SMED30014358

Overview
NameSMED30014358
Smed IDSMED30014358
Length (bp)1205
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30014358 (SMED30014358) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30014358 (SMED30014358) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014358

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014358SMESG000068926.1 Contig1864newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014358SMESG000068926.1 Contig1864uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014358SMESG000015161.1 Contig1864newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014358SMESG000015161.1 Contig1864uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30014358SMESG000068926.1 dd_Smed_v4_11780_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30014358 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002024:33141..53567 -5821
Homology
BLAST of SMED30014358 vs. TrEMBL
Match: R7U9B9 (Uncharacterized protein (Fragment) OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_51336 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 5.676e-8
Identity = 46/155 (29.68%), Postives = 76/155 (49.03%), Query Frame = 3
Query:  456 TNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRL-SREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKRIIKI-----NGEKHKVIKQFHVTTTVANNEPVYK-SFKRLFIQLNEVKETDYPILFHTSNLNREQCSMLISID 899
            TN  +YI S  P K+++ +F RMIW+ KV+ +  LT L        + +WP   N    + E+ +  L  KE+V   +  +R +++     NG +H  + Q+H TT   +  P +  +  RLF +L  V     PI+ H S     +   LI++D
Sbjct:   27 TNGRKYIASQGPKKKTLTDFWRMIWEQKVERIAMLTNLVENGAIKCVRYWPKEVNGDPLKSERFTVKLL-KEDVW-PDFTRRQMEVSKKGSNGARH--VTQYHYTTWPDHGVPSHATALWRLFRKLTHVANNTEPIIVHCS-AGVGRTGTLIAMD 176          
BLAST of SMED30014358 vs. TrEMBL
Match: R7VKM1 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_220101 PE=4 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 2.697e-6
Identity = 44/145 (30.34%), Postives = 71/145 (48.97%), Query Frame = 3
Query:  456 TNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHG-IHFWPALNN----TIQFQFE-----KDSFSLFTKEEVQRKNLVKRIIKINGEKHKVIKQFHVTTTVANNEPVYKS-FKRLFIQLNEVKETDYPILFHTS 857
            TN  +YI S  P  +S+ +F RMIW+ KV+ +  LT L  +  +  + +WP   N     I  QFE     +D +  FT+ +++       +IK N  + + + Q+H TT   +  P + +   RLF +L    +   PIL H S
Sbjct:  862 TNGRKYIASQGPKPKSLTDFWRMIWEQKVERIAMLTNLVEKGNNKCMQYWPEQVNGDPLKIHSQFEINLLKEDVWPDFTRRQME-------VIKKNSNRARHVTQYHYTTWPDHGVPSHATALWRLFRKLTNDADNTQPILIHCS 999          
BLAST of SMED30014358 vs. Planmine SMEST
Match: SMESG000068926.1 (SMESG000068926.1)

