 bits (448), Expect = 3.779e-45
Identity = 103/294 (35.03%), Postives = 161/294 (54.76%), Query Frame = 2
Query:  143 METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQKEST 1021
            M T  F +NFWGDK+ GF VLY NMK G  SS E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K+ +EK +  HMEL + +Q +IK VQKY+DEQ    K TK+    T      + + S  L+++++ Y  + LE  ++ K     G +  D+++   K+KKA + YK  +EKY    T+F+ +M E+   FQ IE  H+ +M++ I  +S  + +   +  E Q  F       +V++L+E   +SK TGK  P    FE+   S I ++  K +K  T
Sbjct:    1 MITPYFLENFWGDKNSGFYVLYHNMKHGQISSKELSDFIRERATIEEAYSRSMTKLAKTASNFSQLGTFAPVWDVFKQSTEKLAACHMELVRKLQELIKEVQKYVDEQAKNHKKTKEEVASTLEAVHNIQSVSQALLKSKENYINKTLEQERMRK----EGAKQGDLDKAGLKVKKATESYKSYVEKYATAKTEFEQRMTETAQKFQGIEEEHILRMQEIIHSYSLSVEETHIQIGEVQQEFVNNMENTSVESLIEKLAESKGTGKERPGPIEFEECNVS-IATEGAKPRKRKT 289          

HSP 2 Score: 125.561 bits (314), Expect = 7.199e-29
Identity = 89/305 (29.18%), Postives = 159/305 (52.13%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL----DLSTNQSS--IKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P  +++ S + +P+A+AFTE+VNA F+ +   +   V  +G + +SFP  +++ F S     +     + F L  ASRL  +  +P  + ++        ++   ++++  L   L       PA+ ++NVDI++Y V +N    G  + P+++   W+   +  + L ++Y +   N E      +P PA        P   V+ LV  +G    MQSLP +IWN++  ++ W+L    D S N+ S  +++KF LS GP  P  +  QF +EGS  SGV +++ G+ +R+S +K R  +GRY+
Sbjct:  550 PSPVTLASQDALPIAVAFTESVNAYFKGA-DPSKCIVKITGDMTLSFPSGIIKIFTSSPSPAV-----LSFKLLNASRLEQI--MPNQQLLHSDSSQSDTNTKDFWMNMPALTSFLRKSSEQNPAASYYNVDILKYQVCSN----GIQSTPLNLVVYWKCARS-TTDLRVDYRY---NPEA----MQP-PA--------PLTNVQVLVPVNGGVMNMQSLPNAIWNAEQNKSLWKLSDISDKSENEGSGSLRAKFELSEGPSIPATLAVQFFSEGSSLSGVDMELAGSGYRLSLNKKRFATGRYM 825          
BLAST of F-BAR domain only protein 2 vs. Ensembl Zebrafish
Match: fcho2 (FCH and mu domain containing endocytic adaptor 2 [Source:NCBI gene;Acc:553949])

HSP 1 Score: 176.792 bits (447), Expect = 5.746e-45
Identity = 103/294 (35.03%), Postives = 161/294 (54.76%), Query Frame = 2
Query:  143 METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQKEST 1021
            M T  F +NFWGDK+ GF VLY NMK G  SS E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K+ +EK +  HMEL + +Q +IK VQKY+DEQ    K TK+    T      + + S  L+++++ Y  + LE  ++ K     G +  D+++   K+KKA + YK  +EKY    T+F+ +M E+   FQ IE  H+ +M++ I  +S  + +   +  E Q  F       +V++L+E   +SK TGK  P    FE+   S I ++  K +K  T
Sbjct:    1 MITPYFLENFWGDKNSGFYVLYHNMKHGQISSKELSDFIRERATIEEAYSRSMTKLAKTASNFSQLGTFAPVWDVFKQSTEKLAACHMELVRKLQELIKEVQKYVDEQAKNHKKTKEEVASTLEAVHNIQSVSQALLKSKENYINKTLEQERMRK----EGAKQGDLDKAGLKVKKATESYKSYVEKYATAKTEFEQRMTETAQKFQGIEEEHILRMQEIIHSYSLSVEETHIQIGEVQQEFVNNMENTSVESLIEKLAESKGTGKERPGPIEFEECNVS-IATEGAKPRKRKT 289          

HSP 2 Score: 125.561 bits (314), Expect = 8.713e-29
Identity = 89/305 (29.18%), Postives = 159/305 (52.13%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL----DLSTNQSS--IKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P  +++ S + +P+A+AFTE+VNA F+ +   +   V  +G + +SFP  +++ F S     +     + F L  ASRL  +  +P  + ++        ++   ++++  L   L       PA+ ++NVDI++Y V +N    G  + P+++   W+   +  + L ++Y +   N E      +P PA        P   V+ LV  +G    MQSLP +IWN++  ++ W+L    D S N+ S  +++KF LS GP  P  +  QF +EGS  SGV +++ G+ +R+S +K R  +GRY+
Sbjct:  570 PSPVTLASQDALPIAVAFTESVNAYFKGA-DPSKCIVKITGDMTLSFPSGIIKIFTSSPSPAV-----LSFKLLNASRLEQI--MPNQQLLHSDSSQSDTNTKDFWMNMPALTSFLRKSSEQNPAASYYNVDILKYQVCSN----GIQSTPLNLVVYWKCARS-TTDLRVDYRY---NPEA----MQP-PA--------PLTNVQVLVPVNGGVMNMQSLPNAIWNAEQNKSLWKLSDISDKSENEGSGSLRAKFELSEGPSIPATLAVQFFSEGSSLSGVDMELAGSGYRLSLNKKRFATGRYM 845          
BLAST of F-BAR domain only protein 2 vs. Ensembl Zebrafish
Match: fcho2 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_30:35169667:35188100:-1 gene:ENSDARG00000112245.1 transcript:ENSDART00000165473.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:fcho2)

HSP 1 Score: 149.443 bits (376), Expect = 1.902e-39
Identity = 90/259 (34.75%), Postives = 144/259 (55.60%), Query Frame = 2
Query:  173 WGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPP 946
            +GDK+ GF VLY NMK G  SS E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K+ +EK +  HMEL + +Q +IK VQKY+DEQ    K TK+    T      + + S  L+++++ Y  + LE  ++ K     G +  D+++   K+KKA + YK  +EKY    T+F+ +M E+   FQ IE  H+ +M++ I  +S  + +   +  E Q  F       +V++L+E   +SK TGK  P
Sbjct:    2 FGDKNSGFYVLYHNMKHGQISSKELSDFIRERATIEEAYSRSMTKLAKTASNFSQLGTFAPVWDVFKQSTEKLAACHMELVRKLQELIKEVQKYVDEQAKNHKKTKEEVASTLEAVHNIQSVSQALLKSKENYINKTLEQERMRK----EGAKQGDLDKAGLKVKKATESYKSYVEKYATAKTEFEQRMTETAQKFQGIEEEHILRMQEIIHSYSLSVEETHIQIGEVQQEFVNNMENTSVESLIEKLAESKGTGKERP 256          
BLAST of F-BAR domain only protein 2 vs. Ensembl Zebrafish
Match: fcho1 (FCH and mu domain containing endocytic adaptor 1 [Source:NCBI gene;Acc:100913078])

HSP 1 Score: 156.377 bits (394), Expect = 3.205e-38
Identity = 91/278 (32.73%), Postives = 153/278 (55.04%), Query Frame = 2
Query:  176 GDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSS-GSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQT-QNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNK 1003
            G+K+ GFDVLY NMK G  ++ E  +F+RE  ++E++ +KS +KL+K  +  S  G+  P W   +  S+K +  H+EL + +  +I+ + KY DEQ    + TK+  + T +++ SL V     L + R+ YH++ +E  +L K     G   +++E+ E K KKA + +   IEK+N     F+ KM ES   FQ+IE  HL QMK  I  +S  +     +  +    F++    + ++ L++ F + K TGK  P    FE+  SS + S+++K
Sbjct:   13 GEKNAGFDVLYHNMKHGQIATKELAEFVRERAAIEETYSKSMSKLAKMASNGSPLGTFAPMWDVFRVSSDKLALCHLELMRKMNDLIRDINKYSDEQVKIHRKTKEEAIGTLESVQSLQVQNG-HLQKTREGYHSKCVELERLRK----EGVPQKELEKAELKCKKAAESFAGSIEKFNRAGGDFEQKMSESAQKFQDIEEAHLRQMKLLIKGYSHSIEDTHVQVGQVHEEFKQNVENIGIENLIQKFTEQKGTGKERPGPVGFEEYLSS-LASENSK 284          

HSP 2 Score: 81.2629 bits (199), Expect = 4.555e-15
Identity = 82/315 (26.03%), Postives = 144/315 (45.71%), Query Frame = 2
Query: 2126 PSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPI-HFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL-DLS-TNQS----SIKSKFMLSNGPGTPQP-VVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P+  +   P  +S+++ E  P+A A TE +NA FR    N    V  +G L +SFP  + + F +      N   P+  F L   SR+ +   LP  K +         D+   + ++  L   L       P + ++NV +++Y  ++         AP+ +SA  Q + T+              T V SL +   PA +  +++     V+ L+  D S   +Q  PP+ WN++  R  W+L +LS TN S    ++ + +     P  P P +  QF   G+  SG+ +++ G+R+R+S  K R  +G+Y+
Sbjct:  856 PARGLSRGPSPISLSAQESWPVAAAITEYINAYFRGGEHNR-CLVKITGDLTMSFPAGITRIFTA------NPNAPVLSFRLVNISRVDHF--LPNQKLLYSDPSQSDPDTKDFWFNMQALTLHLQREAELNPQASYYNVALLKYQASSQ----DPSRAPLLLSAECQRSGTV--------------TRV-SLDYHCCPATAPATQLT---SVQVLLPLDHSATDLQCQPPAAWNAEERRLLWKLANLSPTNHSKGSGTLCASWQCLEVPRGPAPSLAVQFVGSGASLSGLDVELVGSRYRMSLVKKRFATGKYM 1139          
BLAST of F-BAR domain only protein 2 vs. Ensembl Zebrafish
Match: fcho1 (FCH and mu domain containing endocytic adaptor 1 [Source:NCBI gene;Acc:100913078])

HSP 1 Score: 151.369 bits (381), Expect = 8.039e-37
Identity = 89/286 (31.12%), Postives = 154/286 (53.85%), Query Frame = 2
Query:  152 LTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQT-QNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNK 1003
            + F     G+K+ GFDVLY NMK G  ++ E  +F+RE  ++E++ +KS +KL+K   N +  G+  P W   +  S+K +  H+EL + +  +I+ + KY DEQ    + TK+  + T +++ SL V     L + R+ YH++ +E  +L K     G   +++E+ E K KKA + +   IEK+N     F+ KM ES   FQ+IE  HL QMK  I  +S  +     +  +    F++    + ++ L++ F + K TGK  P+  +  +   S + S+++K
Sbjct:    2 IHFFHTLQGEKNAGFDVLYHNMKHGQIATKELAEFVRERAAIEETYSKSMSKLAKMASNGSPLGTFAPMWDVFRVSSDKLALCHLELMRKMNDLIRDINKYSDEQVKIHRKTKEEAIGTLESVQSLQVQNG-HLQKTREGYHSKCVELERLRK----EGVPQKELEKAELKCKKAAESFAGSIEKFNRAGGDFEQKMSESAQKFQDIEEAHLRQMKLLIKGYSHSIEDTHVQVGQVHEEFKQNVENIGIENLIQKFTEQKGTGKERPEGPVGFEEYLSSLASENSK 282          

HSP 2 Score: 84.3445 bits (207), Expect = 5.378e-16
Identity = 81/325 (24.92%), Postives = 147/325 (45.23%), Query Frame = 2
Query: 2087 SNSTIESRKFSSIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPI-HFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLD---LSTNQSSIKSKFMLSNGPGTPQP-VVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            S   + S+  +  P+  +   P  +S+++ E  P+A A TE +NA FR    N    V  +G L +SFP  + + F +      N   P+  F L   SR+ +   LP  K +         D+   + ++  L   L       P + ++NV +++Y  ++   P+    AP+ +SA  Q + T+              T V SL +   PA +  +++     V+ L+  D S   +Q  PP+ WN++  R  W+LD     +   ++ + +     P  P P +  QF   G+  SG+ +++ G+R+R+S  K R  +G+Y+
Sbjct:  602 STCVLYSKMLNCAPAG-LSRGPSPISLSAQESWPVAAAITEYINAYFRGGEHNRCL-VKITGDLTMSFPAGITRIFTA------NPNAPVLSFRLVNISRVDHF--LPNQKLLYSDPSQSDPDTKDFWFNMQALTLHLQREAELNPQASYYNVALLKYQASSQ-DPS---RAPLLLSAECQRSGTV--------------TRV-SLDYHCCPATAPATQLT---SVQVLLPLDHSATDLQCQPPAAWNAEERRLLWKLDDLSCVSGSGTLCASWQCLEVPRGPAPSLAVQFVGSGASLSGLDVELVGSRYRMSLVKKRFATGKYM 894          
BLAST of F-BAR domain only protein 2 vs. Ensembl Xenopus
Match: fcho2 (FCH and mu domain containing endocytic adaptor 2 [Source:NCBI gene;Acc:100216087])

HSP 1 Score: 172.17 bits (435), Expect = 2.085e-43
Identity = 106/281 (37.72%), Postives = 158/281 (56.23%), Query Frame = 2
Query:  158 FSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQT----QNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDI 985
            F DNFWG+K+ GFDVLY NMK G  S+ E  +F+RE  ++E+  ++S NKL+K   N    G+  P W   K  +EK +  H+EL + +Q +IK VQKY +EQ    K TK+    T    QNI S+    +  L +A+D+Y+A+ LE  KL K     G  +++IE+   K KKA + YK  +EKY      F+ KM E+   FQ+IE  HL ++K+ I  +S  + +V  +  +    F      +TVD+LL+ F +SK TGK  P    FE+  ++ +
Sbjct:    6 FPDNFWGEKNSGFDVLYHNMKHGQISTKELSEFIRERSTIEEVYSRSMNKLAKSASNYTQLGTFGPVWDVFKTSTEKLAGCHLELVKKLQDLIKEVQKYGEEQLKSHKKTKEEVSGTLEAVQNIQSI----TQALHKAKDLYNAKCLEQEKLKK----EGAAAKEIEKAAIKTKKATESYKICVEKYAAAKLDFEQKMTETAQKFQDIEEAHLMRVKEIIESYSHSVSEVHIQIGQVHEDFINNMANITVDSLLQKFAESKGTGKERPGPIEFEECNTAVV 278          

