slc27a-1

Overview
Nameslc27a-1 (AKN21615.1)
Smed IDSMED30014353
Length (bp)2220
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc27a-1 (SMED30014353) t-SNE clustered cells

Violin plots show distribution of expression levels for slc27a-1 (SMED30014353) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc27a-1 (SMED30014353) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc27a-1 (SMED30014353) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014353

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30014353SMESG000064689.1 dd_Smed_v4_4057_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014353SMESG000064689.1 dd_Smed_v4_4057_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc27a-1 vs. Ensembl Human
Match: SLC27A1 (solute carrier family 27 member 1 [Source:HGNC Symbol;Acc:HGNC:10995])

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 297/622 (47.75%), Postives = 409/622 (65.76%), Query Frame = 3
Query:  189 SLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFL--FEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            +L +Y   GGW+F++I+  T  RD  GL  L++V+  +    R  HTIP IF+  VQR+   +A +     E WTF+ +D Y+N +AN   +LG   GD +A+F+E RP +V +W+G++K G   AL+N NLR+E L  C+    A  LI G E+ +A+ E++  + K  +   F  G L    P   L  +   +LD ++   S    P  +  ++ + D L +I+TSGTTGLPKAA V H+R+  M+        +Q +D++Y+ LPLYH+AG +IGVGQ +I G  + +RKKFSAS +W DCIKY  TVVQYIGEICRYLL QP+R  E +H VRLA GNG+RP IW EF  RF ++QIGEFYGATE N +I N   KVGS GF +RILP VYPI L+K++ +T   LRD  GLCI C+  E G LVG+I+ +DP+R+FDGY+S++A  +KI H VF KGD A+L+GD+L+ DELG+ YFRDR GDTFRW+GENVST EVE V+S  L   D  VYGV VP  EGKAGMA + +   + +D   + ++L++ L  YARP+F+R+   +DTTGTFK++KT L ++GF+P    D LF+LD K  HY  L+ A++ +I  G
Sbjct:   31 ALGVYVGSGGWRFLRIVCKTARRDLFGLSVLIRVRLELRRHQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEGRPEFVGLWLGLAKAGMEAALLNVNLRREPLAFCLGTSGAKALIFGGEMVAAVAEVSGHLGK--SLIKFCSGDL---GPEGILPDT--HLLDPLLKEAS--TAPLAQIPSKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAYRMQAADVLYDCLPLYHSAGNIIGVGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLKQPVREAERRHRVRLAVGNGLRPAIWEEFTERFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIRLVKVNEDTMELLRDAQGLCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSVFSKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVADP-HSLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSG 642          
BLAST of slc27a-1 vs. Ensembl Human
Match: SLC27A4 (solute carrier family 27 member 4 [Source:HGNC Symbol;Acc:HGNC:10998])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 291/621 (46.86%), Postives = 413/621 (66.51%), Query Frame = 3
Query:  192 LSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFE--DEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            L +Y   GGW+F+++ I TI RD  G + LLKVK  V   ++ R T+P +F  TV+R     A +FE  D  WTF  +D Y++ +AN+L   G+ SGD  A+FME+R  +V +W+G++K+G   ALIN NLR+++L HC+   +A  L+ G+E+ SA+ E++  +    +  +F  GS    +P  G    + + LD ++       P       +   D L +I+TSGTTGLPKAA V H+R+  M+  V     ++ +DI+Y+ LPLYH+AG ++G+GQ ++ G  + IRKKFSAS +W DCIKY  T+VQYIGE+CRYLL QP R  ENQH VR+A GNG+R  IW  F +RF I Q+ EFYGATE N ++ N  ++VG+ GF +RIL FVYPI L++++ +T   +R  +G+CI C+P E G+LVG+I  KDP+R+FDGY++  AN +KI  DVF KGD+A+LTGD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L++ D  VYGVEVP TEG+AGMA +     N  DL+   + L+++LP+YARP+F+R+   +  TGT+K +KT+L K+GF+P ++ D LFYLD +   Y  LD   + +I  G
Sbjct:   30 LFLYLGSGGWRFIRVFIKTIRRDIFGGLVLLKVKAKVRQCLQERRTVPILFASTVRRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQARGLASGDVAAIFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFGSEMASAICEVHASLDP--SLSLFCSGSW---EP--GAVPPSTEHLDPLLKDAPKHLPSCP---DKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIVYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAENQHQVRMALGNGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVRVNEDTMELIRGPDGVCIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANNKKIAKDVFKKGDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNC-DLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAG 639          
BLAST of slc27a-1 vs. Ensembl Human
Match: SLC27A1 (solute carrier family 27 member 1 [Source:HGNC Symbol;Acc:HGNC:10995])

HSP 1 Score: 469.929 bits (1208), Expect = 5.499e-159
Identity = 227/427 (53.16%), Postives = 301/427 (70.49%), Query Frame = 3
Query:  768 ILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            +LD ++   S    P  +  ++ + D L +I+TSGTTGLPKAA V H+R+  M+        +Q +D++Y+ LPLYH+AG +IGVGQ +I G  + +RKKFSAS +W DCIKY  TVVQYIGEICRYLL QP+R  E +H VRLA GNG+RP IW EF  RF ++QIGEFYGATE N +I N   KVGS GF +RILP VYPI L+K++ +T   LRD  GLCI C+  E G LVG+I+ +DP+R+FDGY+S++A  +KI H VF KGD A+L+GD+L+ DELG+ YFRDR GDTFRW+GENVST EVE V+S  L   D  VYGV VP  EGKAGMA + +   + +D   + ++L++ L  YARP+F+R+   +DTTGTFK++KT L ++GF+P    D LF+LD K  HY  L+ A++ +I  G
Sbjct:   40 LLDPLLKEAS--TAPLAQIPSKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAYRMQAADVLYDCLPLYHSAGNIIGVGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLKQPVREAERRHRVRLAVGNGLRPAIWEEFTERFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIRLVKVNEDTMELLRDAQGLCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSVFSKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVADP-HSLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSG 463          
BLAST of slc27a-1 vs. Ensembl Human
Match: SLC27A2 (solute carrier family 27 member 2 [Source:HGNC Symbol;Acc:HGNC:10996])

HSP 1 Score: 408.683 bits (1049), Expect = 3.920e-133
Identity = 234/570 (41.05%), Postives = 324/570 (56.84%), Query Frame = 3
Query:  360 RKSSHIAFL-FEDEQWTFSDVDMYANKIANYLL-KLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYI-SDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            R++ H  FL F DE  T++ VD  +N++A  L   LG++ GD +AL M + PAYV +W+G+ K+G   A +N+N+R +SL HC     A  L+   EL +A++EI   + K        D   I        T   D  LDK+  + +   P + R        P ++I+TSGTTGLPKAA +TH R +    G++ + G++  D+IY  LP YH+A  +IG+   I+ G+ +A+R KFSAS +W DC KY  TV+QYIGE+ RYL   P +P +  H VRLA GNG+R  +W +F  RF    I EFY ATE N   +N   KVG+VG    +   +    LIK D E    +RD+NG C++    EVG LV KI    P   F+GY  + A  ++K + DVF KGD  F +GDLL+ D   F YF DR+GDTFRWKGENV+T EV   +     + +  VYGV VP  EG+ GMA+I     +  D K L + +   LP YARP F+RI   I+ TGTFK +K  L+++GFNP +I D L++LD     Y  +   I+  I    LK 
Sbjct:   64 RQTPHKPFLLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLWLGLVKLGCAMACLNYNIRAKSLLHCFQCCGAKVLLVSPELQAAVEEILPSLKK--------DDVSIYYVSRTSNTDGIDSFLDKVDEVSTEPIPESWRSEV-TFSTPALYIYTSGTTGLPKAAMITHQR-IWYGTGLTFVSGLKADDVIYITLPFYHSAALLIGIHGCIVAGATLALRTKFSASQFWDDCRKYNVTVIQYIGELLRYLCNSPQKPNDRDHKVRLALGNGLRGDVWRQFVKRFGDICIYEFYAATEGNIGFMNYARKVGAVGRVNYLQKKIITYDLIKYDVEKDEPVRDENGYCVRVPKGEVGLLVCKITQLTP---FNGYAGAKAQTEKKKLRDVFKKGDLYFNSGDLLMVDHENFIYFHDRVGDTFRWKGENVATTEVADTVGLVDFVQEVNVYGVHVPDHEGRIGMASIKMKENHEFDGKKLFQHIADYLPSYARPRFLRIQDTIEITGTFKHRKMTLVEEGFNPAVIKDALYFLDDTAKMYVPMTEDIYNAISAKTLKL 620          
BLAST of slc27a-1 vs. Ensembl Human
Match: SLC27A6 (solute carrier family 27 member 6 [Source:HGNC Symbol;Acc:HGNC:11000])

HSP 1 Score: 389.423 bits (999), Expect = 1.335e-125
Identity = 219/586 (37.37%), Postives = 331/586 (56.48%), Query Frame = 3
Query:  327 TIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLK-LGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINME-----SIQNP-PTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQR-KIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            T+ D F    +R+      ++E + +T+ DVD  ++++A+  L    +K GDT+AL M + P +V +W G++K+G V A +N N+R  SL +CI       L+ G +L   ++EI   +S+ I+                 + G  D +   +I+++     S   P P + H+   +    ++IFTSGTTGLPKAA ++  + V+    V    G    DI+Y  LPLYH++  ++G+   +  G+   ++KKFSAS +WSDC KY  TV QYIGE+CRYL  Q  R  E  H VRLA GNGIR  +W EF  RF   ++ E Y ATES+ + +N   ++G++G        +    LIK D +    +R++ G CI  K  E G L+ +++ K+P   F GY     + + K++ DVF KGD    TGDL++QD+  F YF DR GDTFRWKGENV+T EV  VI     + +  VYGV +   EG+AGMA+I+     ++DL+ + E++   LP YA P F+RI   ++ TGTFKL K  L++DGFNP  I + L+++D+    Y  L   +++QIM G +K 
Sbjct:   55 TVLDKFLSHAKRQPRKPFIIYEGDIYTYQDVDKRSSRVAHVFLNHSSLKKGDTVALLMSNEPDFVHVWFGLAKLGCVVAFLNTNIRSNSLLNCIRACGPRALVVGADLLGTVEEILPSLSENIS-----------------VWGMKDSVPQGVISLKEKLSTSPDEPVPRSHHVVSLLKSTCLYIFTSGTTGLPKAAVISQLQ-VLRGSAVLWAFGCTAHDIVYITLPLYHSSAAILGISGCVELGATCVLKKKFSASQFWSDCKKYDVTVFQYIGELCRYLCKQSKREGEKDHKVRLAIGNGIRSDVWREFLDRFGNIKVCELYAATESSISFMNYTGRIGAIGRTNLFYKLLSTFDLIKYDFQKDEPMRNEQGWCIHVKKGEPGLLISRVNAKNP---FFGYAGPYKHTKDKLLCDVFKKGDVYLNTGDLIVQDQDNFLYFWDRTGDTFRWKGENVATTEVADVIGMLDFIQEANVYGVAISGYEGRAGMASIILKPNTSLDLEKVYEQVVTFLPAYACPRFLRIQEKMEATGTFKLLKHQLVEDGFNPLKISEPLYFMDNLKKSYVLLTRELYDQIMLGEIKL 619          
BLAST of slc27a-1 vs. Ensembl Celegans
Match: acs-22 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q18916])