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 336/338 (99.41%), Postives = 336/338 (99.41%), Query Frame = 3
Query:   54 MFXXXXXXXXXXXXRFLSMKTETTEIVLETENLYQYLEEIKNYSIPRNEFHDIYESLLKDRYIPLNKEFKNLVEISMQINQEQXXXXXXXXXXXXXFDHQKQITLQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKRIIKINGEKHKVIKQFHVTTTVANNEPVYKSFKRLFIQLNEVKETDYPILFHTSNLNREQCSMLISIDKXXXXXXXXXXXXXXXXTVFQMNQYKNSMLVEERQYFDIYEYISCYLKKQSKYYDV 1067
            MFPKSLSPKSPLLKRFLSMKTE TEIVLETENLYQYLEEIKNYSIPRNEFHDIYE LLKDRYIPLNKEFKNLVEISMQINQEQSSLLSILSNISSLFDHQKQITLQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKRIIKINGEKHKVIKQFHVTTTVANNEPVYKSFKRLFIQLNEVKETDYPILFHTSNLNREQCSMLISIDKIIKSLENNEENINIYETVFQMNQYKNSMLVEERQYFDIYEYISCYLKKQSKYYDV
Sbjct:    1 MFPKSLSPKSPLLKRFLSMKTEITEIVLETENLYQYLEEIKNYSIPRNEFHDIYEGLLKDRYIPLNKEFKNLVEISMQINQEQSSLLSILSNISSLFDHQKQITLQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKRIIKINGEKHKVIKQFHVTTTVANNEPVYKSFKRLFIQLNEVKETDYPILFHTSNLNREQCSMLISIDKIIKSLENNEENINIYETVFQMNQYKNSMLVEERQYFDIYEYISCYLKKQSKYYDV 338          
BLAST of SMED30014358 vs. Planmine SMEST
Match: SMESG000068926.1 (SMESG000068926.1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 336/340 (98.82%), Postives = 336/340 (98.82%), Query Frame = 3
Query:   54 MFXXXXXXXXXXXXRFLSMKTETTEIVLETENLYQYLEEIKNYSIPRNEFHDIYESLLKDRYIPLNKEFKNLVEISMQINQEQXXXXXXXXXXXXXFDHQKQITLQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKRIIKI--NGEKHKVIKQFHVTTTVANNEPVYKSFKRLFIQLNEVKETDYPILFHTSNLNREQCSMLISIDKXXXXXXXXXXXXXXXXTVFQMNQYKNSMLVEERQYFDIYEYISCYLKKQSKYYDV 1067
            MFPKSLSPKSPLLKRFLSMKTE TEIVLETENLYQYLEEIKNYSIPRNEFHDIYE LLKDRYIPLNKEFKNLVEISMQINQEQSSLLSILSNISSLFDHQKQITLQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKRIIKI  NGEKHKVIKQFHVTTTVANNEPVYKSFKRLFIQLNEVKETDYPILFHTSNLNREQCSMLISIDKIIKSLENNEENINIYETVFQMNQYKNSMLVEERQYFDIYEYISCYLKKQSKYYDV
Sbjct:    1 MFPKSLSPKSPLLKRFLSMKTEITEIVLETENLYQYLEEIKNYSIPRNEFHDIYEGLLKDRYIPLNKEFKNLVEISMQINQEQSSLLSILSNISSLFDHQKQITLQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKRIIKIVKNGEKHKVIKQFHVTTTVANNEPVYKSFKRLFIQLNEVKETDYPILFHTSNLNREQCSMLISIDKIIKSLENNEENINIYETVFQMNQYKNSMLVEERQYFDIYEYISCYLKKQSKYYDV 340          
BLAST of SMED30014358 vs. Planmine SMEST
Match: SMESG000068926.1 (SMESG000068926.1)

HSP 1 Score: 579.711 bits (1493), Expect = 0.000e+0
Identity = 318/320 (99.38%), Postives = 318/320 (99.38%), Query Frame = 3
Query:  108 MKTETTEIVLETENLYQYLEEIKNYSIPRNEFHDIYESLLKDRYIPLNKEFKNLVEISMQINQEQXXXXXXXXXXXXXFDHQKQITLQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKRIIKINGEKHKVIKQFHVTTTVANNEPVYKSFKRLFIQLNEVKETDYPILFHTSNLNREQCSMLISIDKXXXXXXXXXXXXXXXXTVFQMNQYKNSMLVEERQYFDIYEYISCYLKKQSKYYDV 1067
            MKTE TEIVLETENLYQYLEEIKNYSIPRNEFHDIYE LLKDRYIPLNKEFKNLVEISMQINQEQSSLLSILSNISSLFDHQKQITLQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKRIIKINGEKHKVIKQFHVTTTVANNEPVYKSFKRLFIQLNEVKETDYPILFHTSNLNREQCSMLISIDKIIKSLENNEENINIYETVFQMNQYKNSMLVEERQYFDIYEYISCYLKKQSKYYDV
Sbjct:    1 MKTEITEIVLETENLYQYLEEIKNYSIPRNEFHDIYEGLLKDRYIPLNKEFKNLVEISMQINQEQSSLLSILSNISSLFDHQKQITLQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKRIIKINGEKHKVIKQFHVTTTVANNEPVYKSFKRLFIQLNEVKETDYPILFHTSNLNREQCSMLISIDKIIKSLENNEENINIYETVFQMNQYKNSMLVEERQYFDIYEYISCYLKKQSKYYDV 320          
BLAST of SMED30014358 vs. Planmine SMEST
Match: SMESG000068931.1 (SMESG000068931.1)