HSP 2 Score: 122.094 bits (305), Expect = 1.154e-27
Identity = 94/353 (26.63%), Postives = 178/353 (50.42%), Query Frame = 2
Query: 2033 PPLPAKITPPRSASTVPFSNSTIESRKFS-----SIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFC--LSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQS------SIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWE 3052
            PPL +  +PP SAS +P + S+      +     + P+  I   P  +++ + + +P+A+A +E+VNA FR +   T   V  +G++ +SFP  +++ F S          P   C  L   SRL  +  LP ++ +        ++    ++++  +   L       P++ ++NVDI++Y V +N    G  + P++++  W+ T +  + + ++Y +   N E  ++     P+   N        V+ LV  DG    MQSLP +IWN++  +A W++ + + +S      S+++KF LS+GP  P  +  QF ++G   SGV +++ G  +R+S  K R  +G+Y+ E
Sbjct:  491 PPLTSNTSPPPSAS-LPRAESSSSISSSASISAANTPTFGISRGPSPVTLGNQDTLPVAVALSESVNAYFRGA-DPTKCIVKITGEMTVSFPSGIIKVFTSN-------PSPAVLCFRLKNTSRLEQI--LPNNQLLYSDPSQSDNNCKDFWMNMQAVTAYLKKSSEQNPSASYYNVDILKYQVLSN----GIQSTPLNLATYWKCTSS-TTDVRLDYKY---NPESMAM-----PSILSN--------VQVLVPVDGGVTSMQSLPSAIWNAEQMKALWKVSVISEKSENGGAGSLRAKFDLSDGPSNPSTLAVQFVSDGCTLSGVDIELVGTGYRLSLVKKRFGTGKYMAE 811          
BLAST of F-BAR domain only protein 2 vs. Ensembl Xenopus
Match: pak6 (p21 protein (Cdc42/Rac)-activated kinase 6 [Source:Xenbase;Acc:XB-GENE-960331])

HSP 1 Score: 167.548 bits (423), Expect = 8.830e-42
Identity = 92/270 (34.07%), Postives = 145/270 (53.70%), Query Frame = 2
Query:  158 FSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSS-GSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFE 964
            F ++FWGDK+ GF VLY NMK G  S  E  DF+RE  ++E+S +KS  KLSK ++  S  G+  P W+  +  S+K +  H+ELS+ +  +IK + +Y DEQ    K +KD    T     LL   S  L ++RD Y  +F E  +L +     G+  +++E+ E K +KA D  +  +EKYN    +F+ KML+S  +FQ+ E  HL  MK  ++ +S  +     +  +    F+     + V+ L+  F +S  TG   P+   +E
Sbjct:    4 FGEHFWGDKNSGFAVLYHNMKHGQLSVKELADFVRERAAIEESYSKSMQKLSKMVSSGSHLGTFAPMWEMFRVSSDKLALCHLELSKKLHDLIKDISRYGDEQIKMHKKSKDEMSGTLEAIQLLQCNSQMLQKSRDNYCTKFSEQERLRR----EGSLQKELEKAELKTRKAADSLRCSVEKYNAVRKEFEQKMLQSAQTFQDTEATHLRHMKRLVTAYSHSVEDTHVQIGQVHEEFKHNMENVAVEKLIRRFAESNGTGTDRPEPVEYE 269          

HSP 2 Score: 78.1814 bits (191), Expect = 5.029e-14
Identity = 82/329 (24.92%), Postives = 149/329 (45.29%), Query Frame = 2
Query: 2081 PFSNSTIESRKFSSIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFK-MQSLPPSIWNSDLGRASWRL--DLSTNQ----SSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            PFS     S   S  PS  I        + S E +P+A AFTE V+A F E  +     +  SG+L +SFP  +L+ F S     +     + F L   S + +  P   S+ +   +     +S   ++++  L   L  +     A+P++NV +++Y V  +    G   AP+++++ W+   + ++ L ++Y        +A L                  +V+ L+  D  PF  +QS PP+       R  W++  + + N+      I +++   + P  P   V QF++EGS  SGV +++ G+ +R+S  K R  +G+Y+
Sbjct:  623 PFSLGVGTSLGLSRGPSPVI--------LGSQESLPVAAAFTEYVHAVF-EGGALEGSSLRISGELTMSFPAGILRVFASTATPPV-----LSFRLIHTSHVEHFAP--NSELLFSDLSQSDPNSRDFWLNMPGLTSYLNNMAEQH-AAPYYNVTLLKYQVLKS----GISAAPLYLTSTWKCGPS-STDLCLDYR-----QNIAFLC-----------------DVQILLPLD-EPFSNLQSDPPARCAER--RLHWQIPHEPAGNEHDGWGRICARWQPLHAPSRPTSAVAQFTSEGSTLSGVDIELVGSGYRMSLVKKRFAAGKYL 904          
BLAST of F-BAR domain only protein 2 vs. Ensembl Xenopus
Match: fcho2 (FCH and mu domain containing endocytic adaptor 2 [Source:NCBI gene;Acc:100216087])

HSP 1 Score: 155.992 bits (393), Expect = 2.168e-38
Identity = 100/274 (36.50%), Postives = 154/274 (56.20%), Query Frame = 2
Query:  176 GDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQT----QNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDI 985
            G+K+ GFDVLY NMK G  S+ E  +F+RE  ++E+  ++S NKL+K  + N + +  P W   K  +EK +  H+EL + +Q +IK VQKY +EQ    K TK+    T    QNI S+    +  L +A+D+Y+A+ LE  KL K     G  +++IE+   K KKA + YK  +EKY      F+ KM E+   FQ+IE  HL ++K+ I  +S  + +V  +  +    F      +TVD+LL+ F +SK TGK  P    FE+  ++ +
Sbjct:    3 GEKNSGFDVLYHNMKHGQISTKELSEFIRERSTIEEVYSRSMNKLAKSAS-NYTQTFGPVWDVFKTSTEKLAGCHLELVKKLQDLIKEVQKYGEEQLKSHKKTKEEVSGTLEAVQNIQSI----TQALHKAKDLYNAKCLEQEKLKK----EGAAAKEIEKAAIKTKKATESYKICVEKYAAAKLDFEQKMTETAQKFQDIEEAHLMRVKEIIESYSHSVSEVHIQIGQVHEDFINNMANITVDSLLQKFAESKGTGKERPGPIEFEECNTAVV 267          

HSP 2 Score: 117.087 bits (292), Expect = 4.611e-26
Identity = 92/349 (26.36%), Postives = 175/349 (50.14%), Query Frame = 2
Query: 2033 PPLPAKITPPRSASTVPFSNSTIESRKFS-----SIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFC--LSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQS------SIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGR 3040
            PPL +  +PP SAS +P + S+      +     + P+  I   P  +++ + + +P+A+A +E+VNA FR +   T   V  +G++ +SFP  +++ F S          P   C  L   SRL  +  LP ++ +        ++    ++++  +   L       P++ ++NVDI++Y V +N    G  + P++++  W+ T +  + + ++Y +   N E  ++     P+   N        V+ LV  DG    MQSLP +IWN++  +A W++ + + +S      S+++KF LS+GP  P  +  QF ++G   SGV +++ G  +R+S  K R  +G+
Sbjct:  426 PPLTSNTSPPPSAS-LPRAESSSSISSSASISAANTPTFGISRGPSPVTLGNQDTLPVAVALSESVNAYFRGA-DPTKCIVKITGEMTVSFPSGIIKVFTSN-------PSPAVLCFRLKNTSRLEQI--LPNNQLLYSDPSQSDNNCKDFWMNMQAVTAYLKKSSEQNPSASYYNVDILKYQVLSN----GIQSTPLNLATYWKCTSS-TTDVRLDYKY---NPESMAM-----PSILSN--------VQVLVPVDGGVTSMQSLPSAIWNAEQMKALWKVSVISEKSENGGAGSLRAKFDLSDGPSNPSTLAVQFVSDGCTLSGVDIELVGTGYRLSLVKKRFGTGK 742          
BLAST of F-BAR domain only protein 2 vs. Ensembl Xenopus
Match: fcho2 (FCH and mu domain containing endocytic adaptor 2 [Source:NCBI gene;Acc:100216087])

HSP 1 Score: 155.606 bits (392), Expect = 3.973e-38
Identity = 100/274 (36.50%), Postives = 154/274 (56.20%), Query Frame = 2
Query:  176 GDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQT----QNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDI 985
            G+K+ GFDVLY NMK G  S+ E  +F+RE  ++E+  ++S NKL+K  + N + +  P W   K  +EK +  H+EL + +Q +IK VQKY +EQ    K TK+    T    QNI S+    +  L +A+D+Y+A+ LE  KL K     G  +++IE+   K KKA + YK  +EKY      F+ KM E+   FQ+IE  HL ++K+ I  +S  + +V  +  +    F      +TVD+LL+ F +SK TGK  P    FE+  ++ +
Sbjct:    3 GEKNSGFDVLYHNMKHGQISTKELSEFIRERSTIEEVYSRSMNKLAKSAS-NYTQTFGPVWDVFKTSTEKLAGCHLELVKKLQDLIKEVQKYGEEQLKSHKKTKEEVSGTLEAVQNIQSI----TQALHKAKDLYNAKCLEQEKLKK----EGAAAKEIEKAAIKTKKATESYKICVEKYAAAKLDFEQKMTETAQKFQDIEEAHLMRVKEIIESYSHSVSEVHIQIGQVHEDFINNMANITVDSLLQKFAESKGTGKERPGPIEFEECNTAVV 267          

HSP 2 Score: 117.472 bits (293), Expect = 4.167e-26
Identity = 91/347 (26.22%), Postives = 176/347 (50.72%), Query Frame = 2
Query: 2033 PPLPAKITPPRSASTVPFSNSTIESRKFS-----SIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQS------SIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGR 3040
            PPL +  +PP SAS +P + S+      +     + P+  I   P  +++ + + +P+A+A +E+VNA FR +   T   V  +G++ +SFP  +++ F S     +     + F L   SRL  +  LP ++ +        ++    ++++  +   L       P++ ++NVDI++Y V +N    G  + P++++  W+ T +  + + ++Y +   N E  ++     P+   N        V+ LV  DG    MQSLP +IWN++  +A W++ + + +S      S+++KF LS+GP  P  +  QF ++G   SGV +++ G  +R+S  K R  +G+
Sbjct:  484 PPLTSNTSPPPSAS-LPRAESSSSISSSASISAANTPTFGISRGPSPVTLGNQDTLPVAVALSESVNAYFRGA-DPTKCIVKITGEMTVSFPSGIIKVFTSNPSPAV-----LCFRLKNTSRLEQI--LPNNQLLYSDPSQSDNNCKDFWMNMQAVTAYLKKSSEQNPSASYYNVDILKYQVLSN----GIQSTPLNLATYWKCTSS-TTDVRLDYKY---NPESMAM-----PSILSN--------VQVLVPVDGGVTSMQSLPSAIWNAEQMKALWKVSVISEKSENGGAGSLRAKFDLSDGPSNPSTLAVQFVSDGCTLSGVDIELVGTGYRLSLVKKRFGTGK 800          
BLAST of F-BAR domain only protein 2 vs. Ensembl Xenopus
Match: fcho2 (FCH and mu domain containing endocytic adaptor 2 [Source:NCBI gene;Acc:100216087])

HSP 1 Score: 151.754 bits (382), Expect = 3.154e-37
Identity = 99/276 (35.87%), Postives = 152/276 (55.07%), Query Frame = 2
Query:  170 FWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQT----QNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDI 985
            F+     GFDVLY NMK G  S+ E  +F+RE  ++E+  ++S NKL+K  + N + +  P W   K  +EK +  H+EL + +Q +IK VQKY +EQ    K TK+    T    QNI S+    +  L +A+D+Y+A+ LE  KL K     G  +++IE+   K KKA + YK  +EKY      F+ KM E+   FQ+IE  HL ++K+ I  +S  + +V  +  +    F      +TVD+LL+ F +SK TGK  P    FE+  ++ +
Sbjct:    6 FYETHKHGFDVLYHNMKHGQISTKELSEFIRERSTIEEVYSRSMNKLAKSAS-NYTQTFGPVWDVFKTSTEKLAGCHLELVKKLQDLIKEVQKYGEEQLKSHKKTKEEVSGTLEAVQNIQSI----TQALHKAKDLYNAKCLEQEKLKK----EGAAAKEIEKAAIKTKKATESYKICVEKYAAAKLDFEQKMTETAQKFQDIEEAHLMRVKEIIESYSHSVSEVHIQIGQVHEDFINNMANITVDSLLQKFAESKGTGKERPGPIEFEECNTAVV 272          

HSP 2 Score: 112.464 bits (280), Expect = 9.001e-25
Identity = 87/347 (25.07%), Postives = 169/347 (48.70%), Query Frame = 2
Query: 2042 PAKITPPRSASTVPFSNSTIESRKFSSIPSN------TIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFC--LSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQS------SIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGR 3040
            PA+ T P S  ++      +   K ++          +I   P  +++ + + +P+A+A +E+VNA FR +   T   V  +G++ +SFP  +++ F S          P   C  L   SRL  +  LP ++ +        ++    ++++  +   L       P++ ++NVDI++Y V +N    G  + P++++  W+ T +  + + ++Y +   N E  ++     P+   N        V+ LV  DG    MQSLP +IWN++  +A W++ + + +S      S+++KF LS+GP  P  +  QF ++G   SGV +++ G  +R+S  K R  +G+
Sbjct:  351 PARPTTPLSVGSIVPPPRPVSRPKLTAAKLCGINEVVSISRGPSPVTLGNQDTLPVAVALSESVNAYFRGA-DPTKCIVKITGEMTVSFPSGIIKVFTSN-------PSPAVLCFRLKNTSRLEQI--LPNNQLLYSDPSQSDNNCKDFWMNMQAVTAYLKKSSEQNPSASYYNVDILKYQVLSN----GIQSTPLNLATYWKCTSS-TTDVRLDYKY---NPESMAM-----PSILSN--------VQVLVPVDGGVTSMQSLPSAIWNAEQMKALWKVSVISEKSENGGAGSLRAKFDLSDGPSNPSTLAVQFVSDGCTLSGVDIELVGTGYRLSLVKKRFGTGK 666          
BLAST of F-BAR domain only protein 2 vs. Ensembl Mouse
Match: Fcho2 (FCH domain only 2 [Source:MGI Symbol;Acc:MGI:3505790])

HSP 1 Score: 164.081 bits (414), Expect = 1.109e-44
Identity = 96/275 (34.91%), Postives = 150/275 (54.55%), Query Frame = 2
Query:  158 FSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESS 979
            F +NFWG+K+ GFDVLY NMK G  S+ E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K  +EK +  H++L + +Q +IK VQKY +EQ    K TK+    T      + N +  L ++++ Y A+ +E  +L K     G   R+IE+   K KKA D YK  +EKY  T   F+ KM E+   FQ+IE  HL  +K+ I   S  + ++  +  +    F       T+++L++ F +SK TGK  P    FE+ + +
Sbjct:    6 FVENFWGEKNNGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGTFAPMWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQAIQNITQALQKSKENYTAKCVEQERLKK----EGATQREIEKAAVKSKKATDTYKLYVEKYALTKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAVKEIHLQIGQVHEEFINNMANTTIESLIQKFAESKGTGKERPGLIEFEECDPA 276          
BLAST of F-BAR domain only protein 2 vs. Ensembl Mouse
Match: Fcho2 (FCH domain only 2 [Source:MGI Symbol;Acc:MGI:3505790])