HSP 1 Score: 476.863 bits (1226), Expect = 1.773e-159
Identity = 258/617 (41.82%), Postives = 362/617 (58.67%), Query Frame = 3
Query:  225 FMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLF--EDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFV---YPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPV--YARPLFIRICRNIDTTGTFKLKKTDLMKDGFN-PNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGL 2051
            F +  + T+PRDF GL  L+ VK  +  + +    I +IF   V++  + +A +      Q T+ +++  AN+ AN  +  G K GD +ALFME+   + AIW+G+SKIG V A IN NL+ E L H IN  K    I    L    +   +         +F+ G+ +  +          + L + +++ S   PP    +  +    L +I+TSGTTG PK A + H R+  ++ G  +  GI +SD++Y  +P+YH+A G++G+G +I  GS   IRKKFSAS +W DC+KY  T  QYIGEICRYLL     PEE QHNVRL +GNG+R QIW EF  RF IK+IGE YG+TE N+NI+N  N VG+ GF   I P +   YP+ LIK+D  TG   RDKNGLC+ C P E GE+VG I +KD + +F+GY+S+    +KI  DVF  GD+ F +GD+L  D+LG+ YF DR GDTFRWKGENVST EVE ++   +++ D  VYGV V   EG+AGMA IV      ++  + D   +    +  YA P+FIR+C+ +D TGTFKLKKTDL K G++      D ++Y       Y  L   + + I  G+
Sbjct:   44 FGRRALATLPRDFAGLKLLISVKSTIRGLFKKDRPIHEIFLNQVKQHPNKVAIIEIESGRQLTYQELNALANQYANLYVSEGYKMGDVVALFMENSIDFFAIWLGLSKIGVVSAFINSNLKLEPLAHSINVSKCKSCITNINLLPMFKAAREKNLISDEIHVFLAGTQVDGR---------HRSLQQDLHLFSEDEPPVIDGLNFR--SVLCYIYTSGTTGNPKPAVIKHFRYFWIAMGAGKAFGINKSDVVYITMPMYHSAAGIMGIGSLIAFGSTAVIRKKFSASNFWKDCVKYNVTATQYIGEICRYLLAANPCPEEKQHNVRLMWGNGLRGQIWKEFVGRFGIKKIGELYGSTEGNSNIVNVDNHVGACGF-MPIYPHIGSLYPVRLIKVDRATGELERDKNGLCVPCVPGETGEMVGVIKEKDILLKFEGYVSEGDTAKKIYRDVFKHGDKVFASGDILHWDDLGYLYFVDRCGDTFRWKGENVSTTEVEGILQPVMDVEDATVYGVTVGKMEGRAGMAGIVVKDGTDVEKFIADITSRLTENLASYAIPVFIRLCKEVDRTGTFKLKKTDLQKQGYDLVACKGDPIYYWSAAEKSYKPLTDKMQQDIDTGV 648          
BLAST of slc27a-1 vs. Ensembl Celegans
Match: acs-22 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q18916])

HSP 1 Score: 476.478 bits (1225), Expect = 2.494e-159
Identity = 258/617 (41.82%), Postives = 362/617 (58.67%), Query Frame = 3
Query:  225 FMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLF--EDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFV---YPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPV--YARPLFIRICRNIDTTGTFKLKKTDLMKDGFN-PNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGL 2051
            F +  + T+PRDF GL  L+ VK  +  + +    I +IF   V++  + +A +      Q T+ +++  AN+ AN  +  G K GD +ALFME+   + AIW+G+SKIG V A IN NL+ E L H IN  K    I    L    +   +         +F+ G+ +  +          + L + +++ S   PP    +  +    L +I+TSGTTG PK A + H R+  ++ G  +  GI +SD++Y  +P+YH+A G++G+G +I  GS   IRKKFSAS +W DC+KY  T  QYIGEICRYLL     PEE QHNVRL +GNG+R QIW EF  RF IK+IGE YG+TE N+NI+N  N VG+ GF   I P +   YP+ LIK+D  TG   RDKNGLC+ C P E GE+VG I +KD + +F+GY+S+    +KI  DVF  GD+ F +GD+L  D+LG+ YF DR GDTFRWKGENVST EVE ++   +++ D  VYGV V   EG+AGMA IV      ++  + D   +    +  YA P+FIR+C+ +D TGTFKLKKTDL K G++      D ++Y       Y  L   + + I  G+
Sbjct:   47 FGRRALATLPRDFAGLKLLISVKSTIRGLFKKDRPIHEIFLNQVKQHPNKVAIIEIESGRQLTYQELNALANQYANLYVSEGYKMGDVVALFMENSIDFFAIWLGLSKIGVVSAFINSNLKLEPLAHSINVSKCKSCITNINLLPMFKAAREKNLISDEIHVFLAGTQVDGR---------HRSLQQDLHLFSEDEPPVIDGLNFR--SVLCYIYTSGTTGNPKPAVIKHFRYFWIAMGAGKAFGINKSDVVYITMPMYHSAAGIMGIGSLIAFGSTAVIRKKFSASNFWKDCVKYNVTATQYIGEICRYLLAANPCPEEKQHNVRLMWGNGLRGQIWKEFVGRFGIKKIGELYGSTEGNSNIVNVDNHVGACGF-MPIYPHIGSLYPVRLIKVDRATGELERDKNGLCVPCVPGETGEMVGVIKEKDILLKFEGYVSEGDTAKKIYRDVFKHGDKVFASGDILHWDDLGYLYFVDRCGDTFRWKGENVSTTEVEGILQPVMDVEDATVYGVTVGKMEGRAGMAGIVVKDGTDVEKFIADITSRLTENLASYAIPVFIRLCKEVDRTGTFKLKKTDLQKQGYDLVACKGDPIYYWSAAEKSYKPLTDKMQQDIDTGV 651          
BLAST of slc27a-1 vs. Ensembl Celegans
Match: acs-20 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q19878])

HSP 1 Score: 460.299 bits (1183), Expect = 1.177e-152
Identity = 251/617 (40.68%), Postives = 363/617 (58.83%), Query Frame = 3
Query:  243 LTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFL--FEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHS-ALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPF---VYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIV-----ESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            LT+ RD  GL  +++VK  +W  +     I ++F   V++  +  A +    +   T+++ + + N+ ANY   LG +SGD +AL+ME+   +VA WMG++KIG V A IN NL++E L HCI   K   +I    L +  L  I+  +      +++  G   +      L     K LD  I  E     P T  I       L FI+TSGTTG+PKAA + H R+  ++ G ++  GI+ SD +Y  +P+YHTA G++GVGQ ++ GS   IRKKFSAS +W DC+KY  TV QYIGEICRYLL QP+  EE++H +RL  GNG+R +IW  F  RF+++ IGE YG+TE  ++++N    VG+ GF   I P    ++P+ LIK+D  TG A+R  +GLCI C P E G +V  I   +P+ QF+GY++     +KI+ DVF KGD  FLTGDLL  D LG+ YF+DR GDTFRWKGENVST EVEA++     L+D  VYGVEVP  EG+ GMA++V     E  +     ++           YA P FIRIC++++ TGTFKL KT+L + G   +   D+++  + +  ++   D+ +  ++  G   F
Sbjct:   82 LTLNRDLTGLALIIEVKIDLWWRLHQNKGIHELFLDIVKKNPNKPAMIDIETNTTETYAEFNAHCNRYANYFQGLGYRSGDVVALYMENSVEFVAAWMGLAKIGVVTAWINSNLKREQLVHCITASKTKAIITSVTLQNIMLDAIDQKLFDVEGIEVYSVGEPKKNSGFKNL----KKKLDAQITTE-----PKTLDIV-DFKSILCFIYTSGTTGMPKAAVMKHFRYYSIAVGAAKSFGIRPSDRMYVSMPIYHTAAGILGVGQALLGGSSCVIRKKFSASNFWRDCVKYDCTVSQYIGEICRYLLAQPVVEEESRHRMRLLVGNGLRAEIWQPFVDRFRVR-IGELYGSTEGTSSLVNIDGHVGACGF-LPISPLTKKMHPVRLIKVDDVTGEAIRTSDGLCIACNPGESGAMVSTIRKNNPLLQFEGYLNKKETNKKIIRDVFAKGDSCFLTGDLLHWDRLGYVYFKDRTGDTFRWKGENVSTTEVEAILHPITGLSDATVYGVEVPQREGRVGMASVVRVVSHEEDETQFVHRVGARLASSLTS-YAIPQFIRICQDVEKTGTFKLVKTNLQRLGIM-DAPSDSIYIYNSENRNFVPFDNDLRCKVSLGSYPF 684          
BLAST of slc27a-1 vs. Ensembl Celegans
Match: acs-22 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q18916])