HSP 1 Score: 165.236 bits (417), Expect = 3.791e-47
Identity = 108/324 (33.33%), Postives = 194/324 (59.88%), Query Frame = 3
Query:   96 RFLSMKTETTEIVLETENLYQYLEEIKNYSIPRNEFHDIYESLLKDRYIPLNKEFKNLVEISMQINQEQXXXXXXXXXXXXXFDHQKQITLQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKR--IIKINGEKHKVIKQFHVTTTVANNEPVYKSFKRLFIQLNEVKETD--YPILFHTSNLNREQCSMLISIDKXXXXXXXXXXXXXXXXTVFQMNQYKNSMLVEERQYFDIYEYISCYLKKQSK 1055
            R +S K  +++   E     Q   ++ N +I  +EF + Y+ L  + ++ L KE+K+L+  SM + + + ++ + + ++S++  H +   +Q  +L+V +S S +S++ LD  +I +  +   IQYI+S DPS++SI +F +MIW+  + Y++TLT++S+ K     +W + +    +  +K S+ +   +E    NL +R  I++ N  + + I Q H+ T+   N+ V   +++LFI+L+E+K     YP+LFH+SN N +QC+MLI IDKII +L    + +NIY  + ++NQY+N ML +E  Y  IYEYI  +L+K  K
Sbjct:   15 RMMSQKKRSSKHKTEEPQPVQEEAKVLNRAIRISEFKNEYKKLCCNDFVILKKEYKDLINESMTMKESEYNIWTSIESMSNINLHDRIHIVQVDNLRVTMSSSLFSNAKLDAVFIPDQVKHQVIQYIVSQDPSEDSIFDFFQMIWELNISYLITLTKISKRKGFIYEYWDSKSENKTYSKDKVSYKIKKTKETNSGNLTERLFILENNNLECREITQLHLMTSTCQNDSVLNYYEKLFIKLHEIKSLGLCYPLLFHSSNSNLDQCAMLICIDKIISTLAFGSDMVNIYRMMLELNQYRNLMLQQECHYLYIYEYIDWFLRKSFK 338          
BLAST of SMED30014358 vs. Planmine SMEST
Match: SMESG000068923.1 (SMESG000068923.1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.307e-20
Identity = 67/234 (28.63%), Postives = 120/234 (51.28%), Query Frame = 3
Query:  366 LQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKESIVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFSLFTKEEVQRKNLVKRIIKING---EKHKVIKQFHVTTTVANNEPVYKSFKRLFIQLNEV---KETDYPILFHTSNLNREQCSMLISIDKXXXXXXXXXXXXXXXXTVFQMNQYKNSMLVEERQYFDIYEYISCYLKKQ 1049
            LQ  D+ V   +  +S+  L   YI+     N ++YI S DP  ES+ +FL+MIW+ K+  +V +  L   +     +WP    +  +  +   + + T+ E    N++ R + I     E+ ++I Q  ++     NE    +F  L +++ EV   K+  + ILFH    N   C++LI +D+II S+E      N+YETV ++ Q ++ ++  E QY +IY+ +  +LK +
Sbjct:   62 LQVKDINVISKKLPFSNQNLKANYIYQTINENLLEYIASNDPDYESVSDFLQMIWECKITLIVRIKELYETQNDTCEYWPPNLESNNYCNQSSCYKIKTQNESISNNIIIRKLLIQNVKYEETRIIVQIEISIDTKLNENTASTFDSLLLEIQEVKSIKDRSHRILFHARENNLHHCAVLICLDQIITSVEAGISEFNVYETVLRICQSRSMLIKNENQYINIYQSVYRFLKSK 295          
The following BLAST results are available for this feature:
BLAST of SMED30014358 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014358 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014358 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014358 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014358 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014358 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014358 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014358 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
R7U9B95.676e-829.68Uncharacterized protein (Fragment) OS=Capitella te... [more]
R7VKM12.697e-630.34Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of SMED30014358 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014358 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014358 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014358 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014358 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014358 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068926.10.000e+099.41SMESG000068926.1[more]
SMESG000068926.10.000e+098.82SMESG000068926.1[more]
SMESG000068926.10.000e+099.38SMESG000068926.1[more]
SMESG000068931.13.791e-4733.33SMESG000068931.1[more]
SMESG000068923.11.307e-2028.63SMESG000068923.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014358 ID=SMED30014358|Name=SMED30014358|organism=Schmidtea mediterranea sexual|type=transcript|length=1205bp
GACAAATTTCATTAGTATGATTCGATTTCATTAATAAAATAGATATTATT
GCGATGTTCCCAAAATCCTTATCACCAAAATCGCCATTACTAAAACGATT
TCTTTCCATGAAAACGGAAACAACTGAAATTGTTTTGGAAACAGAGAACC
TCTATCAGTACCTGGAAGAAATAAAAAATTATTCAATTCCTAGGAATGAG
TTTCACGATATTTACGAAAGTCTTCTCAAAGACAGATACATTCCTTTGAA
TAAAGAATTTAAAAACTTGGTTGAAATCTCTATGCAAATTAATCAAGAAC
AATCTAGCCTACTCAGTATACTGTCCAACATAAGTTCCTTGTTTGACCAT
CAAAAGCAGATCACTCTGCAAGCTTTGGATTTGAAAGTATACATATCCCA
ATCGTTTTATTCCAGCAGCGGACTAGATTGTACATATATACACAATGATA
GACAAACGAATTGCATTCAGTACATCATATCAACCGATCCATCCAAAGAG
AGTATTGTAGAATTTCTTCGAATGATCTGGAAATCAAAAGTAAAATATGT
GGTAACCCTCACCAGGCTCAGTAGGGAGAAGTTTCACGGAATTCATTTTT
GGCCAGCATTAAACAATACAATACAATTTCAATTTGAAAAAGATTCATTC
AGCCTCTTTACAAAAGAAGAAGTTCAAAGAAAAAACTTAGTGAAAAGAAT
CATAAAAATTAATGGAGAAAAACATAAAGTCATCAAGCAGTTCCACGTTA
CAACGACGGTAGCTAATAACGAACCCGTGTATAAATCGTTTAAAAGGCTT
TTTATCCAACTAAACGAGGTCAAGGAAACAGATTACCCAATTTTATTTCA
TACCAGTAACCTAAACCGAGAACAGTGCTCGATGCTCATTTCCATTGACA
AGATTATTAAAAGTTTGGAAAACAACGAAGAAAATATAAATATCTACGAA
ACCGTTTTTCAAATGAATCAATATAAGAACAGTATGCTAGTTGAAGAGCG
CCAGTATTTCGACATCTATGAATACATCAGCTGCTATTTGAAGAAACAAT
CTAAATATTATGACGTTTAGATGATTGAATAAGAATCTTAAACCCAGAAA
TCTACTGATAAACTATAATTATTTTTATTTTAAATTATCAGATTTACTTT
TTGAATTTCTTTAATGAAATTTGTATTTTCTTTTTGGACAGAATTTCATG
AAAGC
back to top