HSP 1 Score: 174.866 bits (442), Expect = 2.027e-44
Identity = 96/273 (35.16%), Postives = 149/273 (54.58%), Query Frame = 2
Query:  158 FSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAE 973
            F +NFWG+K+ GFDVLY NMK G  S+ E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K  +EK +  H++L + +Q +IK VQKY +EQ    K TK+    T      + N +  L ++++ Y A+ +E  +L K     G   R+IE+   K KKA D YK  +EKY  T   F+ KM E+   FQ+IE  HL  +K+ I   S  + ++  +  +    F       T+++L++ F +SK TGK  P    FE+ +
Sbjct:    6 FVENFWGEKNNGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGTFAPMWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQAIQNITQALQKSKENYTAKCVEQERLKK----EGATQREIEKAAVKSKKATDTYKLYVEKYALTKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAVKEIHLQIGQVHEEFINNMANTTIESLIQKFAESKGTGKERPGLIEFEECD 274          

HSP 2 Score: 126.716 bits (317), Expect = 3.646e-29
Identity = 92/316 (29.11%), Postives = 164/316 (51.90%), Query Frame = 2
Query: 2126 PSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDI---NIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQS------SIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P+  +   P  +S+ + + +P+AIA TE+VNA F+ +   T   V  +G + ISFP  +++ F S     +     + F +   SRL  +  LP S+ +     Q D+ T D    ++++  +   L  L    PA+ ++NVD+++Y V++N    G  + P++++  W+ + +  + L ++Y +  P   VA       P+   N        ++ +V  DG    MQSLPP+IWN++  +A W+L   + +S      S+++KF LS GP  P  +  QF +EG+  SGV +++ G  +R+S  K R  +GRY+
Sbjct:  523 PTVGVSRGPSPVSLGNQDTLPVAIALTESVNAYFKGA-DPTKCIVKITGDVTISFPSGIIKVFTSNPSPAV-----LCFRVKNISRLEQI--LPNSQLVFSDPSQCDSNTKD---FWMNMQAVTIYLKKLSEQNPAASYYNVDVLKYQVSSN----GIQSTPLNLATYWKCSAS-TTDLRVDYKYN-PEAMVA-------PSVLSN--------IQVVVPVDGGVTNMQSLPPAIWNAEQMKAFWKLSGISEKSDSGGSGSLRAKFDLSEGPSKPTTLAVQFLSEGNTLSGVDIELVGTGYRLSLVKKRFATGRYL 806          
BLAST of F-BAR domain only protein 2 vs. Ensembl Mouse
Match: Fcho2 (FCH domain only 2 [Source:MGI Symbol;Acc:MGI:3505790])

HSP 1 Score: 166.777 bits (421), Expect = 2.661e-44
Identity = 96/275 (34.91%), Postives = 150/275 (54.55%), Query Frame = 2
Query:  158 FSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESS 979
            F +NFWG+K+ GFDVLY NMK G  S+ E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K  +EK +  H++L + +Q +IK VQKY +EQ    K TK+    T      + N +  L ++++ Y A+ +E  +L K     G   R+IE+   K KKA D YK  +EKY  T   F+ KM E+   FQ+IE  HL  +K+ I   S  + ++  +  +    F       T+++L++ F +SK TGK  P    FE+ + +
Sbjct:    6 FVENFWGEKNNGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGTFAPMWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQAIQNITQALQKSKENYTAKCVEQERLKK----EGATQREIEKAAVKSKKATDTYKLYVEKYALTKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAVKEIHLQIGQVHEEFINNMANTTIESLIQKFAESKGTGKERPGLIEFEECDPA 276          
BLAST of F-BAR domain only protein 2 vs. Ensembl Mouse
Match: Fcho2 (FCH domain only 2 [Source:MGI Symbol;Acc:MGI:3505790])

HSP 1 Score: 166.777 bits (421), Expect = 2.999e-44
Identity = 96/275 (34.91%), Postives = 150/275 (54.55%), Query Frame = 2
Query:  158 FSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESS 979
            F +NFWG+K+ GFDVLY NMK G  S+ E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K  +EK +  H++L + +Q +IK VQKY +EQ    K TK+    T      + N +  L ++++ Y A+ +E  +L K     G   R+IE+   K KKA D YK  +EKY  T   F+ KM E+   FQ+IE  HL  +K+ I   S  + ++  +  +    F       T+++L++ F +SK TGK  P    FE+ + +
Sbjct:    6 FVENFWGEKNNGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGTFAPMWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQAIQNITQALQKSKENYTAKCVEQERLKK----EGATQREIEKAAVKSKKATDTYKLYVEKYALTKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAVKEIHLQIGQVHEEFINNMANTTIESLIQKFAESKGTGKERPGLIEFEECDPA 276          
BLAST of F-BAR domain only protein 2 vs. Ensembl Mouse
Match: Fcho2 (FCH domain only 2 [Source:MGI Symbol;Acc:MGI:3505790])

HSP 1 Score: 166.777 bits (421), Expect = 3.761e-44
Identity = 96/275 (34.91%), Postives = 150/275 (54.55%), Query Frame = 2
Query:  158 FSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESS 979
            F +NFWG+K+ GFDVLY NMK G  S+ E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K  +EK +  H++L + +Q +IK VQKY +EQ    K TK+    T      + N +  L ++++ Y A+ +E  +L K     G   R+IE+   K KKA D YK  +EKY  T   F+ KM E+   FQ+IE  HL  +K+ I   S  + ++  +  +    F       T+++L++ F +SK TGK  P    FE+ + +
Sbjct:    6 FVENFWGEKNNGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGTFAPMWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQAIQNITQALQKSKENYTAKCVEQERLKKE----GATQREIEKAAVKSKKATDTYKLYVEKYALTKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAVKEIHLQIGQVHEEFINNMANTTIESLIQKFAESKGTGKERPGLIEFEECDPA 276          
BLAST of F-BAR domain only protein 2 vs. UniProt/SwissProt
Match: sp|D3ZYR1|FCHO2_RAT (F-BAR domain only protein 2 OS=Rattus norvegicus OX=10116 GN=Fcho2 PE=1 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 8.600e-44
Identity = 96/273 (35.16%), Postives = 150/273 (54.95%), Query Frame = 2
Query:  158 FSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAE 973
            F +NFWG+K+ GFDVLY NMK G  S+ E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K  +EK +  H++L + +Q +IK VQKY +EQ    K TK+    T      + N +  L ++++ Y+A+ +E  +L K     G   R+IE+   K KKA D YK  +EKY  T   F+ KM E+   FQ+IE  HL  +K+ I   S  + ++  +  +    F       T+++L++ F +SK TGK  P    FE+ +
Sbjct:    6 FVENFWGEKNNGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGTFAPVWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQAIQNITQALQKSKENYNAKCVEQERLKK----EGATPREIEKAAVKSKKATDTYKLYVEKYALTKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIGQVHEEFINNMANTTIESLIQKFAESKGTGKERPGLIEFEECD 274          

HSP 2 Score: 126.716 bits (317), Expect = 2.400e-28
Identity = 92/316 (29.11%), Postives = 164/316 (51.90%), Query Frame = 2
Query: 2126 PSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDI---NIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQS------SIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P+  +   P  +S+ + + +P+AIA TE+VNA F+ +   T   V  +G + ISFP  +++ F S     +     + F +   SRL  +  LP S+ +     Q D+ T D    ++++  +   L  L    PA+ ++NVD+++Y V++N    G  + P++++  W+ + +  + L ++Y +  P   VA       P+   N        ++ +V  DG    MQSLPP+IWN++  +A W+L   + +S      S+++KF LS GP  P  +  QF +EG+  SGV +++ G  +R+S  K R  +GRY+
Sbjct:  523 PTVGVSRGPSPVSLGNQDTLPVAIALTESVNAYFKGA-DPTKCIVKITGDVTISFPSGIIKVFTSNPSPAV-----LCFRVKNISRLEQI--LPNSQLVFSDPSQCDSNTKD---FWMNMQAVTVYLKKLSEQNPAASYYNVDVLKYQVSSN----GIQSTPLNLATYWKCSAS-TTDLRVDYKYN-PEAMVA-------PSVLSN--------IQVVVPVDGGVTNMQSLPPAIWNAEQMKAFWKLSGISEKSDSGGSGSLRAKFDLSEGPSKPATLAVQFLSEGNTLSGVDIELVGTGYRLSLVKKRFATGRYL 806          
BLAST of F-BAR domain only protein 2 vs. UniProt/SwissProt
Match: sp|Q3UQN2|FCHO2_MOUSE (F-BAR domain only protein 2 OS=Mus musculus OX=10090 GN=Fcho2 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 1.418e-43
Identity = 96/273 (35.16%), Postives = 149/273 (54.58%), Query Frame = 2
Query:  158 FSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAE 973
            F +NFWG+K+ GFDVLY NMK G  S+ E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K  +EK +  H++L + +Q +IK VQKY +EQ    K TK+    T      + N +  L ++++ Y A+ +E  +L K     G   R+IE+   K KKA D YK  +EKY  T   F+ KM E+   FQ+IE  HL  +K+ I   S  + ++  +  +    F       T+++L++ F +SK TGK  P    FE+ +
Sbjct:    6 FVENFWGEKNNGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGTFAPMWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQAIQNITQALQKSKENYTAKCVEQERLKK----EGATQREIEKAAVKSKKATDTYKLYVEKYALTKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAVKEIHLQIGQVHEEFINNMANTTIESLIQKFAESKGTGKERPGLIEFEECD 274          

HSP 2 Score: 126.716 bits (317), Expect = 2.551e-28
Identity = 92/316 (29.11%), Postives = 164/316 (51.90%), Query Frame = 2
Query: 2126 PSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDI---NIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQS------SIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P+  +   P  +S+ + + +P+AIA TE+VNA F+ +   T   V  +G + ISFP  +++ F S     +     + F +   SRL  +  LP S+ +     Q D+ T D    ++++  +   L  L    PA+ ++NVD+++Y V++N    G  + P++++  W+ + +  + L ++Y +  P   VA       P+   N        ++ +V  DG    MQSLPP+IWN++  +A W+L   + +S      S+++KF LS GP  P  +  QF +EG+  SGV +++ G  +R+S  K R  +GRY+
Sbjct:  523 PTVGVSRGPSPVSLGNQDTLPVAIALTESVNAYFKGA-DPTKCIVKITGDVTISFPSGIIKVFTSNPSPAV-----LCFRVKNISRLEQI--LPNSQLVFSDPSQCDSNTKD---FWMNMQAVTIYLKKLSEQNPAASYYNVDVLKYQVSSN----GIQSTPLNLATYWKCSAS-TTDLRVDYKYN-PEAMVA-------PSVLSN--------IQVVVPVDGGVTNMQSLPPAIWNAEQMKAFWKLSGISEKSDSGGSGSLRAKFDLSEGPSKPTTLAVQFLSEGNTLSGVDIELVGTGYRLSLVKKRFATGRYL 806          
BLAST of F-BAR domain only protein 2 vs. UniProt/SwissProt
Match: sp|Q5R807|FCHO2_PONAB (F-BAR domain only protein 2 OS=Pongo abelii OX=9601 GN=FCHO2 PE=2 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 1.603e-43
Identity = 97/280 (34.64%), Postives = 153/280 (54.64%), Query Frame = 2
Query:  143 METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESS 979
            M    F +NFWG+K+ GFDVLY NMK G  S+ E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K  +EK +  H++L + +Q +IK VQKY +EQ    K TK+    T      + +T+  L ++++ Y+A+ +E  +L K     G   R+IE+   K KKA D YK  +EKY      F+ KM E+   FQ+IE  HL  +K+ I   S  + ++  +  +    F       TV++L++ F +SK TGK  P    FE+ +++
Sbjct:    1 MVMAYFVENFWGEKNSGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGTFAPVWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQTIQSTTQALQKSKENYNAKCVEQERLKK----EGATQREIEKAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEVIGSLSNAIKEIHLQIGQVHEEFINNMANTTVESLIQKFAESKGTGKERPGLIEFEECDTA 276          

HSP 2 Score: 126.716 bits (317), Expect = 2.304e-28
Identity = 90/316 (28.48%), Postives = 163/316 (51.58%), Query Frame = 2
Query: 2126 PSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDI---NIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQS------SIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P+  +   P  +S+ + + +P+A+A TE+VNA F+ +   T   V  +G + +SFP  +++ F S     +     + F +   SRL  +  LP ++ +     Q D+ T D    ++++  +   L  L    PA+ ++NVD+++Y V++N    G  + P++++  W+ + +  + L ++Y +  P   VA       P+   N        ++ +V  DG    MQSLPP+IWN++  +A W+L   + +S      S+++KF LS GP  P  +  QF +EGS  SGV  ++ G  +R+S  K R  +GRY+
Sbjct:  524 PTVGVSRGPSPVSLGNQDTLPVAVALTESVNAYFKGA-DPTKCIVKITGDMTMSFPSGIIKVFTSNPTPAV-----LCFRVKNISRLEQI--LPNAQLVFSDPSQCDSNTKD---FWMNMQAVTVYLKKLSEQNPAASYYNVDVLKYQVSSN----GIQSTPLNLATYWKCSAS-TTDLRVDYKYN-PEAMVA-------PSVLSN--------IQVVVPVDGGVMNMQSLPPAIWNAEQMKAFWKLSSISEKSENGGSGSLRAKFDLSEGPSKPTTLAVQFLSEGSTLSGVDFELVGTGYRLSLIKKRFATGRYL 807          
BLAST of F-BAR domain only protein 2 vs. UniProt/SwissProt
Match: sp|Q502I9|FCHO2_DANRE (F-BAR domain only protein 2 OS=Danio rerio OX=7955 GN=fcho2 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 3.924e-43
Identity = 101/294 (34.35%), Postives = 161/294 (54.76%), Query Frame = 2
Query:  143 METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQKEST 1021
            M T  F +NFWG+K+ GF VLY NMK G  SS E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K+ +EK +  HMEL + +Q +IK VQKY+DEQ    K TK+    T      + + S  L+++++ Y  + LE  ++ K     G +  D+++   K+KKA + YK  +EKY    T+F+ +M E+   FQ IE  H+ +M++ I  +S  + +   +  E Q  F       +V++L+E   +S+ TGK  P    FE+   S I ++  K +K  T
Sbjct:    1 MITPYFLENFWGNKNSGFYVLYHNMKHGQISSKELSDFIRERATIEEAYSRSMTKLAKTASNFSQLGTFAPVWDVFKQSTEKLAACHMELVRKLQELIKEVQKYVDEQAKNHKKTKEEVASTLEAVHNIQSVSQALLKSKENYINKTLEQERMRK----EGAKQGDLDKAGLKVKKATESYKSYVEKYATAKTEFEQRMTETAQKFQGIEEEHILRMQEIIHSYSLSVEETHIQIGEVQQEFVNNMENTSVESLIEKLAESRGTGKERPGPIEFEECNVS-IATEGAKPRKRKT 289          