HSP 1 Score: 440.269 bits (1131), Expect = 5.225e-147
Identity = 236/533 (44.28%), Postives = 320/533 (60.04%), Query Frame = 3
Query:  474 GDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHIT-RKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFV---YPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPV--YARPLFIRICRNIDTTGTFKLKKTDLMKDGFN-PNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGL 2051
            GD +ALFME+   + AIW+G+SKIG V A IN NL+ E L H IN  K    I    L    +   +         +F+ G+ +  +          + L + +++ S   PP    +  R V   L +I+TSGTTG PK A + H R+  ++ G  +  GI +SD++Y  +P+YH+A G++G+G +I  GS   IRKKFSAS +W DC+KY  T  QYIGEICRYLL     PEE QHNVRL +GNG+R QIW EF  RF IK+IGE YG+TE N+NI+N  N VG+ GF   I P +   YP+ LIK+D  TG   RDKNGLC+ C P E GE+VG I +KD + +F+GY+S+    +KI  DVF  GD+ F +GD+L  D+LG+ YF DR GDTFRWKGENVST EVE ++   +++ D  VYGV V   EG+AGMA IV      ++  + D   +    +  YA P+FIR+C+ +D TGTFKLKKTDL K G++      D ++Y       Y  L   + + I  G+
Sbjct:    2 GDVVALFMENSIDFFAIWLGLSKIGVVSAFINSNLKLEPLAHSINVSKCKSCITNINLLPMFKAAREKNLISDEIHVFLAGTQVDGR---------HRSLQQDLHLFSEDEPPVIDGLNFRSV---LCYIYTSGTTGNPKPAVIKHFRYFWIAMGAGKAFGINKSDVVYITMPMYHSAAGIMGIGSLIAFGSTAVIRKKFSASNFWKDCVKYNVTATQYIGEICRYLLAANPCPEEKQHNVRLMWGNGLRGQIWKEFVGRFGIKKIGELYGSTEGNSNIVNVDNHVGACGF-MPIYPHIGSLYPVRLIKVDRATGELERDKNGLCVPCVPGETGEMVGVIKEKDILLKFEGYVSEGDTAKKIYRDVFKHGDKVFASGDILHWDDLGYLYFVDRCGDTFRWKGENVSTTEVEGILQPVMDVEDATVYGVTVGKMEGRAGMAGIVVKDGTDVEKFIADITSRLTENLASYAIPVFIRLCKEVDRTGTFKLKKTDLQKQGYDLVACKGDPIYYWSAAEKSYKPLTDKMQQDIDTGV 521          
BLAST of slc27a-1 vs. Ensembl Celegans
Match: acs-22 (Fatty Acid CoA Synthetase family [Source:UniProtKB/TrEMBL;Acc:Q18916])

HSP 1 Score: 440.269 bits (1131), Expect = 5.225e-147
Identity = 236/533 (44.28%), Postives = 320/533 (60.04%), Query Frame = 3
Query:  474 GDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHIT-RKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFV---YPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPV--YARPLFIRICRNIDTTGTFKLKKTDLMKDGFN-PNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGL 2051
            GD +ALFME+   + AIW+G+SKIG V A IN NL+ E L H IN  K    I    L    +   +         +F+ G+ +  +          + L + +++ S   PP    +  R V   L +I+TSGTTG PK A + H R+  ++ G  +  GI +SD++Y  +P+YH+A G++G+G +I  GS   IRKKFSAS +W DC+KY  T  QYIGEICRYLL     PEE QHNVRL +GNG+R QIW EF  RF IK+IGE YG+TE N+NI+N  N VG+ GF   I P +   YP+ LIK+D  TG   RDKNGLC+ C P E GE+VG I +KD + +F+GY+S+    +KI  DVF  GD+ F +GD+L  D+LG+ YF DR GDTFRWKGENVST EVE ++   +++ D  VYGV V   EG+AGMA IV      ++  + D   +    +  YA P+FIR+C+ +D TGTFKLKKTDL K G++      D ++Y       Y  L   + + I  G+
Sbjct:    2 GDVVALFMENSIDFFAIWLGLSKIGVVSAFINSNLKLEPLAHSINVSKCKSCITNINLLPMFKAAREKNLISDEIHVFLAGTQVDGR---------HRSLQQDLHLFSEDEPPVIDGLNFRSV---LCYIYTSGTTGNPKPAVIKHFRYFWIAMGAGKAFGINKSDVVYITMPMYHSAAGIMGIGSLIAFGSTAVIRKKFSASNFWKDCVKYNVTATQYIGEICRYLLAANPCPEEKQHNVRLMWGNGLRGQIWKEFVGRFGIKKIGELYGSTEGNSNIVNVDNHVGACGF-MPIYPHIGSLYPVRLIKVDRATGELERDKNGLCVPCVPGETGEMVGVIKEKDILLKFEGYVSEGDTAKKIYRDVFKHGDKVFASGDILHWDDLGYLYFVDRCGDTFRWKGENVSTTEVEGILQPVMDVEDATVYGVTVGKMEGRAGMAGIVVKDGTDVEKFIADITSRLTENLASYAIPVFIRLCKEVDRTGTFKLKKTDLQKQGYDLVACKGDPIYYWSAAEKSYKPLTDKMQQDIDTGV 521          
BLAST of slc27a-1 vs. Ensembl Fly
Match: Fatp2 (gene:FBgn0265187 transcript:FBtr0339108)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 296/666 (44.44%), Postives = 419/666 (62.91%), Query Frame = 3
Query:   81 PEMENFIENYRW-----LTFTFPFSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRK-VHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            P   NF    +W     LT      + +   +Y +   +   +SI     GW++  I  +T PRD   L + ++V  F+    R    I DIFE  V R+   +A + E +QWTF  V+ ++N++AN     G K GD + L +E+R  +VA W+G+SKIG +  LIN NLR  SL H I   + + LI G    SA+ +I  D+   +    F D S  +     GL+    + L+ +  +E+          +R   HD L++I+TSGTTGLPKAA +TH+R+  ++ G+   LG ++ D+ Y PLPLYHTAGG++ +GQ ++ GS + IRKKFSAS Y+SDC +++ TV QYIGE+ RY+L  P  P +  H VR+ FGNG+RPQIW +F  RF I+++GEFYGATE NANI+NN + VG++GF +RILP +YPI++IK DP TG  LR+  GLC +C+ +E G  VGKI   +P R+F GY+   A+ +K+VHDVF KGD AF++GDLL+ DE G+ YF+DR GDTFRWKGENVST+EVEA +SN     D +VYGV +P+TEG+AGMA I +  +  +++  L  +L + LP YARP F+R  R ID TGTFKL+K +L + GFNP +IDD LFY       YA L  +++E+I++  L+F
Sbjct:   53 PAKSNFRRYLQWILAPVLTAISGLILYYQGPWYGVATLYAALISILLVRPGWRWFYIAAVTTPRDTVALFAYIRVLLFIKRQERKNLNIGDIFESNVARQPDKLAIVSESQQWTFRQVNEHSNRVANVFHSHGYKKGDVVGLLLENRAEFVATWLGLSKIGVITPLINTNLRGASLQHSITVGQCTALIYGASFRSAVMDIAKDLPAHVGLYQFNDESNQEVVASEGLSQGLAQQLNGL--LETAAKDKVAAGASRADHHDKLVYIYTSGTTGLPKAAVITHSRYFFIAAGIHYTLGFKDQDVFYTPLPLYHTAGGVMSMGQALLFGSTVVIRKKFSASGYFSDCARFQCTVGQYIGEMARYILATPSAPHDRNHQVRMVFGNGLRPQIWPQFVERFGIRKVGEFYGATEGNANIMNNDSTVGAIGFISRILPQIYPISIIKADPHTGEPLRNSQGLCERCEADEPGVFVGKIVRGNPCREFLGYVDQKASSKKVVHDVFSKGDMAFISGDLLVADERGYLYFKDRTGDTFRWKGENVSTSEVEAQLSNLAGYKDVIVYGVSIPNTEGRAGMAAIYDPTRE-VNVSQLGVELAKSLPNYARPQFLRFLRKIDLTGTFKLRKVELQQQGFNPEIIDDELFYAQPDGV-YAPLTPSVYERIVRNELRF 714          
BLAST of slc27a-1 vs. Ensembl Fly
Match: Fatp2 (gene:FBgn0265187 transcript:FBtr0339109)