protein sequence of SMED30014358-orf-1

>SMED30014358-orf-1 ID=SMED30014358-orf-1|Name=SMED30014358-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=339bp
MFPKSLSPKSPLLKRFLSMKTETTEIVLETENLYQYLEEIKNYSIPRNEF
HDIYESLLKDRYIPLNKEFKNLVEISMQINQEQSSLLSILSNISSLFDHQ
KQITLQALDLKVYISQSFYSSSGLDCTYIHNDRQTNCIQYIISTDPSKES
IVEFLRMIWKSKVKYVVTLTRLSREKFHGIHFWPALNNTIQFQFEKDSFS
LFTKEEVQRKNLVKRIIKINGEKHKVIKQFHVTTTVANNEPVYKSFKRLF
IQLNEVKETDYPILFHTSNLNREQCSMLISIDKIIKSLENNEENINIYET
VFQMNQYKNSMLVEERQYFDIYEYISCYLKKQSKYYDV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR029021Prot-tyrosine_phosphatase-like
IPR003595Tyr_Pase_cat
IPR000242PTPase_domain
Vocabulary: molecular function
TermDefinition
GO:0004725protein tyrosine phosphatase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000242PTP type protein phosphataseSMARTSM00194PTPc_3coord: 32..330
e-value: 1.5E-4
score: -37.0
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 128..325
e-value: 9.1E-17
score: 61.4
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 80..328
score: 16.08
IPR003595Protein-tyrosine phosphatase, catalyticSMARTSM00404ptp_7coord: 226..327
e-value: 0.0052
score: 15.4
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 26..337
e-value: 1.1E-22
score: 82.7
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 132..336
NoneNo IPR availablePANTHERPTHR19134PROTEIN-TYROSINE PHOSPHATASEcoord: 113..331
NoneNo IPR availableCDDcd00047PTPccoord: 128..323
e-value: 7.1738E-17
score: 75.7848