HSP 2 Score: 125.561 bits (314), Expect = 5.581e-28
Identity = 89/305 (29.18%), Postives = 160/305 (52.46%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL----DLSTNQSS--IKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P  +++ S + +P+A+AFTE+VNA F+ +   +   V  +G + +SFP  +++ F S     +     + F L  ASRL  +  +P  + ++        ++   ++++  L   L       PA+ ++NVDI++Y V +N    G  + P+++   W+ + +  + L ++Y +   N E      +P PA        P   V+ LV  +G    MQSLP +IWN++  ++ W+L    D S N+ S  +++KF LS GP  P  +  QF +EGS  SGV +++ G+ +R+S +K R  +GRY+
Sbjct:  570 PSPVTLASQDALPIAVAFTESVNAYFKGA-DPSKCIVKITGDMTLSFPSGIIKIFTSSPSPAV-----LSFKLLNASRLEQI--MPNQQLLHSDSSQSDTNTKDFWMNMPALTSFLRKSSEQNPAASYYNVDILKYQVCSN----GIQSTPLNLVVYWKCSRS-TTDLRVDYRY---NPEA----MQP-PA--------PLTNVQVLVPVNGGVMNMQSLPNAIWNAEQNKSLWKLSDISDKSENEGSGSLRAKFELSEGPSIPATLAVQFFSEGSSLSGVDMELAGSGYRLSLNKKRFATGRYM 845          
BLAST of F-BAR domain only protein 2 vs. UniProt/SwissProt
Match: sp|Q0JRZ9|FCHO2_HUMAN (F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2 PE=1 SV=2)

HSP 1 Score: 172.94 bits (437), Expect = 5.539e-43
Identity = 96/280 (34.29%), Postives = 152/280 (54.29%), Query Frame = 2
Query:  143 METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESS 979
            M    F +NFWG+K+ GFDVLY NMK G  S+ E  DF+RE  ++E++ ++S  KL+K   N +  G+  P W   K  +EK +  H++L + +Q +IK VQKY +EQ    K TK+    T      + + +  L ++++ Y+A+ +E  +L K     G   R+IE+   K KKA D YK  +EKY      F+ KM E+   FQ+IE  HL  +K+ I   S  + ++  +  +    F       TV++L++ F +SK TGK  P    FE+ +++
Sbjct:    1 MVMAYFVENFWGEKNSGFDVLYHNMKHGQISTKELADFVRERATIEEAYSRSMTKLAKSASNYSQLGTFAPVWDVFKTSTEKLANCHLDLVRKLQELIKEVQKYGEEQVKSHKKTKEEVAGTLEAVQTIQSITQALQKSKENYNAKCVEQERLKK----EGATQREIEKAAVKSKKATDTYKLYVEKYALAKADFEQKMTETAQKFQDIEETHLIHIKEIIGSLSNAIKEIHLQIGQVHEEFINNMANTTVESLIQKFAESKGTGKERPGLIEFEECDTA 276          

HSP 2 Score: 125.946 bits (315), Expect = 4.732e-28
Identity = 90/316 (28.48%), Postives = 163/316 (51.58%), Query Frame = 2
Query: 2126 PSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDI---NIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQS------SIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P+  +   P  +S+ + + +P+A+A TE+VNA F+ +   T   V  +G + +SFP  +++ F S     +     + F +   SRL  +  LP ++ +     Q D+ T D    ++++  +   L  L    PA+ ++NVD+++Y V++N    G  + P++++  W+ + +  + L ++Y +  P   VA       P+   N        ++ +V  DG    MQSLPP+IWN++  +A W+L   + +S      S+++KF LS GP  P  +  QF +EGS  SGV  ++ G  +R+S  K R  +GRY+
Sbjct:  524 PTVGVSRGPSPVSLGNQDTLPVAVALTESVNAYFKGA-DPTKCIVKITGDMTMSFPSGIIKVFTSNPTPAV-----LCFRVKNISRLEQI--LPNAQLVFSDPSQCDSNTKD---FWMNMQAVTVYLKKLSEQNPAASYYNVDVLKYQVSSN----GIQSTPLNLATYWKCSAS-TTDLRVDYKYN-PEAMVA-------PSVLSN--------IQVVVPVDGGVTNMQSLPPAIWNAEQMKAFWKLSSISEKSENGGSGSLRAKFDLSEGPSKPTTLAVQFLSEGSTLSGVDFELVGTGYRLSLIKKRFATGRYL 807          
BLAST of F-BAR domain only protein 2 vs. TrEMBL
Match: A0A224Z5G6 (Proline serine threonine phosphatase interacting protein pstpip OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 1.770e-76
Identity = 269/1002 (26.85%), Postives = 445/1002 (44.41%), Query Frame = 2
Query:  149 TLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQKESTDILTD----PSLNGNHIGDVITGNLVNXXXXXXXXXTHVSNVNITTPNAKDSINDIFDQLS-NISDNNSINQTTVSHIDGGTVSIPIKKQKKYNNIFRRKRNSPSNGVTQKQLQDTDKEKSSQSLGEYMVDDEGYTIKP-NDPWPXXXXXXXXXXXXXXXXXXXIFKAIKIEIKPKDNKSDSSSIPDNDLPIKAKSKNNDNLELFKAVQAFKISPNIFRDGNRRTGDSRSNTP-SLPNVLA-----DDGSPPTSTRLNSISVSIRD-SRRKKNSRSQSEQAQSLAQPYFQVEFTNSFESNGLDLAGVTSDPFNSRFESFQSSKADLPLKTNENKIDPWGSSTVNDKSIQPPPLPAKITPPRSASTVPFSNSTIESRKFSSIPSNTIPA----TPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNF-----QWPNTEVASLTFRPS---PAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLD-------LSTNQSSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWEP 3055
            T+ F D FWG+K+ GFDVLY NMK G  ++ +  +F RE   +E+S +K  +KL++Q     S+G+  P W  ++  SEK S+ H ++   +Q +++ VQ+Y +EQ  + K  K+ +  T  +   L  T+  L +AR+ Y AR LE  KL +      +  +D+++ EAK +KA ++Y+ L+E++      F+ +M  SC  FQE+E  HL+ MK+F++ ++  L        +    F +    L +D LL  F  ++ TG   P+   FE+ + S   +  N     S    T     PS +G+  G V+  +     +++   S+  +N     P A  +  + F +            +  +S  D  T S                              + D ++S +   E  VD+EGYT++P ++   +++++S   SS  D + ++  + I IEIKP  N +  S+  D               EL   + +  +SP I +   RR  +S S+TP   P   A     D     + T  + + +   D S     +R QS   Q   +P  Q   + S  S   D     SD FN +  +  SS       T      P  +S     ++  PP          AS +P S +       S   +  +P      P  L+I   + IPLA+AF E V+A+FR +   T   V   G + +SFP  ++     V  N  + A  + F ++ A R  NV  LP    I +     T D      ++  L   L       P++ +FN+DI++Y V       G+ +AP+H+ A W+ T    + L I+Y +       P    A+   +P+   PA S    + P   +   V  DG    +Q+ PP IWN +  RA WRL              S+ ++F L+ GP TP+P+  +F  EG+  SG   ++ G  +R+S  K +++SG+Y+ EP
Sbjct:    2 TVDFRDYFWGEKNNGFDVLYHNMKYGYLAAKDLAEFFRERSLVEESHSKLLSKLARQAAGSCSTGTFGPLWGVLRSTSEKLSSLHAQMVAQLQDLVREVQRYCEEQHRRHKQVKEEEAPTLEVVQGLQQTTGALAKAREAYAARCLELEKLKRE-----SSPKDLDKAEAKARKACEEYRQLVERHGVVRADFERRMAGSCQRFQELEVGHLQHMKEFLAGYARVLDSSHALVGQVHAEFRQQCDALDIDALLRQFASARQTGSEKPEAITFEEPDPSLQLTPTNAASTGSPPFFTTSTPAPSASGSENGPVLPADFCPASAAAAAPSSAATN----GPQAPAAKKEGFLRTKWERQKEKRKRKKEMSSKDASTTS-----------------------------GEADSKESEEQNAE--VDEEGYTVRPSSERHKENDRDSFYSSSDGDSDDEDRDRRIHIEIKPLSNGAPMSASVD---------------ELRATIGSLSLSP-IPQHSARRAYNSASSTPDEAPKRPANQSSKDSAGIGSGTEADMLGLFPLDTSASTPTTRLQSPLGQ--GEPASQPSASGSVPS--WDRYAALSDLFNDKAPAESSSSEASKGATTSRGGTP--TSAFTGPALPRPPSRRSEAVRGRASPLPMSRTESVGSLSSDFKTTPMPLGSSRGPSPLTIGLCDSIPLAVAFQEVVHARFRGT-DETLCQVKLLGDMKVSFPAGIVH----VLTNNPSPAA-LTFRVNTA-RFDNV--LPNKNLITLDASQSTSDRCVYEFNMSVLTGLLRRQHEQTPSASYFNIDILKYHVRAG---PGARSAPLHLVAFWK-TQEDNTDLKIDYEYNAKALSLPAGTGATGVGQPASSNPAPSAPG-LPPLTGLCLGVPMDGGVTSVQAKPPCIWNGETQRALWRLSDPLGGTAGGQRGGSLLARFALTRGPSTPRPLEARFLCEGATLSGASFELIGQGYRVSLVKRQILSGKYLCEP 927          
BLAST of F-BAR domain only protein 2 vs. TrEMBL
Match: A0A183AXU1 (F-BAR domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS11776 PE=4 SV=1)

HSP 1 Score: 231.491 bits (589), Expect = 4.693e-62
Identity = 118/288 (40.97%), Postives = 181/288 (62.85%), Query Frame = 2
Query:  143 METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINV---NSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQD 997
            ME   F+ NFWG+K+ GFDVLYQN+K   +S+SEF +F+R+  S+ED+  KS  KL+KQ      NS  S +P W  +++L E+    H+  +Q+ Q + K VQKY++EQQ + KS +D +  TQ +      T+ QL RA++VYH+R+ E+ +  +S+ ++   +R+ E+MEAKLKKA D+YKY +EKYNN   +F SKM  SC  FQE+E  HLEQM++F+ R+S+     +   ++    F +   ++T   LL+MF+  + TG   P+   FEDAE + + S +
Sbjct:    1 MEPCLFARNFWGEKNTGFDVLYQNLKLSYRSTSEFAEFVRDSSSIEDAYYKSLLKLAKQTGSYSNNSVSSFKPCWSILRQLVEQLGQLHLVFAQSRQSLSKDVQKYLEEQQKRHKSIRDAEASTQEVVHAFQVTAVQLHRAKEVYHSRYAEYERTMRSESSS---TREQEKMEAKLKKAQDEYKYSVEKYNNLRNQFVSKMAASCAQFQEVEVAHLEQMREFMQRYSSVWSAARDTMDKLCAQFNQDLTQMTTARLLDMFVAERGTGTTEPRIVPFEDAEVAAVFSAN 285          
BLAST of F-BAR domain only protein 2 vs. TrEMBL
Match: A0A4E0S0B5 (FCH domain only protein 2 OS=Fasciola hepatica OX=6192 GN=D915_003796 PE=4 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 5.520e-61
Identity = 119/284 (41.90%), Postives = 182/284 (64.08%), Query Frame = 2
Query:  143 METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINV---NSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDI 985
            ME   F++NFWG+K+ GFDVLYQN+K+  +S+S+F +F+RE  S+ED+  KS  KL+KQ      N+  S +P W  +++L E+    H+  SQ+ Q + K VQKY++EQQ + KS +D +  TQ +      T+ QL RA++VYH+R+ E+ +  +S+ ++   +R+ E++EAKLKKA D+YKY +EKYNN   +F SKM  SC  FQEIE  HLEQM++F+ R+S+     +   ++    F++   K+T   LLEMF+  + TG   P+   FEDAE + +
Sbjct:    1 MERCLFAENFWGEKNTGFDVLYQNLKSSCRSTSDFAEFVRESSSIEDAYYKSLLKLAKQTASYSNNNVSSFKPCWSVLRQLVEQLGQLHLAFSQSRQSLSKDVQKYLEEQQKRHKSIRDAETSTQEVVHAFQVTAVQLHRAKEVYHSRYAEYERTVRSESSS---TREQEKVEAKLKKAQDEYKYSVEKYNNLRNQFVSKMSASCAQFQEIEVAHLEQMREFMQRYSSVWSTTRETMDKLCAQFDEDLTKMTTMKLLEMFVAERGTGSTQPRIVPFEDAEVAAV 281          

HSP 2 Score: 114.39 bits (285), Expect = 7.753e-22
Identity = 105/387 (27.13%), Postives = 173/387 (44.70%), Query Frame = 2
Query: 2090 NSTIESRKFSSI---PSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFR----ESFSN----TPHDVHT-SGQLVISFPCSMLQQF---ESVGENQLNLAEPIHFCLSQASRLRNVE-----------PLPTSKD---------INIQIDNPTDDSYSIYIDLF--TLHKKLTTLR-RNEPASPFFNVDIIRYDV----TNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWP-NTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTN---------------QSSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWEPSTNTTGF 3076
            NST+    FSS    P N +P        N    I +A AFTET  A+F      SFS     TP  +   SG+L ++FP + ++Q     +VG        P+   L+ A RL++++           PL ++           ++  +  P       ++DL   T   K  T +  N  A  +  +DI+ Y V     ++  P  ++  P+H+   W+   T+ +   ++Y  +WP + ++ S T R              G++R ++  DG   +MQSLP   W  +L RA+W++ L+ +                 ++++KF L +GPG PQPV  QF  E  + SGV L +    +R+S  K R+I  RYV +P  ++T F
Sbjct:  788 NSTMSIPSFSSGTVGPWNQVP-------TNQAGSISVAAAFTETWRARFHNGGGSSFSTAAMITPPPIQAVSGELTLAFPRTSVEQMVTHSAVG--------PLVLRLNNAVRLKDLQLRVVGSSMVGCPLESAAPMSSPSSGVTMDFVLTVPGSVLMERFVDLLAETASSKTGTGKTSNNQAMSYLKMDILSYTVDVCQGSDCAPYPALTPPIHLCTYWRCDQTV-TDFRLDYATRWPSDKQITSRTSR--------------GDLRVILNVDGGVTRMQSLPMGTWMPELSRATWQIPLTPSTDALGVNSRETSIDTSGTVRAKFTLDHGPGRPQPVALQFFREDCLASGVQLILDCPMYRLSLCKRRVIGDRYVCDPPNHSTRF 1144          
BLAST of F-BAR domain only protein 2 vs. TrEMBL
Match: A0A5J4NMJ2 (F-BAR domain only protein OS=Paragonimus westermani OX=34504 GN=DEA37_0010067 PE=4 SV=1)