HSP 1 Score: 591.267 bits (1523), Expect = 0.000e+0
Identity = 296/666 (44.44%), Postives = 419/666 (62.91%), Query Frame = 3
Query:   81 PEMENFIENYRW-----LTFTFPFSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRK-VHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            P   NF    +W     LT      + +   +Y +   +   +SI     GW++  I  +T PRD   L + ++V  F+    R    I DIFE  V R+   +A + E +QWTF  V+ ++N++AN     G K GD + L +E+R  +VA W+G+SKIG +  LIN NLR  SL H I   + + LI G    SA+ +I  D+   +    F D S  +     GL+    + L+ +  +E+          +R   HD L++I+TSGTTGLPKAA +TH+R+  ++ G+   LG ++ D+ Y PLPLYHTAGG++ +GQ ++ GS + IRKKFSAS Y+SDC +++ TV QYIGE+ RY+L  P  P +  H VR+ FGNG+RPQIW +F  RF I+++GEFYGATE NANI+NN + VG++GF +RILP +YPI++IK DP TG  LR+  GLC +C+ +E G  VGKI   +P R+F GY+   A+ +K+VHDVF KGD AF++GDLL+ DE G+ YF+DR GDTFRWKGENVST+EVEA +SN     D +VYGV +P+TEG+AGMA I +  +  +++  L  +L + LP YARP F+R  R ID TGTFKL+K +L + GFNP +IDD LFY       YA L  +++E+I++  L+F
Sbjct:   53 PAKSNFRRYLQWILAPVLTAISGLILYYQGPWYGVATLYAALISILLVRPGWRWFYIAAVTTPRDTVALFAYIRVLLFIKRQERKNLNIGDIFESNVARQPDKLAIVSESQQWTFRQVNEHSNRVANVFHSHGYKKGDVVGLLLENRAEFVATWLGLSKIGVITPLINTNLRGASLQHSITVGQCTALIYGASFRSAVMDIAKDLPAHVGLYQFNDESNQEVVASEGLSQGLAQQLNGL--LETAAKDKVAAGASRADHHDKLVYIYTSGTTGLPKAAVITHSRYFFIAAGIHYTLGFKDQDVFYTPLPLYHTAGGVMSMGQALLFGSTVVIRKKFSASGYFSDCARFQCTVGQYIGEMARYILATPSAPHDRNHQVRMVFGNGLRPQIWPQFVERFGIRKVGEFYGATEGNANIMNNDSTVGAIGFISRILPQIYPISIIKADPHTGEPLRNSQGLCERCEADEPGVFVGKIVRGNPCREFLGYVDQKASSKKVVHDVFSKGDMAFISGDLLVADERGYLYFKDRTGDTFRWKGENVSTSEVEAQLSNLAGYKDVIVYGVSIPNTEGRAGMAAIYDPTRE-VNVSQLGVELAKSLPNYARPQFLRFLRKIDLTGTFKLRKVELQQQGFNPEIIDDELFYAQPDGV-YAPLTPSVYERIVRNELRF 714          
BLAST of slc27a-1 vs. Ensembl Fly
Match: Fatp2 (gene:FBgn0265187 transcript:FBtr0339110)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 296/666 (44.44%), Postives = 419/666 (62.91%), Query Frame = 3
Query:   81 PEMENFIENYRW-----LTFTFPFSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRK-VHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            P   NF    +W     LT      + +   +Y +   +   +SI     GW++  I  +T PRD   L + ++V  F+    R    I DIFE  V R+   +A + E +QWTF  V+ ++N++AN     G K GD + L +E+R  +VA W+G+SKIG +  LIN NLR  SL H I   + + LI G    SA+ +I  D+   +    F D S  +     GL+    + L+ +  +E+          +R   HD L++I+TSGTTGLPKAA +TH+R+  ++ G+   LG ++ D+ Y PLPLYHTAGG++ +GQ ++ GS + IRKKFSAS Y+SDC +++ TV QYIGE+ RY+L  P  P +  H VR+ FGNG+RPQIW +F  RF I+++GEFYGATE NANI+NN + VG++GF +RILP +YPI++IK DP TG  LR+  GLC +C+ +E G  VGKI   +P R+F GY+   A+ +K+VHDVF KGD AF++GDLL+ DE G+ YF+DR GDTFRWKGENVST+EVEA +SN     D +VYGV +P+TEG+AGMA I +  +  +++  L  +L + LP YARP F+R  R ID TGTFKL+K +L + GFNP +IDD LFY       YA L  +++E+I++  L+F
Sbjct:   42 PAKSNFRRYLQWILAPVLTAISGLILYYQGPWYGVATLYAALISILLVRPGWRWFYIAAVTTPRDTVALFAYIRVLLFIKRQERKNLNIGDIFESNVARQPDKLAIVSESQQWTFRQVNEHSNRVANVFHSHGYKKGDVVGLLLENRAEFVATWLGLSKIGVITPLINTNLRGASLQHSITVGQCTALIYGASFRSAVMDIAKDLPAHVGLYQFNDESNQEVVASEGLSQGLAQQLNGL--LETAAKDKVAAGASRADHHDKLVYIYTSGTTGLPKAAVITHSRYFFIAAGIHYTLGFKDQDVFYTPLPLYHTAGGVMSMGQALLFGSTVVIRKKFSASGYFSDCARFQCTVGQYIGEMARYILATPSAPHDRNHQVRMVFGNGLRPQIWPQFVERFGIRKVGEFYGATEGNANIMNNDSTVGAIGFISRILPQIYPISIIKADPHTGEPLRNSQGLCERCEADEPGVFVGKIVRGNPCREFLGYVDQKASSKKVVHDVFSKGDMAFISGDLLVADERGYLYFKDRTGDTFRWKGENVSTSEVEAQLSNLAGYKDVIVYGVSIPNTEGRAGMAAIYDPTRE-VNVSQLGVELAKSLPNYARPQFLRFLRKIDLTGTFKLRKVELQQQGFNPEIIDDELFYAQPDGV-YAPLTPSVYERIVRNELRF 703          
BLAST of slc27a-1 vs. Ensembl Fly
Match: Fatp1 (gene:FBgn0267828 transcript:FBtr0347403)

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 289/623 (46.39%), Postives = 401/623 (64.37%), Query Frame = 3
Query:  216 GWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGS--------LIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            GW++  I   T  RD   L + +K+  +     R  +T+ D+FE+ VQ     +A + E ++WTF  V+ +ANK+AN L   G K GD +AL +E+R  YVA W+G+SKIG +  LIN NLR  SL H I     S LI G +   A+ ++  D+   +T   F + +        + Q K LN L  +A           S + P  T+      HD L++I+TSGTTGLPKAA ++H+R++ ++ G+   +G QE DI Y PLPLYHTAGG++ +GQ ++ GS ++IRKKFSAS Y++DC KY AT+ QYIGE+ RY+L       + +H VRL FGNG+RPQIW +F  RF I ++GEFYGATE NANI+N+ N VG++GF +RILP +YPI++I+ DP+TG  +RD+NGLC  C PNE G  +GKI   +P R+F GY+ + A+ +KIV DVF  GD AF++GDLL+ DE G+ YF+DR GDTFRWKGENVST+EVEA +SN     D VVYGV +PHTEG+AGMA I +  +  +DL +    L + LP YARP  IR+   +D TGTFKL+K DL K+G++PN I D L+Y   K   Y  L   +++Q+ +  ++F
Sbjct:   20 GWRWFYIAGATASRDLTALWAYIKLLRYTKRHERLNYTVADVFERNVQAHPDKVAVVSETQRWTFRQVNEHANKVANVLQAQGYKKGDVVALLLENRAEYVATWLGLSKIGVITPLINTNLRGPSLLHSITVAHCSALIYGEDFLEAVTDVAKDLPANLTLFQFNNENNNSETEKNIPQAKNLNALLTTA-----------SYEKPNKTQ---VNHHDKLVYIYTSGTTGLPKAAVISHSRYLFIAAGIHYTMGFQEEDIFYTPLPLYHTAGGIMCMGQSVLFGSTVSIRKKFSASNYFADCAKYNATIGQYIGEMARYILATKPSEYDQKHRVRLVFGNGLRPQIWPQFVQRFNIAKVGEFYGATEGNANIMNHDNTVGAIGFVSRILPKIYPISIIRADPDTGEPIRDRNGLCQLCAPNEPGVFIGKIVKGNPSREFLGYVDEKASAKKIVKDVFKHGDMAFISGDLLVADEKGYLYFKDRTGDTFRWKGENVSTSEVEAQVSNVAGYKDTVVYGVTIPHTEGRAGMAAIYDP-ERELDLDVFAASLAKVLPAYARPQIIRLLTKVDLTGTFKLRKVDLQKEGYDPNAIKDALYYQTSK-GRYELLTPQVYDQVQRNEIRF 626          
BLAST of slc27a-1 vs. Ensembl Fly
Match: Fatp1 (gene:FBgn0267828 transcript:FBtr0347405)

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 289/623 (46.39%), Postives = 401/623 (64.37%), Query Frame = 3
Query:  216 GWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGS--------LIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            GW++  I   T  RD   L + +K+  +     R  +T+ D+FE+ VQ     +A + E ++WTF  V+ +ANK+AN L   G K GD +AL +E+R  YVA W+G+SKIG +  LIN NLR  SL H I     S LI G +   A+ ++  D+   +T   F + +        + Q K LN L  +A           S + P  T+      HD L++I+TSGTTGLPKAA ++H+R++ ++ G+   +G QE DI Y PLPLYHTAGG++ +GQ ++ GS ++IRKKFSAS Y++DC KY AT+ QYIGE+ RY+L       + +H VRL FGNG+RPQIW +F  RF I ++GEFYGATE NANI+N+ N VG++GF +RILP +YPI++I+ DP+TG  +RD+NGLC  C PNE G  +GKI   +P R+F GY+ + A+ +KIV DVF  GD AF++GDLL+ DE G+ YF+DR GDTFRWKGENVST+EVEA +SN     D VVYGV +PHTEG+AGMA I +  +  +DL +    L + LP YARP  IR+   +D TGTFKL+K DL K+G++PN I D L+Y   K   Y  L   +++Q+ +  ++F
Sbjct:   20 GWRWFYIAGATASRDLTALWAYIKLLRYTKRHERLNYTVADVFERNVQAHPDKVAVVSETQRWTFRQVNEHANKVANVLQAQGYKKGDVVALLLENRAEYVATWLGLSKIGVITPLINTNLRGPSLLHSITVAHCSALIYGEDFLEAVTDVAKDLPANLTLFQFNNENNNSETEKNIPQAKNLNALLTTA-----------SYEKPNKTQ---VNHHDKLVYIYTSGTTGLPKAAVISHSRYLFIAAGIHYTMGFQEEDIFYTPLPLYHTAGGIMCMGQSVLFGSTVSIRKKFSASNYFADCAKYNATIGQYIGEMARYILATKPSEYDQKHRVRLVFGNGLRPQIWPQFVQRFNIAKVGEFYGATEGNANIMNHDNTVGAIGFVSRILPKIYPISIIRADPDTGEPIRDRNGLCQLCAPNEPGVFIGKIVKGNPSREFLGYVDEKASAKKIVKDVFKHGDMAFISGDLLVADEKGYLYFKDRTGDTFRWKGENVSTSEVEAQVSNVAGYKDTVVYGVTIPHTEGRAGMAAIYDP-ERELDLDVFAASLAKVLPAYARPQIIRLLTKVDLTGTFKLRKVDLQKEGYDPNAIKDALYYQTSK-GRYELLTPQVYDQVQRNEIRF 626          
BLAST of slc27a-1 vs. Ensembl Zebrafish
Match: slc27a1a (solute carrier family 27 member 1a [Source:ZFIN;Acc:ZDB-GENE-050320-112])

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 300/625 (48.00%), Postives = 424/625 (67.84%), Query Frame = 3
Query:  192 LSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFE--DEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            LS+Y   GGW+++ +++ T  RD  GL  LL+VK  +W+ +RNR+TIP IF +TV R     A ++E   E WTFS +D  +N +A++ L  G  SGD +ALFMESRP  VA+W+G++K+G   ALINFNLR++SL HC+    + G++ G EL  A+ E++  +S+  T   F  G L   KP + +     + LD I+   + Q+PP+   +++  +D L +I+TSGTTGLPKAA V H+R+  ++        ++  DIIY+ LPLYH+AG ++GVGQ +I G  + +++KFSAS +W DCIK+  TVVQYIGEICRYLL QP+RP E QH VRLA GNG+RP +W  F  RF++KQIGEFYGATE N +I N   KVG+ GF +RILP VYPI L+K++ ET   +RDK GLC+ C+P E G LVG+I+ +DP+R+FDGY S  A ++KI ++VF K D A+L+GD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L   D  V+GV VP  EGKAGMA I +S   + +     ++++Q LP YARP+F+RIC  +DTTGTFK++KT L ++G++P L  D +++L+ +   Y  ++  ++    +G +  
Sbjct:   32 LSVYLGTGGWRYLYVVVRTAKRDINGLYVLLRVKLALWHYMRNRNTIPSIFAQTVARHPDKPALVYEATGETWTFSQLDQISNAVAHWALSQGWTSGDVVALFMESRPLQVALWLGLAKVGVEAALINFNLRRDSLLHCVGVSASRGIVFGAELADAVSEVSHSLSQ--TMVRFSTGDL---KP-DLMAALKCQPLDPIL-ASAPQHPPSCT-VSKGFNDHLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGYLSFRMRPDDIIYDCLPLYHSAGNIMGVGQCLIHGLTVVVKRKFSASRFWEDCIKHNCTVVQYIGEICRYLLAQPVRPSERQHRVRLAVGNGLRPSVWEAFVERFRVKQIGEFYGATECNCSIANMDGKVGACGFNSRILPNVYPIRLVKVNEETMELVRDKQGLCVSCRPGEPGLLVGRINQQDPLRRFDGYASQEATRKKIAYNVFRKNDSAYLSGDVLVMDELGYMYFRDRSGDTFRWKGENVSTTEVEGTLSGLLRQTDVAVFGVNVPGVEGKAGMAAIADS-TGSFNCNSFLKEVQQALPPYARPIFLRICPCVDTTGTFKIQKTRLQREGYDPRLTTDQIYFLNSRAGRYELVNEELYNAFEQGRISL 647          
BLAST of slc27a-1 vs. Ensembl Zebrafish
Match: slc27a1a (solute carrier family 27 member 1a [Source:ZFIN;Acc:ZDB-GENE-050320-112])

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 298/632 (47.15%), Postives = 423/632 (66.93%), Query Frame = 3
Query:  192 LSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFE--DEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSL-------IQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            LS+Y   GGW+++ +++ T  RD  GL  LL+VK  +W+ +RNR+TIP IF +TV R     A ++E   E WTFS +D  +N +A++ L  G  SGD +ALFMESRP  VA+W+G++K+G   ALINFNLR++SL HC+    + G++ G EL  A+ E++  +S+  T   F  G L       ++ +PL+ +  SA +            +PP+   +++  +D L +I+TSGTTGLPKAA V H+R+  ++        ++  DIIY+ LPLYH+AG ++GVGQ +I G  + +++KFSAS +W DCIK+  TVVQYIGEICRYLL QP+RP E QH VRLA GNG+RP +W  F  RF++KQIGEFYGATE N +I N   KVG+ GF +RILP VYPI L+K++ ET   +RDK GLC+ C+P E G LVG+I+ +DP+R+FDGY S  A ++KI ++VF K D A+L+GD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L   D  V+GV VP  EGKAGMA I +S   + +     ++++Q LP YARP+F+RIC  +DTTGTFK++KT L ++G++P L  D +++L+ +   Y  ++  ++    +G +  
Sbjct:   32 LSVYLGTGGWRYLYVVVRTAKRDINGLYVLLRVKLALWHYMRNRNTIPSIFAQTVARHPDKPALVYEATGETWTFSQLDQISNAVAHWALSQGWTSGDVVALFMESRPLQVALWLGLAKVGVEAALINFNLRRDSLLHCVGVSASRGIVFGAELADAVSEVSHSLSQ--TMVRFSTGDLKPDLMATLKCQPLDPILASAPR------------HPPSCT-VSKGFNDHLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGYLSFRMRPDDIIYDCLPLYHSAGNIMGVGQCLIHGLTVVVKRKFSASRFWEDCIKHNCTVVQYIGEICRYLLAQPVRPSERQHRVRLAVGNGLRPSVWEAFVERFRVKQIGEFYGATECNCSIANMDGKVGACGFNSRILPNVYPIRLVKVNEETMELVRDKQGLCVSCRPGEPGLLVGRINQQDPLRRFDGYASQEATRKKIAYNVFRKNDSAYLSGDVLVMDELGYMYFRDRSGDTFRWKGENVSTTEVEGTLSGLLRQTDVAVFGVNVPGVEGKAGMAAIADS-TGSFNCNSFLKEVQQALPPYARPIFLRICPCVDTTGTFKIQKTRLQREGYDPRLTTDQIYFLNSRAGRYELVNEELYNAFEEGRISL 647          
BLAST of slc27a-1 vs. Ensembl Zebrafish
Match: slc27a1a (solute carrier family 27 member 1a [Source:ZFIN;Acc:ZDB-GENE-050320-112])

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 298/632 (47.15%), Postives = 423/632 (66.93%), Query Frame = 3
Query:  192 LSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFE--DEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSL-------IQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            LS+Y   GGW+++ +++ T  RD  GL  LL+VK  +W+ +RNR+TIP IF +TV R     A ++E   E WTFS +D  +N +A++ L  G  SGD +ALFMESRP  VA+W+G++K+G   ALINFNLR++SL HC+    + G++ G EL  A+ E++  +S+  T   F  G L       ++ +PL+ +  SA +            +PP+   +++  +D L +I+TSGTTGLPKAA V H+R+  ++        ++  DIIY+ LPLYH+AG ++GVGQ +I G  + +++KFSAS +W DCIK+  TVVQYIGEICRYLL QP+RP E QH VRLA GNG+RP +W  F  RF++KQIGEFYGATE N +I N   KVG+ GF +RILP VYPI L+K++ ET   +RDK GLC+ C+P E G LVG+I+ +DP+R+FDGY S  A ++KI ++VF K D A+L+GD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L   D  V+GV VP  EGKAGMA I +S   + +     ++++Q LP YARP+F+RIC  +DTTGTFK++KT L ++G++P L  D +++L+ +   Y  ++  ++    +G +  
Sbjct:   32 LSVYLGTGGWRYLYVVVRTAKRDINGLYVLLRVKLALWHYMRNRNTIPSIFAQTVARHPDKPALVYEATGETWTFSQLDQISNAVAHWALSQGWTSGDVVALFMESRPLQVALWLGLAKVGVEAALINFNLRRDSLLHCVGVSASRGIVFGAELADAVSEVSHSLSQ--TMVRFSTGDLKPDLMATLKCQPLDPILASAPR------------HPPSCT-VSKGFNDHLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGYLSFRMRPDDIIYDCLPLYHSAGNIMGVGQCLIHGLTVVVKRKFSASRFWEDCIKHNCTVVQYIGEICRYLLAQPVRPSERQHRVRLAVGNGLRPSVWEAFVERFRVKQIGEFYGATECNCSIANMDGKVGACGFNSRILPNVYPIRLVKVNEETMELVRDKQGLCVSCRPGEPGLLVGRINQQDPLRRFDGYASQEATRKKIAYNVFRKNDSAYLSGDVLVMDELGYMYFRDRSGDTFRWKGENVSTTEVEGTLSGLLRQTDVAVFGVNVPGVEGKAGMAAIADS-TGSFNCNSFLKEVQQALPPYARPIFLRICPCVDTTGTFKIQKTRLQREGYDPRLTTDQIYFLNSRAGRYELVNEELYNAFEEGRISL 647          
BLAST of slc27a-1 vs. Ensembl Zebrafish
Match: slc27a1b (solute carrier family 27 member 1b [Source:ZFIN;Acc:ZDB-GENE-061013-672])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 295/621 (47.50%), Postives = 411/621 (66.18%), Query Frame = 3
Query:  192 LSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFED--EQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            L +Y   GGW+F+ + + T  RD  GL  LL+VKF++   IRNR TIP +F + V       A + E   E W+FS++D  +N +A ++L  G +SGD +A+FMESRP  VA+W+G++K+G  PALINFNLR++SL HC+    A G++ G EL   + E+ + +    +  +F  GS     P   L   +   LD +++ +S + PP   H  +  +D L +I+TSGTTGLPKAA V H+R+  ++       G+Q  D++Y  LPLYH+AG +IGVGQ ++ G  + IR+KFSAS +W DC+KY  TVVQYIGEICRYLL QP+RP E+ H VR+A GNG+RP +W  F  RF +K+IGEFYGATE N ++ N  NKVG+ GF + +LP VYPI L++ D +T   +RD  GLC+ CKP E G +VG+I+ +DP+R+FDGY ++ A  +KI H+VF KGD A+++GDL++ DELG+ YFRDR GDTFRW+GENVST EVE V+S  L   D  VYGV VP  EGKAGMA I +  +N  D +     ++  LP YARP+F+R+   +D TGTFK++KT L K+GF+P+   D LF+L+ +   Y SL   +   IM+G
Sbjct:   34 LGVYLCSGGWRFVYVAVRTAKRDLIGLQVLLRVKFYMRQYIRNRSTIPSLFAQRVALHPEKAALVDESSGEVWSFSELDRRSNAVAQWVLAQGWRSGDVVAIFMESRPQMVALWLGMAKVGVEPALINFNLRRDSLIHCMGVSGACGMVFGAELLDVVLEVRESLR---SLSLFSCGS----APAEMLDSLSAADLDALLS-KSPETPPAVAH-NKGFNDRLFYIYTSGTTGLPKAAIVVHSRYYRIAAFSYYSFGLQPDDVVYCCLPLYHSAGNIIGVGQCLLHGLTVVIRRKFSASRFWDDCVKYNCTVVQYIGEICRYLLSQPVRPSESLHRVRVAMGNGLRPNVWESFMKRFSVKRIGEFYGATECNCSLANMDNKVGACGFNSVVLPSVYPIRLLRADEDTMELIRDSRGLCVPCKPGEPGIIVGRINPQDPLRRFDGYANEEATSKKISHNVFRKGDSAYVSGDLMVMDELGYVYFRDRGGDTFRWRGENVSTTEVEGVLSALLKQTDVAVYGVSVPGVEGKAGMAAIADP-ENVFDCETFLRDVQNALPSYARPVFLRLSPEVDKTGTFKIQKTRLQKEGFDPHQTADRLFFLNSRQGRYESLTEELHSAIMQG 644          
BLAST of slc27a-1 vs. Ensembl Zebrafish
Match: slc27a4 (solute carrier family 27 member 4 [Source:ZFIN;Acc:ZDB-GENE-050417-248])