HSP 1 Score: 234.572 bits (597), Expect = 1.546e-59
Identity = 112/287 (39.02%), Postives = 183/287 (63.76%), Query Frame = 2
Query:  143 METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQIN-VNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDN 1000
            M++  F+ +FWGDKH GFDVLYQN+K   +S+++F +FLRE +S++D+  K+ +KL+KQ    N + + +P W  +++  E+    H   +Q+ Q ++K VQKY++EQQ + KS K+ ++ TQ +      T+ QL +A+++Y  R  E+ ++ +   N  + +RD E++EAKLKK+ D+YKYLIEKYNN   +F  KM  SC  FQEIE  HL+QM++F+ R+S+  F  +   ++    FE+   +++ + LL++F+K + TG   P+   FEDAE +   S  N
Sbjct:    1 MDSCLFAQHFWGDKHMGFDVLYQNLKLACRSTNDFAEFLRESFSVDDAYCKAISKLAKQAGSYNIASTFKPCWSIVRQFIEQIGQLHSNFTQDRQALLKDVQKYIEEQQKRYKSVKEGEVSTQEVVHAFQVTTVQLQKAKELYFCRHTEYQRMLR---NESSSTRDQEKLEAKLKKSQDEYKYLIEKYNNLRNQFVGKMQTSCAQFQEIEVSHLDQMREFLHRYSSAWFTGRQGLDKLLLQFEEYFAQMSTEQLLQLFVKERGTGSTIPQGIAFEDAEVAAAFSTPN 284          

HSP 2 Score: 112.079 bits (279), Expect = 4.428e-21
Identity = 100/371 (26.95%), Postives = 153/371 (41.24%), Query Frame = 2
Query: 2120 SIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFR----ESFSNT-----PHDVHTSGQLVISFPCSMLQQF---ESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDN-------------------PTDDSYSIYIDLFTLHKK----LTTLRRNEPASP------FFNVDIIRYDVTNNVRPN-GSINAPVHISANWQITDTLASHLMINYNFQWP-NTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL----------------DLSTNQSSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWEP 3055
            ++P   +PA P          IP+A AFTET   +F      SFS       P     SG L ++FP   ++Q     SVG   L L   I F                 K+I +++D                    P+ D Y I I    L +     L+T  R+   S       +  +D++ Y V  N   N  ++  P+H+   W+  +  A+   ++Y   WP N +  S + R              G++R  +  DG   +MQSLP  +W  D+ RA+W++                 L+    ++++KF L NGPG PQPV  QF  E  + SGV L V G  +++S  K R+I  RY+ +P
Sbjct:  845 TLPRTLLPAKP----------IPIAAAFTETWRVRFHNGGGSSFSTAASIIPPPLQAVSGTLTLAFPTLAVEQLVREPSVGPLVLRLNNAIRF-----------------KNIQLKLDGSFISDCSSDSTSTCGASTYPSAD-YVITIPGTALVQHFTNILSTFSRSAADSSGANISNYVKLDVLSYAVELNAIMNLQALTPPIHLCTYWRC-ERGATDFRLDYTSHWPSNDQAVSRSIR--------------GDLRISLNVDGGVSRMQSLPMGVWLPDVHRATWQIPFSQPLDNVSSRAASDSLTVCSGTVRAKFTLVNGPGRPQPVALQFVREDCLASGVRLAVEGLEYKLSLCKQRIIGDRYICDP 1172          
BLAST of F-BAR domain only protein 2 vs. TrEMBL
Match: A0A183WKJ9 (F-BAR domain-containing protein OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS12651 PE=4 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 1.330e-58
Identity = 112/278 (40.29%), Postives = 170/278 (61.15%), Query Frame = 2
Query:  143 METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQIN-VNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAE 973
            M    FS +FWG+KH GFD +YQN K   ++S+EF +FLRE YS ED+  K+  KLSKQ    N++ S +P W  +K+L ++ S  H+ ++Q  Q + + VQKY++EQ  +QK  KD +  TQ +      TS QL +A++ YH+R+ E+ +  + +  +   SR+ E++E KLKKA D+YKY +EKYNN   +F SKM  SC  F+EIE  HLEQM++F+ R+++          +    F++   +LT D LL + +  + TG + P+   FEDAE
Sbjct:    1 MSACLFSQHFWGEKHSGFDAMYQNFKLCYRTSAEFAEFLRESYSAEDNYYKALIKLSKQAGSYNNTSSFKPCWSLLKQLIDQVSQVHLNIAQERQNLSRDVQKYLEEQHKRQKLIKDTEASTQEVVHAFQVTSMQLQKAKEAYHSRYSEYERAMRLESGS---SREQEKLEVKLKKAQDEYKYSVEKYNNLRNQFVSKMHISCAQFEEIEVAHLEQMREFLHRYASVWSVTGDALGKLHNQFDQDLAELTTDRLLNILVSERGTGTLEPQGVQFEDAE 275          
BLAST of F-BAR domain only protein 2 vs. Ensembl Cavefish
Match: fcho1 (FCH and mu domain containing endocytic adaptor 1 [Source:NCBI gene;Acc:100913078])

HSP 1 Score: 159.073 bits (401), Expect = 2.226e-39
Identity = 91/290 (31.38%), Postives = 154/290 (53.10%), Query Frame = 2
Query:  170 FWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQKESTDILTD 1036
            F G+K+ GFDVLY NMK G  ++ E  +F+RE  ++E++ +KS +KL+K   N ++ G+  P W   +  S+K +  H+EL + +  +I+ + KY DEQ    + TK+  + T      L   +  L ++R+ YHA+  E  +L K     G   +++E+ E K KKA + +   IEK+N     F+ KM ES   FQ+IE  HL QMK  I  +S  +     +  +    F++    + + +L++ F + K TGK  P    FE+  SS +   + K + +++ +  D
Sbjct:   22 FQGEKNAGFDVLYHNMKHGQIATKELAEFVRERAAVEETYSKSMSKLAKMASNGSTLGTFAPMWDVFRVSSDKLALCHLELMRKMNDLIRDINKYGDEQAKVHRKTKEEVMGTLEAVQTLQVQNGHLQKSREGYHAKCTELERLRK----EGAPQKELEKAELKSKKAAESFASSIEKFNRAGGDFEQKMSESAQKFQDIEEAHLRQMKQLIKGYSHSIEDTHVQVGQVHEEFKQNVENIGIGSLIQKFTEQKGTGKDRPVPVGFEEYLSSQLPDNNKKSRAKNSPLEVD 307          

HSP 2 Score: 81.2629 bits (199), Expect = 3.662e-15
Identity = 83/305 (27.21%), Postives = 140/305 (45.90%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPI-HFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL-DLS-TNQSS---IKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P  +S+++ E  P+A A TE +NA F+    N    V  +G L +SFP  + + F +      N   P+  F L   SR+ +   LP  K +         DS   + ++  L   L       P + ++NV +++Y V++         AP+ +SA  Q + T+              T V SL +   PA +  +++     V+ L+  D +   +Q  PP+ WN++  R  W+L +LS TN SS     S   L    G P  +  QF   G+  SG+ +++ G+R+R+S  K R  +G+Y+
Sbjct:  566 PSPISLSTQEAWPVAAAITEYINAYFKGGEHNRCL-VKITGDLTMSFPAGITRLFTA------NPNAPVLSFRLVNISRVDHF--LPNQKLLFSDPSQNDPDSRDFWFNMQALTFHLQREAELNPQASYYNVGLLKYQVSSQ----DPARAPLLLSAECQRSGTV--------------TRV-SLDYHCCPATAPATQLT---AVQVLLPLDHTATDLQCQPPASWNAEERRLLWKLPNLSPTNHSSGTLCASWQCLEVPRGPPPSLAVQFVGSGASLSGMDVELVGSRYRMSLVKKRFATGKYM 839          
BLAST of F-BAR domain only protein 2 vs. Ensembl Cavefish
Match: fcho2 (FCH and mu domain containing endocytic adaptor 2 [Source:NCBI gene;Acc:553949])

HSP 1 Score: 125.946 bits (315), Expect = 4.130e-29
Identity = 87/308 (28.25%), Postives = 155/308 (50.32%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHG---EVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL-DLST-----NQSSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P  +++ S + +P+A+AFTE+VNA F+ +   +   V  +G + +SFP  +++ F S     +     + F L   S+L  +  LP    ++        D+   ++++  L   L       P S ++NVD+++Y V +N    G  + P++++  W+   T  + L ++Y +   N E                 ++PHG    V+ LV  +G    MQS+P +IWN+D  ++ W+L D+S         S+++KF LS+GP  P  +  QF  EGS  SG  +++ G+ +R+S +K R  SGRY+
Sbjct:  503 PSPVTLASQDALPIAVAFTESVNAYFKGA-DPSKCIVKITGDMTLSFPSGIIKIFTSSPSPAV-----LSFKLKNTSKLEQI--LPNQHLLHSDSSQSDTDTRDFWLNMPALTAYLRKNSEQNPTSSYYNVDVLKYQVCSN----GIQSTPLNLAVYWKCGPT-TTDLRVDYRY---NPEA----------------MQPHGPLSSVQVLVPVNGGVTNMQSIPNAIWNADQNKSLWKLNDISEKSENEGSGSLRAKFELSDGPSIPATLAVQFFNEGSTLSGADMELVGSGYRLSLNKKRFASGRYM 778          

HSP 2 Score: 124.02 bits (310), Expect = 1.643e-28
Identity = 75/228 (32.89%), Postives = 120/228 (52.63%), Query Frame = 2
Query:  341 SLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQT----QNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQK 1012
            +  P W   K  +EK ++ HMEL + +Q +IK VQKY+DEQ    K TK+    T    QNI S+    S  L ++++ Y+++ LE  ++ K     G   RD+++   K+KKA + YK  +EKY  T T+F+ KM E+   FQ+IE  H+  MK+ I  +S  +     +  E    F       +V++L++   +SK TGK  P    FE+   S + ++  K +K
Sbjct:   37 TFAPIWDVFKVSTEKLASCHMELVRKLQELIKEVQKYVDEQAKAHKKTKEEVASTLEAVQNIQSV----SQALQKSKENYNSKTLEQERMRK----EGATQRDLDKTGVKVKKATEVYKSFVEKYATTKTEFEQKMAETAQKFQDIEESHILHMKEIIQSYSCSVEDTHKQIEEVHQEFVNNMENTSVESLIQKLAESKGTGKERPGPIEFEECNVSTVATEAAKPRK 256          
BLAST of F-BAR domain only protein 2 vs. Ensembl Cavefish
Match: sgip1a (SH3GL interacting endocytic adaptor 1a [Source:ZFIN;Acc:ZDB-GENE-131121-25])

HSP 1 Score: 119.013 bits (297), Expect = 2.638e-27
Identity = 86/310 (27.74%), Postives = 158/310 (50.97%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEP--IHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHG--EVRFLVIADGSPFKMQS-LPPSIWNSDLGRASWRL-DLSTNQ-----SSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P  L++ + + +P+A AFTETVN+ F+ +   +   V  +G++V+SFP  + + F        N   P  + F ++  S L +V P P     +    NP  +S   ++++  L   L  +   +P + ++NVD+++Y V+      G  + P++++ NW+   T ++ L I+Y +                  +GN+   P     V+FL+  DG   K+Q+ LPP+ WN++  R  W++ D+S         S+ ++F L++GP  P P+  QF++EGS  SG  +++ G  +R S  K R  +G+Y+
Sbjct:  302 PSPLTMGAQDTLPVAAAFTETVNSYFKGT-DPSKCVVKITGEMVLSFPAGITRHFA-------NNPSPAVLTFSITNYSCLEHVLPNPQLLCCDTTQSNP--NSKEFWVNMTNLMAHLKKVAEQKPQATYYNVDMLKYQVS----AQGPQSTPLNLAVNWRCEPT-STDLRIDYKY------------------NGNAMTTPVALNNVQFLIPVDGGVNKLQAVLPPAAWNAEQQRILWKIPDISQKSENGGVGSLLARFQLTDGPSKPAPLAVQFTSEGSTLSGCDIELVGPGYRFSLIKKRFAAGKYM 578          
BLAST of F-BAR domain only protein 2 vs. Ensembl Cavefish
Match: sgip1b (SH3GL interacting endocytic adaptor 1b [Source:ZFIN;Acc:ZDB-GENE-131121-110])

HSP 1 Score: 103.99 bits (258), Expect = 2.965e-22
Identity = 79/307 (25.73%), Postives = 146/307 (47.56%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEP--IHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQS------SIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P  L++   + +P+A AFTET++A F+ +  +    V  +G++V+SFP  + + F        N   P  + F +S  SRL  V  LP  + +         D    ++++  L   L  +    P + ++NVD+++Y V+      G  + P++++ +W+  D  ++ L I+Y +       A     P P  +          ++F+V  DG   K+Q++ P   N +  +  W++   + +S      ++  +F LS GP  P  +  QFS+EGS  SG   Q+ G+ +R+S  K R  S +Y+
Sbjct:  458 PSPLTMGPQDTLPVAAAFTETISAYFKGA--DPSCVVKITGEMVLSFPAGITRHFS-------NHPTPPVLTFTISHYSRLEQV--LPNPQLLCSDTMPTASDCKEFWVNMPNLMTHLKKVADQRPQATYYNVDMLKYQVSTQ----GIQSTPLNLAVSWR-GDPNSTDLRIDYKYN------AEAMLSPVPLTN----------IQFMVPVDGGVMKVQAMLPPATNQETQKILWKISELSQKSENGGVGALLGRFQLSEGPSKPSQLAVQFSSEGSTLSGCDFQLMGSGYRLSLVKKRF-SAKYL 731          
BLAST of F-BAR domain only protein 2 vs. Ensembl Cavefish
Match: pstpip1a (proline-serine-threonine phosphatase interacting protein 1 [Source:NCBI gene;Acc:103046241])