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 300/647 (46.37%), Postives = 421/647 (65.07%), Query Frame = 3
Query:  129 FPFSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFE--DEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSL-IQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            F   +   L ++ ++ + L+    Y   GGWK + +   TI RD      LL+VK  V   +R R+T+P +F K+V++  +  A +FE  DE+W+F ++D Y+N++AN+LL+ G + GD +ALFME+R  YV +W+G++KIG   ALINFNLR E+L HC+N   A  ++ G+EL  A+ E++  + K  T K+F+ G    +R P+        + LD ++   S   P   +   R   D L +I+TSGTTG+PKAA V H+R+  M+  V     ++  D++Y+ LPLYH+AG ++G+GQ +I G  + IRKKFSAS +W DCIKY  T+VQYIGEICRYLL QP +  E +H VR+A GNG+R  IW EF  RF + QI EFYGATE N ++ N  NK G+ GF +RILP+VYPI L+K+D ET   +R  +G+CI C P E G+LVG+I   DP+R+FDGY++  A  +KI  DVF KGD A+L+GD+L+ D+ G+ YFRDR GDTFRWKGENVST EVE  +S  L++ D VVYGVEVP  EGKAGMA I +  +N  DL      L++ LP YARP+F+R    +D TGTFK +KTD+ +DGF+PN++ D L++LD     Y  L++ +   I+ G  K 
Sbjct:   12 FVLRLFIGLPWWQVLPSILI---FYVGSGGWKSLYVFSKTIYRDLHAASVLLRVKLNVKKHLRERNTVPKLFAKSVKKYGNKTALIFEGTDEKWSFKELDEYSNRVANFLLQQGFREGDVVALFMENRHQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNISSAKAVVFGSELTEAMCEVHSSMGK--TVKLFVSGEWDPKRVPV------GTEHLDPLLETTSTIQP---KQPDRSFTDRLFYIYTSGTTGMPKAAIVVHSRYYRMAALVYYGFRMKPEDVLYDCLPLYHSAGNIVGIGQGLIHGMTVVIRKKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQPRKDTERKHKVRMALGNGLRQSIWEEFTNRFNVPQIAEFYGATECNCSLGNFDNKTGACGFNSRILPYVYPIRLVKVDEETMELIRGPDGVCIPCGPGEPGQLVGRIIQNDPLRRFDGYVNQTATNKKIAQDVFKKGDSAYLSGDVLVMDDFGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPGAEGKAGMAAIADP-ENNTDLAKFSRDLEKALPPYARPVFLRFLPEVDKTGTFKFQKTDMRRDGFDPNIVSDKLYFLDCTKGQYVELNAELHRNIVSGKQKL 643          
BLAST of slc27a-1 vs. Ensembl Xenopus
Match: SLC27A4 (solute carrier family 27 member 4 [Source:NCBI gene;Acc:101735131])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 295/625 (47.20%), Postives = 414/625 (66.24%), Query Frame = 3
Query:  192 LSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFED--EQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            L  Y   GGWKFM++  +TI RD  G ++L++VK  V   +R R+TIPDIF++ V+R  +  A +FE     WTF ++D ++N +AN+L   G +SGD IALFME+   YV +W+G++KIG   ALINFNLR ++L HC     +  +I G E+  A+ +++  + K +    F +       P     G+  + LD ++   S ++PP  +   R   D L +I+TSGTTGLPKAA V H+R+  M+  V    G++  D++Y+ LPLYH+AG ++G+GQ ++ G  + I+KKFSAS +W DC KY  T+VQYIGEICRYLL QP+R  E+QH VR+A GNG+RP IW EF +RF+I Q+ EFYGATE N ++ N  N VG+ GF +RILPFVYPI L+K++ +T   +RD  GLCI C+P E G+LVG+I   DP+R+FDGY+++ A  +KI  DVF  GD A+LTGD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L   D VVYGVE+P TEG+AGMA + +   +  DL+   + LK+ LP YA P+F+RI   ++ TGT+K +KT++ K+ FNP+L+ D L+ LD +   Y  L   ++ +I  G  K 
Sbjct:   30 LVFYLGSGGWKFMRVFCMTISRDLWGALTLVRVKLQVRKHLRERNTIPDIFKECVKRHPNKTALIFEGTGASWTFMELDEFSNAVANFLHAEGFRSGDVIALFMENCNEYVGLWLGMAKIGVEAALINFNLRLDALEHCFTVSNSKAVIFGKEMSQAMCDVHSLMGKSVRLYCFGECD-----PKTVPVGA--EFLDSLLQSAS-RHPP--KGPGRSFTDKLFYIYTSGTTGLPKAAIVVHSRYFRMAALVHYGFGMRSDDVVYDCLPLYHSAGNIVGIGQCLLHGLTVVIKKKFSASRFWDDCAKYNCTIVQYIGEICRYLLNQPVREAESQHRVRMALGNGLRPAIWTEFTSRFRIPQVAEFYGATECNCSLGNFDNHVGACGFNSRILPFVYPIRLMKVNEDTMELIRDAQGLCIPCRPGEPGQLVGRIIQSDPLRRFDGYVNETATSKKIAKDVFKNGDMAYLTGDVLVMDELGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLGQADVVVYGVEIPGTEGRAGMAAVADP-NSTCDLEKFAKDLKKSLPAYAHPVFLRILPEVNKTGTYKFQKTEMRKESFNPHLVKDALYVLDSQQGRYTPLTHDVYSRIQTGKFKL 643          
BLAST of slc27a-1 vs. Ensembl Xenopus
Match: SLC27A4 (solute carrier family 27 member 4 [Source:NCBI gene;Acc:101735131])

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 295/625 (47.20%), Postives = 414/625 (66.24%), Query Frame = 3
Query:  192 LSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFED--EQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            L  Y   GGWKFM++  +TI RD  G ++L++VK  V   +R R+TIPDIF++ V+R  +  A +FE     WTF ++D ++N +AN+L   G +SGD IALFME+   YV +W+G++KIG   ALINFNLR ++L HC     +  +I G E+  A+ +++  + K +    F +       P     G+  + LD ++   S ++PP  +   R   D L +I+TSGTTGLPKAA V H+R+  M+  V    G++  D++Y+ LPLYH+AG ++G+GQ ++ G  + I+KKFSAS +W DC KY  T+VQYIGEICRYLL QP+R  E+QH VR+A GNG+RP IW EF +RF+I Q+ EFYGATE N ++ N  N VG+ GF +RILPFVYPI L+K++ +T   +RD  GLCI C+P E G+LVG+I   DP+R+FDGY+++ A  +KI  DVF  GD A+LTGD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L   D VVYGVE+P TEG+AGMA + +   +  DL+   + LK+ LP YA P+F+RI   ++ TGT+K +KT++ K+ FNP+L+ D L+ LD +   Y  L   ++ +I  G  K 
Sbjct:   28 LVFYLGSGGWKFMRVFCMTISRDLWGALTLVRVKLQVRKHLRERNTIPDIFKECVKRHPNKTALIFEGTGASWTFMELDEFSNAVANFLHAEGFRSGDVIALFMENCNEYVGLWLGMAKIGVEAALINFNLRLDALEHCFTVSNSKAVIFGKEMSQAMCDVHSLMGKSVRLYCFGECD-----PKTVPVGA--EFLDSLLQSAS-RHPP--KGPGRSFTDKLFYIYTSGTTGLPKAAIVVHSRYFRMAALVHYGFGMRSDDVVYDCLPLYHSAGNIVGIGQCLLHGLTVVIKKKFSASRFWDDCAKYNCTIVQYIGEICRYLLNQPVREAESQHRVRMALGNGLRPAIWTEFTSRFRIPQVAEFYGATECNCSLGNFDNHVGACGFNSRILPFVYPIRLMKVNEDTMELIRDAQGLCIPCRPGEPGQLVGRIIQSDPLRRFDGYVNETATSKKIAKDVFKNGDMAYLTGDVLVMDELGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLGQADVVVYGVEIPGTEGRAGMAAVADP-NSTCDLEKFAKDLKKSLPAYAHPVFLRILPEVNKTGTYKFQKTEMRKESFNPHLVKDALYVLDSQQGRYTPLTHDVYSRIQTGKFKL 641          
BLAST of slc27a-1 vs. Ensembl Xenopus
Match: SLC27A4 (solute carrier family 27 member 4 [Source:NCBI gene;Acc:101735131])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 283/601 (47.09%), Postives = 400/601 (66.56%), Query Frame = 3
Query:  264 RGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFED--EQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            +G ++L++VK  V   +R R+TIPDIF++ V+R  +  A +FE     WTF ++D ++N +AN+L   G +SGD IALFME+   YV +W+G++KIG   ALINFNLR ++L HC     +  +I G E+  A+ +++  + K +    F +       P     G+  + LD ++   S ++PP  +   R   D L +I+TSGTTGLPKAA V H+R+  M+  V    G++  D++Y+ LPLYH+AG ++G+GQ ++ G  + I+KKFSAS +W DC KY  T+VQYIGEICRYLL QP+R  E+QH VR+A GNG+RP IW EF +RF+I Q+ EFYGATE N ++ N  N VG+ GF +RILPFVYPI L+K++ +T   +RD  GLCI C+P E G+LVG+I   DP+R+FDGY+++ A  +KI  DVF  GD A+LTGD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L   D VVYGVE+P TEG+AGMA + +   +  DL+   + LK+ LP YA P+F+RI   ++ TGT+K +KT++ K+ FNP+L+ D L+ LD +   Y  L   ++ +I  G  K 
Sbjct:   32 QGALTLVRVKLQVRKHLRERNTIPDIFKECVKRHPNKTALIFEGTGASWTFMELDEFSNAVANFLHAEGFRSGDVIALFMENCNEYVGLWLGMAKIGVEAALINFNLRLDALEHCFTVSNSKAVIFGKEMSQAMCDVHSLMGKSVRLYCFGECD-----PKTVPVGA--EFLDSLLQSAS-RHPP--KGPGRSFTDKLFYIYTSGTTGLPKAAIVVHSRYFRMAALVHYGFGMRSDDVVYDCLPLYHSAGNIVGIGQCLLHGLTVVIKKKFSASRFWDDCAKYNCTIVQYIGEICRYLLNQPVREAESQHRVRMALGNGLRPAIWTEFTSRFRIPQVAEFYGATECNCSLGNFDNHVGACGFNSRILPFVYPIRLMKVNEDTMELIRDAQGLCIPCRPGEPGQLVGRIIQSDPLRRFDGYVNETATSKKIAKDVFKNGDMAYLTGDVLVMDELGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLGQADVVVYGVEIPGTEGRAGMAAVADP-NSTCDLEKFAKDLKKSLPAYAHPVFLRILPEVNKTGTYKFQKTEMRKESFNPHLVKDALYVLDSQQGRYTPLTHDVYSRIQTGKFKL 621          
BLAST of slc27a-1 vs. Ensembl Xenopus
Match: SLC27A4 (solute carrier family 27 member 4 [Source:NCBI gene;Acc:101735131])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 283/601 (47.09%), Postives = 400/601 (66.56%), Query Frame = 3
Query:  264 RGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFED--EQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            +G ++L++VK  V   +R R+TIPDIF++ V+R  +  A +FE     WTF ++D ++N +AN+L   G +SGD IALFME+   YV +W+G++KIG   ALINFNLR ++L HC     +  +I G E+  A+ +++  + K +    F +       P     G+  + LD ++   S ++PP  +   R   D L +I+TSGTTGLPKAA V H+R+  M+  V    G++  D++Y+ LPLYH+AG ++G+GQ ++ G  + I+KKFSAS +W DC KY  T+VQYIGEICRYLL QP+R  E+QH VR+A GNG+RP IW EF +RF+I Q+ EFYGATE N ++ N  N VG+ GF +RILPFVYPI L+K++ +T   +RD  GLCI C+P E G+LVG+I   DP+R+FDGY+++ A  +KI  DVF  GD A+LTGD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L   D VVYGVE+P TEG+AGMA + +   +  DL+   + LK+ LP YA P+F+RI   ++ TGT+K +KT++ K+ FNP+L+ D L+ LD +   Y  L   ++ +I  G  K 
Sbjct:   13 KGALTLVRVKLQVRKHLRERNTIPDIFKECVKRHPNKTALIFEGTGASWTFMELDEFSNAVANFLHAEGFRSGDVIALFMENCNEYVGLWLGMAKIGVEAALINFNLRLDALEHCFTVSNSKAVIFGKEMSQAMCDVHSLMGKSVRLYCFGECD-----PKTVPVGA--EFLDSLLQSAS-RHPP--KGPGRSFTDKLFYIYTSGTTGLPKAAIVVHSRYFRMAALVHYGFGMRSDDVVYDCLPLYHSAGNIVGIGQCLLHGLTVVIKKKFSASRFWDDCAKYNCTIVQYIGEICRYLLNQPVREAESQHRVRMALGNGLRPAIWTEFTSRFRIPQVAEFYGATECNCSLGNFDNHVGACGFNSRILPFVYPIRLMKVNEDTMELIRDAQGLCIPCRPGEPGQLVGRIIQSDPLRRFDGYVNETATSKKIAKDVFKNGDMAYLTGDVLVMDELGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLGQADVVVYGVEIPGTEGRAGMAAVADP-NSTCDLEKFAKDLKKSLPAYAHPVFLRILPEVNKTGTYKFQKTEMRKESFNPHLVKDALYVLDSQQGRYTPLTHDVYSRIQTGKFKL 602          
BLAST of slc27a-1 vs. Ensembl Xenopus
Match: SLC27A4 (solute carrier family 27 member 4 [Source:NCBI gene;Acc:101735131])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 283/600 (47.17%), Postives = 399/600 (66.50%), Query Frame = 3
Query:  267 GLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFED--EQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            G ++L++VK  V   +R R+TIPDIF++ V+R  +  A +FE     WTF ++D ++N +AN+L   G +SGD IALFME+   YV +W+G++KIG   ALINFNLR ++L HC     +  +I G E+  A+ +++  + K +    F +       P     G+  + LD ++   S ++PP  +   R   D L +I+TSGTTGLPKAA V H+R+  M+  V    G++  D++Y+ LPLYH+AG ++G+GQ ++ G  + I+KKFSAS +W DC KY  T+VQYIGEICRYLL QP+R  E+QH VR+A GNG+RP IW EF +RF+I Q+ EFYGATE N ++ N  N VG+ GF +RILPFVYPI L+K++ +T   +RD  GLCI C+P E G+LVG+I   DP+R+FDGY+++ A  +KI  DVF  GD A+LTGD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L   D VVYGVE+P TEG+AGMA + +   +  DL+   + LK+ LP YA P+F+RI   ++ TGT+K +KT++ K+ FNP+L+ D L+ LD +   Y  L   ++ +I  G  K 
Sbjct:   26 GALTLVRVKLQVRKHLRERNTIPDIFKECVKRHPNKTALIFEGTGASWTFMELDEFSNAVANFLHAEGFRSGDVIALFMENCNEYVGLWLGMAKIGVEAALINFNLRLDALEHCFTVSNSKAVIFGKEMSQAMCDVHSLMGKSVRLYCFGECD-----PKTVPVGA--EFLDSLLQSAS-RHPP--KGPGRSFTDKLFYIYTSGTTGLPKAAIVVHSRYFRMAALVHYGFGMRSDDVVYDCLPLYHSAGNIVGIGQCLLHGLTVVIKKKFSASRFWDDCAKYNCTIVQYIGEICRYLLNQPVREAESQHRVRMALGNGLRPAIWTEFTSRFRIPQVAEFYGATECNCSLGNFDNHVGACGFNSRILPFVYPIRLMKVNEDTMELIRDAQGLCIPCRPGEPGQLVGRIIQSDPLRRFDGYVNETATSKKIAKDVFKNGDMAYLTGDVLVMDELGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLGQADVVVYGVEIPGTEGRAGMAAVADP-NSTCDLEKFAKDLKKSLPAYAHPVFLRILPEVNKTGTYKFQKTEMRKESFNPHLVKDALYVLDSQQGRYTPLTHDVYSRIQTGKFKL 614          
BLAST of slc27a-1 vs. Ensembl Mouse
Match: Slc27a4 (solute carrier family 27 (fatty acid transporter), member 4 [Source:MGI Symbol;Acc:MGI:1347347])

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 289/612 (47.22%), Postives = 415/612 (67.81%), Query Frame = 3
Query:  219 WKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFE--DEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            W+F+++ I T+ RD  G M LLKVK  V   ++ R T+P +F   VQR     A +FE  D  WTF  +D Y++ +AN+L   G+ SG+ +ALFME+R  +V +W+G++K+G   ALIN NLR+++L HC++  KA  LI G+E+ SA+ EI+  +    T  +F  GS  +   +   T   D +L+     ++ ++ P+  H  +   D L +I+TSGTTGLPKAA V H+R+  M+  V     ++  DI+Y+ LPLYH+AG ++G+GQ ++ G  + IRKKFSAS +W DCIKY  T+VQYIGE+CRYLL QP R  E++H VR+A GNG+R  IW +F +RF I Q+ EFYGATE N ++ N  ++VG+ GF +RIL FVYPI L++++ +T   +R  +G+CI C+P + G+LVG+I  +DP+R+FDGY++  AN +KI +DVF KGD+A+LTGD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L++ D  VYGVEVP TEG+AGMA +     N  DL+   + LK++LP+YARP+F+R    +  TGTFK +KT+L K+GF+P+++ D LFYLD +   Y +LD   + +I  G
Sbjct:   39 WRFIRVFIKTVRRDIFGGMVLLKVKTKVRRYLQERKTVPLLFASMVQRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQARGLASGNVVALFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALRHCLDTSKARALIFGSEMASAICEIHASLEP--TLSLFCSGSW-EPSTVPVSTEHLDPLLE-----DAPKHLPS--HPDKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMASLVYYGFRMRPDDIVYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAESRHKVRMALGNGLRQSIWTDFSSRFHIPQVAEFYGATECNCSLGNFDSRVGACGFNSRILSFVYPIRLVRVNEDTMELIRGPDGVCIPCQPGQPGQLVGRIIQQDPLRRFDGYLNQGANNKKIANDVFKKGDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLHMADVAVYGVEVPGTEGRAGMAAVASPISNC-DLESFAQTLKKELPLYARPIFLRFLPELHKTGTFKFQKTELRKEGFDPSVVKDPLFYLDARKGCYVALDQEAYTRIQAG 639          
BLAST of slc27a-1 vs. Ensembl Mouse
Match: Slc27a1 (solute carrier family 27 (fatty acid transporter), member 1 [Source:MGI Symbol;Acc:MGI:1347098])

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 290/622 (46.62%), Postives = 404/622 (64.95%), Query Frame = 3
Query:  189 SLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQ--WTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            +  +Y   GGW+F++I+  T  RD  GL  L++V+  +    R   TIP IF+   +R+   +A +       WTF+ +D Y+N +AN   +LG   GD +A+F+E RP +V +W+G++K G V AL+N NLR+E L  C+    A  LI G E+ +A+ E+++ + K  +   F  G L    P + L  +  ++LD +  +      P  +   + + D L +I+TSGTTGLPKAA V H+R+  ++        ++ +D++Y+ LPLYH+AG ++GVGQ +I G  + +RKKFSAS +W DC+KY  TVVQYIGEICRYLL QP+R  E +H VRLA GNG+RP IW EF  RF + QIGEFYGATE N +I N   KVGS GF +RIL  VYPI L+K++ +T   LRD  GLCI C+P E G LVG+I+ +DP+R+FDGY+SD+A  +KI H VF KGD A+L+GD+L+ DELG+ YFRDR GDTFRW+GENVST EVEAV+S  L   D  VYGV VP  EGKAGMA I +   + +D   + ++L++ L  YARP+F+R+   +DTTGTFK++KT L ++GF+P    D LF+LD K   Y  LD  +  +I  G
Sbjct:   31 AFCVYVGGGGWRFLRIVCKTARRDLFGLSVLIRVRLELRRHRRAGDTIPCIFQAVARRQPERLALVDASSGICWTFAQLDTYSNAVANLFRQLGFAPGDVVAVFLEGRPEFVGLWLGLAKAGVVAALLNVNLRREPLAFCLGTSAAKALIYGGEMAAAVAEVSEQLGK--SLLKFCSGDL---GPESILPDT--QLLDPM--LAEAPTTPLAQAPGKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGHHSYSMRAADVLYDCLPLYHSAGNIMGVGQCVIYGLTVVLRKKFSASRFWDDCVKYNCTVVQYIGEICRYLLRQPVRDVEQRHRVRLAVGNGLRPAIWEEFTQRFGVPQIGEFYGATECNCSIANMDGKVGSCGFNSRILTHVYPIRLVKVNEDTMEPLRDSEGLCIPCQPGEPGLLVGQINQQDPLRRFDGYVSDSATNKKIAHSVFRKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEAVLSRLLGQTDVAVYGVAVPGVEGKAGMAAIADP-HSQLDPNSMYQELQKVLASYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGRYVPLDERVHARICAG 642          
BLAST of slc27a-1 vs. Ensembl Mouse
Match: Slc27a1 (solute carrier family 27 (fatty acid transporter), member 1 [Source:MGI Symbol;Acc:MGI:1347098])