HSP 1 Score: 51.2174 bits (121), Expect = 4.875e-6
Identity = 67/327 (20.49%), Postives = 141/327 (43.12%), Query Frame = 2
Query:  143 METLTFSDNFWGD---KHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSS-GSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQ--NNGNRSRDIERMEAKLKK-------AVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQC-----EFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQKESTDILTDPS--LNGNHIG 1063
            M  L F D FWG     + G++ L Q +  G ++  +  + L+     E+   K    ++++    S  G+L+  +  +K   E     H+ LS  ++  +K ++++ + Q+ ++K  + +    + ++   V+   + I ++  Y  R  E  +  ++ +  NN    +  E+++ K K+       A   Y   I++ +    ++++    +C  FQ+ E   +  +++ I     H F +QC      + E +T  E     +T D  +  FI+ K TG  PP   +FE   + +   + N   +    ++   S  L GN  G
Sbjct:    1 MTPLQFKDAFWGPDFVSNAGYEALTQRLYDGRRACKDMEELLKMRAMAEEKYGKELVAIARKAGGQSEIGTLKASFDQLKAQIENIGNLHIHLSGMLKEEVKRMEQFRERQKEQRKKFEGI---MEKVHKTKVSQYKKTIESKRSYEQRCREADEAEQAAEKINNTTTPKQAEKVQNKAKQCREAAGDAEKQYMSNIDQLDKIRQEWETTHESTCEVFQQQEGDRISILRNAIWVHCNH-FSMQCVKDDESYEEVRTVMEGCD--ITAD--INSFIELKRTGSSPPPPVLFESYYNREFAGESNGTARFGGGVIKRFSNLLQGNCSG 319          
BLAST of F-BAR domain only protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007464.1 (pep scaffold:Pmarinus_7.0:GL477111:2188:43613:-1 gene:ENSPMAG00000006739.1 transcript:ENSPMAT00000007464.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 1.015e-44
Identity = 96/267 (35.96%), Postives = 151/267 (56.55%), Query Frame = 2
Query:  152 LTFSDNFWG-DKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSS-GSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPP 946
            L F +  WG +K+ GFD+LY NMK G  S+ E  DF+RE  ++E+   KS  KL+K  + NS  G+  P W+  +  SE+ ++ H ELS+ +  +I+ VQKY DEQ  + K TK+    T      + +T+  L++A++VY+++  E  +L K     GN  ++ E+ + K +KA++ YK  ++KY N  + F+ KM E+   FQEIE  HL+ + DFI  FS  +        +    F +  R +T D L+E + +SK TGK  P
Sbjct:    4 LHFVEPEWGGEKNNGFDILYHNMKHGQISTKEVADFIRERMTVEEVYAKSLTKLAKTASNNSQLGTFAPMWEVFRASSERLASCHQELSRKLMELIREVQKYGDEQTKQHKKTKEEVSGTLEAVQGMQSTTQALLKAKEVYNSKHQETERLKK----EGNH-KEYEKAQVKSRKAMEAYKVFVDKYANVRSDFEHKMTETAQRFQEIEEAHLQSLHDFIKAFSQAVEDTHTLIGQVHMEFRQQVRDITADNLIEKYSESKGTGKERP 265          
BLAST of F-BAR domain only protein 2 vs. Ensembl Sea Lamprey
Match: gas7a (growth arrest-specific 7a [Source:ZFIN;Acc:ZDB-GENE-130128-1])

HSP 1 Score: 60.077 bits (144), Expect = 1.556e-9
Identity = 61/280 (21.79%), Postives = 128/280 (45.71%), Query Frame = 2
Query:  155 TFSDNFWGDK--------HQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSK-QINVNSSGSLQPFWQAIKELSEKRSTAHME----LSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLK--KAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQ-QTAFEKTQRKLTVDTLLEMFIKSKSTGKIPP 946
            ++ D+FW DK          GF+VL      G + S E  +F+R+   +E+   K+ +KLS+  + +   G+L   W  +K      +  H++    LS  ++  + + +++  ++  K+      +    N   LL    + + +AR V   R  E     K ++   +   + E M+A+++  +  DD K  ++ YN    ++  +M+ S    + +E   +EQ++  ++R+ T L      FN+    A  ++ +K+  +   E+++K   TG + P
Sbjct:  138 SYCDHFWADKLDAHSKKATSGFNVLLAKQMKGQQMSREMAEFIRQRVKIEEEYAKNLSKLSQCPLALQEEGTLGESWAQVKISLSAEAEVHLKFAAKLSSEVEKPLFSFREHFGKEMRKK------EHHIANHRKLLTTRYSSVQKARKVLAKRQRELEMKVKHNEIKPSNKAEEEIMKARMRSTQGGDDLKKCVDLYNQAQFRWFEEMVTSSLELERLEVERIEQIEQHLNRY-TQLRHETDVFNQSTMEAVNQSLQKVDPNRDRELWVKDTRTGSVRP 410          
BLAST of F-BAR domain only protein 2 vs. Ensembl Nematostella
Match: EDO36238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ57])

HSP 1 Score: 136.346 bits (342), Expect = 8.968e-36
Identity = 90/272 (33.09%), Postives = 157/272 (57.72%), Query Frame = 2
Query:  176 GDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSK-QINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRF-STHLF------KVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFED 967
            G+K+ GFDVLY NMK G  +S++ ++F+RE  ++E++  KS  KL+K   + +  G+ +P W  ++  +EK S AH ++   +Q ++K +++Y D+Q+ + K+ KD    T  I   +   +  L +A++ Y+AR  EF +    ++ +G  ++++E+ EAK+KKA ++YK L+EK       F  KM+++C  FQ+IE  HL+ +   +  +  +H+       KV  EF EQ  A       L V+ LL+ F++SK TG   P+   FE+
Sbjct:    1 GEKNAGFDVLYHNMKYGNNASTKLVEFIRERSAIEENYCKSLVKLAKSACSASQLGTFEPLWGVLRVATEKLSNAHHQVVVRLQELVKEIKEYGDKQKERHKAAKDEFTTTAEIVQTIQTMTAALTKAKETYYARCQEFER----NKRDGTSTKELEKAEAKMKKAAEEYKALVEKREIIRNDFHDKMVDTCRKFQQIEEEHLQIISRHLETYIGSHMAGWEIMEKVHTEFREQVAA-------LAVEKLLDQFVRSKGTGMNIPEVITFEE 261          
BLAST of F-BAR domain only protein 2 vs. Ensembl Nematostella
Match: EDO40558 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6P0])

HSP 1 Score: 62.3882 bits (150), Expect = 1.300e-10
Identity = 63/271 (23.25%), Postives = 122/271 (45.02%), Query Frame = 2
Query: 2258 VHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPA--SPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL-DLSTNQ-------SSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGR 3040
            V  +G + +SFP S++ +  +   + L     + F +   S L  + P  +      Q+      SY      F +   +  LR+   A  S ++N+DI++Y+V      +G  + P+ + + W+  +   +++ I+Y +   N+   S     +P         P   V  +   +G    MQS P + W+++  RA W + ++S++Q       S + +KF LS GP TP  +  QF+  G+  S +  ++    +R+S  K +  SG+
Sbjct:    4 VKVTGDITVSFPASLVTRLCNRESSPL-----LTFQIKGTSSLEQILPNKSLILSEGQLSGGDIVSYK-----FIMPSLIEHLRKQLEATSSAYYNIDIMKYEV----HTSGIQSTPLQLCSYWK-CEQPTTNIRIDYRY---NSSCMS-----APC--------PLSNVSIIAPVNGGVTIMQSKPSATWSAENERAVWVIPEISSSQEPDGQYLSIVGAKFDLSGGPSTPSRIAVQFTCNGATISKLNFELKSEDYRLSLVKKKFSSGK 243          
BLAST of F-BAR domain only protein 2 vs. Ensembl Nematostella
Match: EDO34808 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNC2])

HSP 1 Score: 56.6102 bits (135), Expect = 3.804e-8
Identity = 77/340 (22.65%), Postives = 149/340 (43.82%), Query Frame = 2
Query:  158 FSDNFWGDKH---QGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSS-GSLQPFWQAIKELSEKRSTAHMELSQNI-QLIIKAVQKYMDEQQLKQKSTKDLDLQTQ--------NINSLLVNTSTQLIRARD---------VYHARFLEFHKLHKS-DQNNGNRSRDIERMEAKLKKAVDD--YKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQC-EFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFED---AESSDIKSQDNKIQKESTDILTDPSLNGNHIGDVITGNLVN 1090
            F D FWG +     GFD L + M+ G ++  E  +F+++   +E+   KS  +L+K        G+L+  W +++  +E    AH+ L+Q +   + K +Q++ + Q+  +K  +D   ++Q        N++ L   T  Q  R ++         V  A   E   LH S    +      +     KL     D  Y+  +   ++T   ++ +M   CN FQ +E   +  +++++  ++ +L  + C + +E      ++     VD  +++FI  + TG   P H  +E+    +SS           + T  L+  S+N   IG  I G+L +
Sbjct:    4 FVDCFWGTEFTSTAGFDALSKRMRDGKQTCQEMEEFVKQRADIEEKYGKSLMRLAKTSEAKDEIGTLKSSWDSLRNETENIGKAHVALAQQLLDSLEKGLQEFRENQKETRKKLEDSVKRSQRNKKTCYENLHKL-KRTYEQKCREKEAADDALKKSVSMAAKDEEKTLHSSIVYGHTTEKAPVLVRSPKLSSVEHDSAYQTSVRVLDDTRVVWEREMATCCNVFQNLEEERIAFLRNWMWLYA-NLGSINCVKVDEMYEVVRQSLEGCNVDQDIKLFISMRQTGSERPSHIDYENYYMVQSS-----------QKTSPLSGGSVN---IGGPIPGSLTH 327          
BLAST of F-BAR domain only protein 2 vs. Ensembl Nematostella
Match: EDO43872 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXM7])

HSP 1 Score: 51.9878 bits (123), Expect = 9.656e-7
Identity = 54/258 (20.93%), Postives = 113/258 (43.80%), Query Frame = 2
Query:  158 FSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLS----KQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQL-IIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLH------KSDQNNGNRSRDIERMEAKLKKAVD-------DYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQ 877
            F ++FW  + +G++ L ++ + G     E      E   +E S   S +KLS    K +  +  G+L+  W+ I    E  +  H  L+  +     K ++ +++ Q    K+ K ++++ +       +  +  ++ +   H++  E   LH      K  +      +DI ++EAK+KK ++       DY+ +  K   T  ++++ M + C + +++E   +  +KD  S +   L  V     E Q  +E  Q
Sbjct:    4 FEESFW--EQKGYEELRKSCRQGSDFCKEIAAIFNERSKIELSYADSLSKLSVKAQKLLAKDVVGTLKSSWEKISWNIESEADIHRTLANQLHGEAAKQIKAFVETQS---KTRKPVEVEVEKAYKNFSDRLSDSLKKKGASHSKSKEVETLHDQMEDTKQGKGKAVSDKDITKLEAKIKKGMESAIKSDKDYREMYMKTERTRLEWEATMSKYCQTCEKLEEERVGHLKDMFSLYGNMLAAV---IPELQQVYESIQ 253          
BLAST of F-BAR domain only protein 2 vs. Ensembl Medaka
Match: fcho1 (F-BAR domain only protein 1 [Source:NCBI gene;Acc:101171653])

HSP 1 Score: 177.563 bits (449), Expect = 7.662e-45
Identity = 92/274 (33.58%), Postives = 150/274 (54.74%), Query Frame = 2
Query:  152 LTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDA 970
            + F DNFWG+K+ GFDVLY NMK G  ++ E  +F+RE  ++E++ +KS +KL+K   N +  G+  P W   +  S+K +  H+EL + +  +I+ + KY +EQ    + TK+  + T      L   S+ L ++++ YH + LE  +L K     G   +++E+ E K KKA + +   IEKYN    +F+ KM ES  +FQEIE  HL QMK  +  +S  +     +  +    F++    + +DTL++   + K TGK  P    FE+ 
Sbjct:    1 MAFQDNFWGEKNAGFDVLYHNMKHGQLATKELAEFVRERAAIEETYSKSMSKLAKMASNGSPQGTFAPMWDVFRVSSDKVALCHLELMKKMNDLIREINKYGEEQVKIHRKTKEKMVGTVEAVQALQVQSSHLQKSKEGYHGKCLELDRLRK----EGAPQKELEKAELKSKKAAESFALCIEKYNRVGGEFEQKMSESAQNFQEIEEAHLRQMKQLMKSYSHSIEDTHVQVGQVHEEFKQNVENIGIDTLIQKLAEQKGTGKDRPAPVGFEEC 270          

HSP 2 Score: 80.4925 bits (197), Expect = 8.604e-15
Identity = 86/345 (24.93%), Postives = 154/345 (44.64%), Query Frame = 2
Query: 2036 PLPAKITPPRSASTVPFSNSTIESRKFSSIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPI-HFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL-DLSTNQSSIKSKFMLSNGP------GTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P PA+I     AS + + +  ++ R         +   P  +S+++ E  P+A A TE +NA F+    N    V  +G L +SFP  + + F +      N   PI  F L   SR+ +   LP  K +         +S   + ++  L   L       P + ++NV +++Y V++         AP+ +SA  Q + T+              T V SL +   PA + ++++     V+ L+  D +   +Q  PP+ WN++  R  W+L +LS    S  S  + ++        G P  +  QF   G+  SG+ +++ G+R+R+S  K R  +G+Y+
Sbjct:  912 PSPARIG---QASPLSYQHQELQQRSLH------LSRGPSPISLSAQEAWPVAAAITEYINAYFKGGQHNR-CLVKITGDLTMSFPAGITRIFSA------NPNIPILSFRLVNISRIDHF--LPNQKLLYSDPSQTDPNSRDFWFNMQALQLHLQREAELNPQASYYNVGLLKYQVSSQ----DPGRAPLLLSAECQRSGTV--------------TRV-SLDYHCCPATAPSTQLT---SVQVLLPLDHAATDVQCQPPASWNAEERRLLWKLPNLSPTNHSKGSGTLCASWQCLEVPRGPPPSLAVQFVGSGTSLSGMGVELVGSRYRMSLVKKRFATGKYM 1216          
BLAST of F-BAR domain only protein 2 vs. Ensembl Medaka
Match: fcho2 (FCH and mu domain containing endocytic adaptor 2 [Source:NCBI gene;Acc:101175493])

HSP 1 Score: 168.318 bits (425), Expect = 2.184e-42
Identity = 96/283 (33.92%), Postives = 158/283 (55.83%), Query Frame = 2
Query:  146 ETLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQI-NVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQT----QNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESS 979
            E L    N+ G+K+ GFDVLY NMK G  S+ E  DF+RE  ++E++  +S  KL K   N +  G+  P W   K  +EK++  HM+L++ +Q +IK VQKY++EQ    K TK+    T    QNI ++    S  L +++++Y+A+ +E  +L K     G   RD+++   K KKA + YK  +EKY    ++F+ KM E+   FQ+IE  H+ Q+K+ I  +S ++ +   +  E    F +     +V++L++   +SK TGK  P    FE+  ++
Sbjct:   13 EPLLLCRNY-GEKNNGFDVLYHNMKHGQISTKELTDFIRERSTIEEAYARSMTKLVKTAGNFSQLGTFAPVWDVFKSSTEKQAVCHMDLARKLQELIKEVQKYIEEQAKAHKKTKEEVAPTLEAVQNIQTI----SQSLQKSKEIYNAKTVEQERLRK----EGATQRDVDKAGVKAKKATESYKSYVEKYATAKSEFEQKMAETAQKFQDIEENHILQLKEIIHSYSEYVEETHVQIGEVHKEFVRNIENTSVESLIQKLSESKGTGKERPGPVEFEECNAA 286          

HSP 2 Score: 123.635 bits (309), Expect = 2.368e-28
Identity = 90/305 (29.51%), Postives = 158/305 (51.80%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRL-DLST-----NQSSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P  +++ S + +P+A+AFTE+VNA F+ +   T   V  +G + +SFP  +++ F S     +     + F L  ASRL  +  LP  + ++        DS S + ++  L   L       P++ ++NVDI++Y V ++    G  + P++++  W+ T +  + L ++Y +   + +        SP    N ++        LV  DG    +QSLP SIW+S+  +  W+L DLS+        SI++KF LS+GP  P  +  QF +EG+  SGV +++ G+ +R+S  K R  +GRY+
Sbjct:  548 PSPVTLASQDALPIAVAFTESVNAYFKGA-DPTKCIVKITGDMTLSFPMGIIKVFTSNPSPAV-----LTFKLKNASRLEQI--LPNVQLLHSDPSQSDSDSKSFWFNMQALTTYLRKASEQNPSASYYNVDILKYQVQSD----GIHSTPLNLAVYWKCTPS-TTDLRVDYRYNPESMD--------SPGSLTNLQV--------LVPVDGGVTSVQSLPNSIWSSEQNKCLWKLSDLSSKSENEGAGSIRAKFDLSHGPSNPSTLAVQFMSEGATLSGVDMELLGSGYRLSLSKKRFATGRYM 823          
BLAST of F-BAR domain only protein 2 vs. Ensembl Medaka
Match: sgip1a (SH3GL interacting endocytic adaptor 1 [Source:NCBI gene;Acc:101164635])

HSP 1 Score: 120.939 bits (302), Expect = 2.114e-27
Identity = 88/306 (28.76%), Postives = 156/306 (50.98%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPT--SKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQS-LPPSIWNSDLGRASWRL-DLSTNQ-----SSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGR 3040
            P  L++ + + +P+A AFTETVNA F+ +  +    V   G++V+SFP  + + F +     +     + F ++  SRL +V P P     D   Q      DS   ++++  L   L  +   +P + ++NVD+++Y V+      G  ++P++++ +W+   T ++ L I+Y +   N E  S     +P    N        V+FLV  DG   K+Q+ LPP+ WN++  R  W++ D+S         S+ ++F L+ GP  P P+  QF++EGS  SG  +++ G  +R S  K R  +G+
Sbjct:  628 PSPLTMGAQDTLPVAAAFTETVNAVFKGADPSK-CVVKIIGEMVLSFPAGITRHFANNPSPAV-----LTFSITNYSRLEHVLPNPQLLCCDTTTQAKA---DSKDFWVNMPNLISHLKKVSEQKPQATYYNVDMLKYQVSTQ----GLQSSPLNLAVSWRCEST-STDLRIDYKY---NGEAMS-----TPMALNN--------VQFLVPVDGGVSKLQAVLPPAAWNAEQQRILWKIPDISQKSENGGVGSLLARFQLTEGPSKPAPLAVQFTSEGSTLSGCDIELAGPGYRFSLIKKRFAAGQ 903          
BLAST of F-BAR domain only protein 2 vs. Ensembl Medaka
Match: SGIP1 (SH3-containing GRB2-like protein 3-interacting protein 1 [Source:NCBI gene;Acc:105356194])

HSP 1 Score: 117.857 bits (294), Expect = 1.725e-26
Identity = 86/318 (27.04%), Postives = 160/318 (50.31%), Query Frame = 2
Query: 2123 IPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPI-HFCLSQASRLRNVEPLPTSKDINIQIDNPTD--DSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSL-PPSIWNSDLGRASWRLDLSTNQS------SIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            +PS      P  L++   + +P+A AFTET+NA F+ +   +   V  +G++V+SFP  + + F S      +  +PI  F +S  +RL  V P P      +  D+ T+   +   ++++  L   L  +   +P + ++NVD+I+Y V+      G  + P++++ +W+ +D+ ++ L I+Y +   NTE  +                P   ++FLV  D    K+Q++ PP+IWN +     W +   +++S      ++  +F +  GP  P  +  QFS+EGS  SG  +Q+ G  +R+S  K R  +G+Y+
Sbjct:  584 MPSTGCSRGPSPLTMGPQDTLPVAAAFTETINAYFKGA-DPSKCLVKITGEIVLSFPAGITRHFAS------HPTQPILTFSISNYNRLEQVLPNPQL----LCCDSTTNVVGTKEFWVNMPNLLSHLKKVAEQKPQATYYNVDMIKYQVSAE----GIQSTPLNLALSWR-SDSTSTDLRIDYKY---NTEAMAAPV-------------PLHNIQFLVPVDAGVAKLQAMVPPAIWNPEHRTIQWNISSLSHRSENGGVGALLGRFQMVEGPCKPSQLAVQFSSEGSTLSGCDIQLVGTGYRLSLVKKRFAAGKYL 869          
BLAST of F-BAR domain only protein 2 vs. Ensembl Medaka
Match: sgip1a (SH3GL interacting endocytic adaptor 1 [Source:NCBI gene;Acc:101164635])

HSP 1 Score: 108.227 bits (269), Expect = 1.832e-23
Identity = 80/306 (26.14%), Postives = 146/306 (47.71%), Query Frame = 2
Query: 2150 PVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQS-LPPSIWNSDLGRASWRL-DLSTNQ-----SSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYV 3046
            P  L++ + + +P+A AFTETVNA F+ +  +          +V++F  +   + E V      L  P   C    ++ +                    DS   ++++  L   L  +   +P + ++NVD+++Y V+      G  ++P++++ +W+   T ++ L I+Y +   N E  S     +P    N        V+FLV  DG   K+Q+ LPP+ WN++  R  W++ D+S         S+ ++F L+ GP  P P+  QF++EGS  SG  +++ G  +R S  K R  +G+Y+
Sbjct:  612 PSPLTMGAQDTLPVAAAFTETVNAVFKGADPSK----CVVKIIVLTFSITNYSRLEHV------LPNPQLLCCDTTTQAKA-------------------DSKDFWVNMPNLISHLKKVSEQKPQATYYNVDMLKYQVSTQ----GLQSSPLNLAVSWRCEST-STDLRIDYKY---NGEAMS-----TPMALNN--------VQFLVPVDGGVSKLQAVLPPAAWNAEQQRILWKIPDISQKSENGGVGSLLARFQLTEGPSKPAPLAVQFTSEGSTLSGCDIELAGPGYRFSLIKKRFAAGKYL 867          
BLAST of F-BAR domain only protein 2 vs. Planmine SMEST
Match: SMESG000078045.1 (SMESG000078045.1)

HSP 1 Score: 1950.64 bits (5052), Expect = 0.000e+0
Identity = 978/980 (99.80%), Postives = 980/980 (100.00%), Query Frame = 2
Query:  143 METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQKESTDILTDPSLNGNHIGDVITGNLVNXXXXXXXXXTHVSNVNITTPNAKDSINDIFDQLSNISDNNSINQTTVSHIDGGTVSIPIKKQKKYNNIFRRKRNSPSNGVTQKQLQDTDKEKSSQSLGEYMVDDEGYTIKPNDPWPXXXXXXXXXXXXXXXXXXXIFKAIKIEIKPKDNKSDSSSIPDNDLPIKAKSKNNDNLELFKAVQAFKISPNIFRDGNRRTGDSRSNTPSLPNVLADDGSPPTSTRLNSISVSIRDSRRKKNSRSQSEQAQSLAQPYFQVEFTNSFESNGLDLAGVTSDPFNSRFESFQSSKADLPLKTNENKIDPWGSSTVNDKSIQPPPLPAKITPPRSASTVPFSNSTIESRKFSSIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQSSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWEPSTNTTGFCV 3082
            METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQKESTDILTDPSLNGNHIGDVITGNLVNIDSSSDISSTHVSNVNITTPNAKDSINDIFDQLSNISDNNSINQTTVSHIDGGTVSIPIKKQKKYNNIFRRKRNSPSNGVTQKQLQDTDKEKSSQSLGEYMVDDEGYTIKPNDPWPDHNQ+SSSDSSSDDDNADNIFKAIKIEIKPKDNKSDSSSIPDNDLPIKAKSKNNDNLELFKAVQAFKISPNIFRDGNRRTGDSRSNTPSLPNVLADDGSPPTSTRLNSISVSIRDSRRKKNSRSQSEQAQSLAQPYFQVEFTNSFESNGLDLAGVTSDPFNSRFESFQSSKADLPLKTNENKIDPWGSSTVNDKSIQPPPLPAKITPPRSASTVPFSNSTIESRKFSSIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCL+QASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQSSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWEPSTNTTGFCV
Sbjct:    1 METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQKESTDILTDPSLNGNHIGDVITGNLVNIDSSSDISSTHVSNVNITTPNAKDSINDIFDQLSNISDNNSINQTTVSHIDGGTVSIPIKKQKKYNNIFRRKRNSPSNGVTQKQLQDTDKEKSSQSLGEYMVDDEGYTIKPNDPWPDHNQHSSSDSSSDDDNADNIFKAIKIEIKPKDNKSDSSSIPDNDLPIKAKSKNNDNLELFKAVQAFKISPNIFRDGNRRTGDSRSNTPSLPNVLADDGSPPTSTRLNSISVSIRDSRRKKNSRSQSEQAQSLAQPYFQVEFTNSFESNGLDLAGVTSDPFNSRFESFQSSKADLPLKTNENKIDPWGSSTVNDKSIQPPPLPAKITPPRSASTVPFSNSTIESRKFSSIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLTQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQSSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWEPSTNTTGFCV 980          
BLAST of F-BAR domain only protein 2 vs. Planmine SMEST
Match: SMESG000078045.1 (SMESG000078045.1)

HSP 1 Score: 1896.32 bits (4911), Expect = 0.000e+0
Identity = 954/956 (99.79%), Postives = 956/956 (100.00%), Query Frame = 2
Query:  215 MKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQKESTDILTDPSLNGNHIGDVITGNLVNXXXXXXXXXTHVSNVNITTPNAKDSINDIFDQLSNISDNNSINQTTVSHIDGGTVSIPIKKQKKYNNIFRRKRNSPSNGVTQKQLQDTDKEKSSQSLGEYMVDDEGYTIKPNDPWPXXXXXXXXXXXXXXXXXXXIFKAIKIEIKPKDNKSDSSSIPDNDLPIKAKSKNNDNLELFKAVQAFKISPNIFRDGNRRTGDSRSNTPSLPNVLADDGSPPTSTRLNSISVSIRDSRRKKNSRSQSEQAQSLAQPYFQVEFTNSFESNGLDLAGVTSDPFNSRFESFQSSKADLPLKTNENKIDPWGSSTVNDKSIQPPPLPAKITPPRSASTVPFSNSTIESRKFSSIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQSSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWEPSTNTTGFCV 3082
            MKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQKESTDILTDPSLNGNHIGDVITGNLVNIDSSSDISSTHVSNVNITTPNAKDSINDIFDQLSNISDNNSINQTTVSHIDGGTVSIPIKKQKKYNNIFRRKRNSPSNGVTQKQLQDTDKEKSSQSLGEYMVDDEGYTIKPNDPWPDHNQ+SSSDSSSDDDNADNIFKAIKIEIKPKDNKSDSSSIPDNDLPIKAKSKNNDNLELFKAVQAFKISPNIFRDGNRRTGDSRSNTPSLPNVLADDGSPPTSTRLNSISVSIRDSRRKKNSRSQSEQAQSLAQPYFQVEFTNSFESNGLDLAGVTSDPFNSRFESFQSSKADLPLKTNENKIDPWGSSTVNDKSIQPPPLPAKITPPRSASTVPFSNSTIESRKFSSIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCL+QASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQSSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWEPSTNTTGFCV
Sbjct:    1 MKTGVKSSSEFLDFLREIYSMEDSCTKSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAVQKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFHKLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLESCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTVDTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQKESTDILTDPSLNGNHIGDVITGNLVNIDSSSDISSTHVSNVNITTPNAKDSINDIFDQLSNISDNNSINQTTVSHIDGGTVSIPIKKQKKYNNIFRRKRNSPSNGVTQKQLQDTDKEKSSQSLGEYMVDDEGYTIKPNDPWPDHNQHSSSDSSSDDDNADNIFKAIKIEIKPKDNKSDSSSIPDNDLPIKAKSKNNDNLELFKAVQAFKISPNIFRDGNRRTGDSRSNTPSLPNVLADDGSPPTSTRLNSISVSIRDSRRKKNSRSQSEQAQSLAQPYFQVEFTNSFESNGLDLAGVTSDPFNSRFESFQSSKADLPLKTNENKIDPWGSSTVNDKSIQPPPLPAKITPPRSASTVPFSNSTIESRKFSSIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFSNTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLTQASRLRNVEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNVDIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEVASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGRASWRLDLSTNQSSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTGNRFRISRHKYRLISGRYVWEPSTNTTGFCV 956          
The following BLAST results are available for this feature:
BLAST of F-BAR domain only protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FCHO21.154e-4334.29FCH and mu domain containing endocytic adaptor 2 [... [more]
FCHO21.280e-4234.29FCH and mu domain containing endocytic adaptor 2 [... [more]
FCHO12.802e-3829.12FCH and mu domain containing endocytic adaptor 1 [... [more]
FCHO13.037e-3829.12FCH and mu domain containing endocytic adaptor 1 [... [more]
FCHO13.037e-3829.12FCH and mu domain containing endocytic adaptor 1 [... [more]
back to top
BLAST of F-BAR domain only protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
fcho-18.789e-3127.82FCH domain Only (FCH stands for Fes/CIP4 homology ... [more]
fcho-11.476e-2125.56FCH domain Only (FCH stands for Fes/CIP4 homology ... [more]
back to top
BLAST of F-BAR domain only protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG81763.595e-4535.29gene:FBgn0037702 transcript:FBtr0334650[more]
CG81763.595e-4535.29gene:FBgn0037702 transcript:FBtr0082065[more]
CG81767.270e-4535.29gene:FBgn0037702 transcript:FBtr0334651[more]
CG81767.270e-4535.29gene:FBgn0037702 transcript:FBtr0113207[more]
CG81767.678e-4535.29gene:FBgn0037702 transcript:FBtr0334652[more]
back to top
BLAST of F-BAR domain only protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fcho23.779e-4535.03FCH and mu domain containing endocytic adaptor 2 [... [more]
fcho25.746e-4535.03FCH and mu domain containing endocytic adaptor 2 [... [more]
fcho21.902e-3934.75pep chromosome:GRCz11:CHR_ALT_CTG5_1_30:35169667:3... [more]
fcho13.205e-3832.73FCH and mu domain containing endocytic adaptor 1 [... [more]
fcho18.039e-3731.12FCH and mu domain containing endocytic adaptor 1 [... [more]
back to top
BLAST of F-BAR domain only protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fcho22.085e-4337.72FCH and mu domain containing endocytic adaptor 2 [... [more]
pak68.830e-4234.07p21 protein (Cdc42/Rac)-activated kinase 6 [Source... [more]
fcho22.168e-3836.50FCH and mu domain containing endocytic adaptor 2 [... [more]
fcho23.973e-3836.50FCH and mu domain containing endocytic adaptor 2 [... [more]
fcho23.154e-3735.87FCH and mu domain containing endocytic adaptor 2 [... [more]
back to top
BLAST of F-BAR domain only protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fcho21.109e-4434.91FCH domain only 2 [Source:MGI Symbol;Acc:MGI:35057... [more]
Fcho22.027e-4435.16FCH domain only 2 [Source:MGI Symbol;Acc:MGI:35057... [more]
Fcho22.661e-4434.91FCH domain only 2 [Source:MGI Symbol;Acc:MGI:35057... [more]
Fcho22.999e-4434.91FCH domain only 2 [Source:MGI Symbol;Acc:MGI:35057... [more]
Fcho23.761e-4434.91FCH domain only 2 [Source:MGI Symbol;Acc:MGI:35057... [more]
back to top
BLAST of F-BAR domain only protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|D3ZYR1|FCHO2_RAT8.600e-4435.16F-BAR domain only protein 2 OS=Rattus norvegicus O... [more]
sp|Q3UQN2|FCHO2_MOUSE1.418e-4335.16F-BAR domain only protein 2 OS=Mus musculus OX=100... [more]
sp|Q5R807|FCHO2_PONAB1.603e-4334.64F-BAR domain only protein 2 OS=Pongo abelii OX=960... [more]
sp|Q502I9|FCHO2_DANRE3.924e-4334.35F-BAR domain only protein 2 OS=Danio rerio OX=7955... [more]
sp|Q0JRZ9|FCHO2_HUMAN5.539e-4334.29F-BAR domain only protein 2 OS=Homo sapiens OX=960... [more]
back to top
BLAST of F-BAR domain only protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A224Z5G61.770e-7626.85Proline serine threonine phosphatase interacting p... [more]
A0A183AXU14.693e-6240.97F-BAR domain-containing protein OS=Echinostoma cap... [more]
A0A4E0S0B55.520e-6141.90FCH domain only protein 2 OS=Fasciola hepatica OX=... [more]
A0A5J4NMJ21.546e-5939.02F-BAR domain only protein OS=Paragonimus westerman... [more]
A0A183WKJ91.330e-5840.29F-BAR domain-containing protein OS=Trichobilharzia... [more]
back to top
BLAST of F-BAR domain only protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fcho12.226e-3931.38FCH and mu domain containing endocytic adaptor 1 [... [more]
fcho24.130e-2928.25FCH and mu domain containing endocytic adaptor 2 [... [more]
sgip1a2.638e-2727.74SH3GL interacting endocytic adaptor 1a [Source:ZFI... [more]
sgip1b2.965e-2225.73SH3GL interacting endocytic adaptor 1b [Source:ZFI... [more]
pstpip1a4.875e-620.49proline-serine-threonine phosphatase interacting p... [more]
back to top
BLAST of F-BAR domain only protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007464.11.015e-4435.96pep scaffold:Pmarinus_7.0:GL477111:2188:43613:-1 g... [more]
gas7a1.556e-921.79growth arrest-specific 7a [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of F-BAR domain only protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of F-BAR domain only protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO362388.968e-3633.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405581.300e-1023.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348083.804e-822.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438729.656e-720.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of F-BAR domain only protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fcho17.662e-4533.58F-BAR domain only protein 1 [Source:NCBI gene;Acc:... [more]
fcho22.184e-4233.92FCH and mu domain containing endocytic adaptor 2 [... [more]
sgip1a2.114e-2728.76SH3GL interacting endocytic adaptor 1 [Source:NCBI... [more]
SGIP11.725e-2627.04SH3-containing GRB2-like protein 3-interacting pro... [more]
sgip1a1.832e-2326.14SH3GL interacting endocytic adaptor 1 [Source:NCBI... [more]
back to top
BLAST of F-BAR domain only protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000078045.10.000e+099.80SMESG000078045.1[more]
SMESG000078045.10.000e+099.79SMESG000078045.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014362 ID=SMED30014362|Name=F-BAR domain only protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=3154bp
AACTGTATTATTTAATTTTCTATTTAATTTACTTATAAGGGAAAAATTAA
ATATCTAAATTAAATATTTCAATTTAGTAAAGTTTATCTAAAAATTCAAA
TCCTGAAATTCTAATTTTTTCAAGCTATTTGTAGGAAGTCGAATGGAAAC
TTTAACTTTCAGTGATAATTTTTGGGGAGATAAACATCAGGGTTTTGATG
TCTTGTATCAAAATATGAAAACCGGTGTTAAGAGTAGTTCGGAATTTTTA
GACTTTTTACGTGAAATATATTCCATGGAAGATTCGTGTACAAAATCATG
GAATAAATTATCAAAACAAATTAATGTCAACTCCTCAGGTTCTTTACAGC
CATTTTGGCAAGCCATTAAAGAGTTATCAGAAAAACGAAGCACTGCACAT
ATGGAATTAAGTCAAAATATACAATTGATAATAAAAGCTGTGCAAAAATA
TATGGATGAACAACAACTAAAACAAAAGTCCACAAAAGATTTAGATTTGC
AAACTCAGAATATTAATAGTCTCTTAGTGAACACTTCAACTCAGTTGATT
CGAGCAAGAGATGTGTATCATGCTCGATTTTTGGAATTTCACAAACTCCA
CAAATCAGATCAAAATAACGGCAATAGATCTCGAGACATAGAACGAATGG
AAGCAAAACTTAAAAAAGCTGTTGATGATTATAAATATCTCATAGAAAAA
TATAACAATACTTGCACAAAATTCAAATCAAAAATGTTGGAGTCTTGTAA
TAGCTTTCAGGAAATTGAAACCTATCATTTGGAACAAATGAAAGATTTTA
TAAGTCGATTTTCGACTCATTTATTCAAAGTTCAATGTGAGTTTAATGAA
CAACAAACAGCATTTGAAAAAACTCAAAGGAAATTAACCGTTGACACGTT
GCTAGAAATGTTTATTAAATCAAAATCAACTGGGAAAATTCCACCGAAAC
ACGCTATGTTTGAAGACGCAGAATCATCGGACATTAAGTCTCAAGATAAT
AAAATTCAAAAGGAAAGCACTGATATATTAACCGATCCTTCATTAAATGG
CAATCATATTGGTGATGTAATCACGGGAAATCTTGTCAACATTGACTCAT
CCTCCGATATATCTAGTACTCATGTCAGCAACGTAAATATTACAACTCCA
AATGCCAAAGATAGCATAAATGACATTTTTGATCAATTGAGTAATATCAG
TGATAATAATAGCATTAACCAAACAACCGTGTCTCACATTGATGGTGGTA
CTGTGTCGATTCCAATAAAAAAACAAAAGAAATACAATAATATCTTTCGC
AGAAAACGTAATTCTCCGTCAAATGGTGTTACACAGAAACAACTCCAAGA
CACAGATAAGGAAAAGAGTTCTCAAAGTTTAGGTGAATACATGGTAGACG
ATGAAGGATATACAATAAAACCCAATGATCCATGGCCTGATCATAACCAG
AACAGTAGCTCTGATTCCTCAAGCGATGATGATAATGCAGACAATATCTT
CAAAGCCATTAAAATTGAAATTAAACCAAAAGATAATAAATCTGATTCTT
CAAGTATTCCCGACAATGATTTACCGATTAAAGCCAAATCAAAAAATAAT
GACAATTTGGAATTATTCAAAGCTGTTCAAGCATTTAAAATTTCCCCTAA
CATATTTCGTGACGGAAATCGTAGGACAGGAGATAGTAGATCTAACACGC
CATCTTTACCTAATGTACTTGCTGATGATGGCTCACCTCCAACGTCAACA
AGATTGAATTCTATTTCAGTTTCTATTCGCGACTCTCGTCGTAAGAAAAA
CAGTCGTTCGCAATCAGAACAAGCACAATCGTTAGCCCAACCATATTTTC
AGGTTGAATTTACGAACTCCTTTGAATCGAATGGACTCGATTTAGCCGGA
GTTACAAGTGATCCATTCAATTCTCGGTTTGAATCTTTTCAAAGTTCAAA
AGCCGATTTGCCTCTTAAAACTAATGAAAACAAAATCGATCCTTGGGGTA
GCAGCACGGTTAACGATAAATCAATTCAGCCTCCTCCACTTCCAGCGAAA
ATAACTCCACCGCGTTCTGCAAGCACAGTTCCATTCTCAAACTCAACGAT
AGAATCTAGGAAATTTAGTTCGATCCCTTCGAACACTATTCCAGCGACTC
CCGTTAGGTTGTCAATCAATTCCATTGAAGGAATTCCATTGGCAATTGCT
TTTACAGAAACTGTTAACGCAAAATTCAGAGAATCTTTCAGCAACACTCC
TCACGATGTACATACAAGTGGACAACTGGTCATTTCATTTCCTTGTTCTA
TGCTTCAGCAATTTGAAAGTGTCGGTGAAAACCAGTTGAATCTGGCCGAG
CCCATTCATTTTTGCTTATCCCAAGCTAGTAGGCTTCGTAATGTTGAACC
ATTACCGACGAGCAAAGATATTAATATACAAATTGATAATCCAACAGATG
ATTCTTATTCTATATATATAGATTTATTTACTTTACATAAAAAATTGACT
ACTCTTAGAAGAAATGAACCCGCATCGCCTTTCTTTAACGTTGATATTAT
TCGATATGACGTCACAAATAATGTTCGACCAAACGGTAGCATTAATGCTC
CAGTTCATATTTCTGCAAATTGGCAAATTACTGATACTCTCGCCAGTCAT
CTCATGATCAACTATAATTTTCAATGGCCAAATACAGAAGTTGCGTCTCT
CACTTTCAGGCCTTCGCCAGCCAAAAGTGGAAATTCTGAAATACGGCCTC
ATGGAGAAGTTCGTTTTTTAGTTATTGCCGATGGTTCTCCCTTCAAAATG
CAAAGTCTTCCTCCGAGTATTTGGAATAGTGATTTAGGCCGAGCTTCTTG
GAGGCTGGATTTATCCACCAATCAAAGTAGCATAAAGTCGAAATTCATGC
TATCTAACGGTCCTGGAACTCCTCAACCAGTGGTTTGTCAATTCTCAGCC
GAAGGCTCAATTGAAAGTGGCGTCCTTTTACAAGTCACTGGCAATCGATT
TCGCATTTCACGCCATAAATATCGGTTGATTTCCGGGAGATATGTTTGGG
AACCATCCACTAACACGACTGGGTTTTGTGTGTAAATGCAGATTATATTT
TATTTTAATATTATTGTGATTTATTAATGAAAATATTATAAATAATAATA
TTAT
back to top

protein sequence of SMED30014362-orf-1

>SMED30014362-orf-1 ID=SMED30014362-orf-1|Name=SMED30014362-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=981bp
METLTFSDNFWGDKHQGFDVLYQNMKTGVKSSSEFLDFLREIYSMEDSCT
KSWNKLSKQINVNSSGSLQPFWQAIKELSEKRSTAHMELSQNIQLIIKAV
QKYMDEQQLKQKSTKDLDLQTQNINSLLVNTSTQLIRARDVYHARFLEFH
KLHKSDQNNGNRSRDIERMEAKLKKAVDDYKYLIEKYNNTCTKFKSKMLE
SCNSFQEIETYHLEQMKDFISRFSTHLFKVQCEFNEQQTAFEKTQRKLTV
DTLLEMFIKSKSTGKIPPKHAMFEDAESSDIKSQDNKIQKESTDILTDPS
LNGNHIGDVITGNLVNIDSSSDISSTHVSNVNITTPNAKDSINDIFDQLS
NISDNNSINQTTVSHIDGGTVSIPIKKQKKYNNIFRRKRNSPSNGVTQKQ
LQDTDKEKSSQSLGEYMVDDEGYTIKPNDPWPDHNQNSSSDSSSDDDNAD
NIFKAIKIEIKPKDNKSDSSSIPDNDLPIKAKSKNNDNLELFKAVQAFKI
SPNIFRDGNRRTGDSRSNTPSLPNVLADDGSPPTSTRLNSISVSIRDSRR
KKNSRSQSEQAQSLAQPYFQVEFTNSFESNGLDLAGVTSDPFNSRFESFQ
SSKADLPLKTNENKIDPWGSSTVNDKSIQPPPLPAKITPPRSASTVPFSN
STIESRKFSSIPSNTIPATPVRLSINSIEGIPLAIAFTETVNAKFRESFS
NTPHDVHTSGQLVISFPCSMLQQFESVGENQLNLAEPIHFCLSQASRLRN
VEPLPTSKDINIQIDNPTDDSYSIYIDLFTLHKKLTTLRRNEPASPFFNV
DIIRYDVTNNVRPNGSINAPVHISANWQITDTLASHLMINYNFQWPNTEV
ASLTFRPSPAKSGNSEIRPHGEVRFLVIADGSPFKMQSLPPSIWNSDLGR
ASWRLDLSTNQSSIKSKFMLSNGPGTPQPVVCQFSAEGSIESGVLLQVTG
NRFRISRHKYRLISGRYVWEPSTNTTGFCV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027267AH/BAR_dom_sf
IPR023353LemA-like_dom
IPR018808Muniscin_C
IPR001060FCH_dom
IPR031160F_BAR
Vocabulary: molecular function
TermDefinition
GO:0005546phosphatidylinositol-4,5-bisphosphate binding
GO:0035091phosphatidylinositol binding
GO:0001786phosphatidylserine binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005905clathrin-coated pit
GO:0016020membrane
GO:0030136clathrin-coated vesicle
GO:0098835presynaptic endocytic zone membrane
Vocabulary: biological process
TermDefinition
GO:0006897endocytosis
GO:0010324membrane invagination
GO:0048268clathrin coat assembly
GO:0048488synaptic vesicle endocytosis
GO:0072583clathrin-dependent endocytosis
GO:0072659protein localization to plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 166..186
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 514..543
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 506..564
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 458..479
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 380..413
NoneNo IPR availablePANTHERPTHR23065:SF15AT02057Pcoord: 4..972
NoneNo IPR availablePANTHERPTHR23065PROLINE-SERINE-THREONINE PHOSPHATASE INTERACTING PROTEIN 1coord: 4..972
IPR001060FCH domainPFAMPF00611FCHcoord: 17..87
e-value: 1.3E-8
score: 35.0
IPR018808Muniscin C-terminalPFAMPF10291muHDcoord: 681..968
e-value: 7.0E-18
score: 65.0
IPR027267AH/BAR domain superfamilyGENE3DG3DSA:1.20.1270.60coord: 2..277
e-value: 9.5E-59
score: 201.0
IPR027267AH/BAR domain superfamilySUPERFAMILYSSF103657BAR/IMD domain-likecoord: 5..275
IPR031160F-BAR domainPROSITEPS51741F_BARcoord: 4..253
score: 16.963