HSP 1 Score: 583.948 bits (1504), Expect = 0.000e+0
Identity = 290/622 (46.62%), Postives = 404/622 (64.95%), Query Frame = 3
Query:  189 SLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQ--WTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            +  +Y   GGW+F++I+  T  RD  GL  L++V+  +    R   TIP IF+   +R+   +A +       WTF+ +D Y+N +AN   +LG   GD +A+F+E RP +V +W+G++K G V AL+N NLR+E L  C+    A  LI G E+ +A+ E+++ + K  +   F  G L    P + L  +  ++LD +  +      P  +   + + D L +I+TSGTTGLPKAA V H+R+  ++        ++ +D++Y+ LPLYH+AG ++GVGQ +I G  + +RKKFSAS +W DC+KY  TVVQYIGEICRYLL QP+R  E +H VRLA GNG+RP IW EF  RF + QIGEFYGATE N +I N   KVGS GF +RIL  VYPI L+K++ +T   LRD  GLCI C+P E G LVG+I+ +DP+R+FDGY+SD+A  +KI H VF KGD A+L+GD+L+ DELG+ YFRDR GDTFRW+GENVST EVEAV+S  L   D  VYGV VP  EGKAGMA I +   + +D   + ++L++ L  YARP+F+R+   +DTTGTFK++KT L ++GF+P    D LF+LD K   Y  LD  +  +I  G
Sbjct:   31 AFCVYVGGGGWRFLRIVCKTARRDLFGLSVLIRVRLELRRHRRAGDTIPCIFQAVARRQPERLALVDASSGICWTFAQLDTYSNAVANLFRQLGFAPGDVVAVFLEGRPEFVGLWLGLAKAGVVAALLNVNLRREPLAFCLGTSAAKALIYGGEMAAAVAEVSEQLGK--SLLKFCSGDL---GPESILPDT--QLLDPM--LAEAPTTPLAQAPGKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGHHSYSMRAADVLYDCLPLYHSAGNIMGVGQCVIYGLTVVLRKKFSASRFWDDCVKYNCTVVQYIGEICRYLLRQPVRDVEQRHRVRLAVGNGLRPAIWEEFTQRFGVPQIGEFYGATECNCSIANMDGKVGSCGFNSRILTHVYPIRLVKVNEDTMEPLRDSEGLCIPCQPGEPGLLVGQINQQDPLRRFDGYVSDSATNKKIAHSVFRKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEAVLSRLLGQTDVAVYGVAVPGVEGKAGMAAIADP-HSQLDPNSMYQELQKVLASYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGRYVPLDERVHARICAG 642          
BLAST of slc27a-1 vs. Ensembl Mouse
Match: Slc27a6 (solute carrier family 27 (fatty acid transporter), member 6 [Source:MGI Symbol;Acc:MGI:3036230])

HSP 1 Score: 418.313 bits (1074), Expect = 5.793e-137
Identity = 226/582 (38.83%), Postives = 338/582 (58.08%), Query Frame = 3
Query:  327 TIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLK-LGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKI---INMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            T+ D F    +++      ++E + +T+ DVD  +N+IA+ LL    +K GD +AL M + P +V +W G++K+G V A +N NLR +SL HCIN  + + ++ G +L  +++EI   + K +               + G+  S  + +D +   +++ S +  P + H+T  +    ++IFTSGTTGLPKAA ++  + +  S G+    G    DIIY  LPLYH++G ++G+G  +  G+   ++KKFSAS +W+DC KY  TV QYIGE+CRYL  QP R  E  H VRLA GNG+   +W +F  RF   ++ E YGATE N   +N+  K+GSVG         +   LIK D +     R+  G C   +  E G L+ +++ K+P   + G  SD   + K++ DVF KGD  F TGDL+ QD+  F YF DRLGDTFRWKGENV+T EV  V+     + +  VYGV VP  EGKAGM +++     ++DL+ +  ++   LP YA PLF+RI   ++TTGTFKLKK  L+++GF+P  I D L+++D+    Y  L   I+ QIM   +K 
Sbjct:   55 TVLDKFLSHTRKQPRKAFIIYEGDVYTYEDVDKRSNRIAHALLNHSSLKRGDVVALLMSNEPDFVHVWFGLAKLGCVVAFLNSNLRFDSLLHCINTCEPTAVVVGGDLLGSIEEILPSLPKHVR--------------VWGMKDSVPEGIDSLQEKLSLASDEPVPPSHHVTSSLKSTCLYIFTSGTTGLPKAAVISQLQVLKGSVGL-WAFGCTADDIIYITLPLYHSSGSLLGIGGCVELGATCVLKKKFSASQFWNDCKKYNVTVFQYIGELCRYLCKQPQREGEKDHRVRLAVGNGLSSDVWRQFLDRFGNIKMCELYGATEGNIVFMNHTGKIGSVGRANFFYSLFFSFELIKYDFQKDEPWRNGQGWCSCVRKGEPGLLISRVNKKNPFFGYAG--SDTHTKSKLLFDVFRKGDVYFNTGDLMFQDQENFVYFWDRLGDTFRWKGENVATTEVADVLGRLDFIQEANVYGVRVPGYEGKAGMTSVILKPNKSLDLEKMYNQVVTSLPAYACPLFLRIQDKMETTGTFKLKKLQLVEEGFDPLKISDPLYFMDNLKKSYVPLTEEIYNQIMSEEVKL 619          
BLAST of slc27a-1 vs. Ensembl Mouse
Match: Slc27a2 (solute carrier family 27 (fatty acid transporter), member 2 [Source:MGI Symbol;Acc:MGI:1347099])

HSP 1 Score: 404.445 bits (1038), Expect = 1.525e-131
Identity = 227/569 (39.89%), Postives = 321/569 (56.41%), Query Frame = 3
Query:  360 RKSSHIAFL-FEDEQWTFSDVDMYANKIANYLL-KLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            RK+ H  FL F DE  T++ VD  +N++A  L  +LG++ GD +ALFM + PAYV IW+G+ K+G   A +N+N+R +SL HC     A  L+   +L  A++E+   + K      ++  +          T   D ILDK+  + +   P + R        P ++I+TSGTTGLPKAA + H R +    G++   GI   D+IY  +PLYH+A  MIG+   I+ G+ +A+R KFSAS +W DC KY  TV+QYIGE+ RYL   P +P +  H V+ A GNG+R  +W EF  RF    + EFY +TE N   +N   K+G+VG    +   V    LIK D E    +RD NG CI+    EVG LV KI    P   + G       ++K + DVF KGD  F +GDLL+ D   F YF DR+GDTFRWKGENV+T EV  ++     + +  VYGV VP  EG+ GMA++        + K L + + + LP YARP F+RI   I+ TGTFK +K  LM++GFNP +I D L+++D     +  +   I+  I+   LK 
Sbjct:   64 RKTPHKPFLLFRDETLTYAQVDRRSNQVARALHDQLGLRQGDCVALFMGNEPAYVWIWLGLLKLGCPMACLNYNIRAKSLLHCFQCCGAKVLLASPDLQEAVEEVLPTLKKDAVSVFYVSRT--------SNTNGVDTILDKVDGVSAEPTPESWRSEV-TFTTPAVYIYTSGTTGLPKAATINHHR-LWYGTGLAMSSGITAQDVIYTTMPLYHSAALMIGLHGCIVVGATLALRSKFSASQFWDDCRKYNVTVIQYIGELLRYLCNTPQKPNDRDHKVKKALGNGLRGDVWREFIKRFGDIHVYEFYASTEGNIGFVNYPRKIGAVGRANYLQRKVARYELIKYDVEKDEPVRDANGYCIKVPKGEVGLLVCKITQLTPFIGYAG--GKTQTEKKKLRDVFKKGDIYFNSGDLLMIDRENFVYFHDRVGDTFRWKGENVATTEVADIVGLVDFVEEVNVYGVPVPGHEGRIGMASLKIKENYEFNGKKLFQHIAEYLPSYARPRFLRIQDTIEITGTFKHRKVTLMEEGFNPTVIKDTLYFMDDAEKTFVPMTENIYNAIIDKTLKL 620          
BLAST of slc27a-1 vs. UniProt/SwissProt
Match: sp|Q6PCB7|S27A1_HUMAN (Long-chain fatty acid transport protein 1 OS=Homo sapiens OX=9606 GN=SLC27A1 PE=1 SV=1)

HSP 1 Score: 597.43 bits (1539), Expect = 0.000e+0
Identity = 297/622 (47.75%), Postives = 409/622 (65.76%), Query Frame = 3
Query:  189 SLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFL--FEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            +L +Y   GGW+F++I+  T  RD  GL  L++V+  +    R  HTIP IF+  VQR+   +A +     E WTF+ +D Y+N +AN   +LG   GD +A+F+E RP +V +W+G++K G   AL+N NLR+E L  C+    A  LI G E+ +A+ E++  + K  +   F  G L    P   L  +   +LD ++   S    P  +  ++ + D L +I+TSGTTGLPKAA V H+R+  M+        +Q +D++Y+ LPLYH+AG +IGVGQ +I G  + +RKKFSAS +W DCIKY  TVVQYIGEICRYLL QP+R  E +H VRLA GNG+RP IW EF  RF ++QIGEFYGATE N +I N   KVGS GF +RILP VYPI L+K++ +T   LRD  GLCI C+  E G LVG+I+ +DP+R+FDGY+S++A  +KI H VF KGD A+L+GD+L+ DELG+ YFRDR GDTFRW+GENVST EVE V+S  L   D  VYGV VP  EGKAGMA + +   + +D   + ++L++ L  YARP+F+R+   +DTTGTFK++KT L ++GF+P    D LF+LD K  HY  L+ A++ +I  G
Sbjct:   31 ALGVYVGSGGWRFLRIVCKTARRDLFGLSVLIRVRLELRRHQRAGHTIPRIFQAVVQRQPERLALVDAGTGECWTFAQLDAYSNAVANLFRQLGFAPGDVVAIFLEGRPEFVGLWLGLAKAGMEAALLNVNLRREPLAFCLGTSGAKALIFGGEMVAAVAEVSGHLGK--SLIKFCSGDL---GPEGILPDT--HLLDPLLKEAS--TAPLAQIPSKGMDDRLFYIYTSGTTGLPKAAIVVHSRYYRMAAFGHHAYRMQAADVLYDCLPLYHSAGNIIGVGQCLIYGLTVVLRKKFSASRFWDDCIKYNCTVVQYIGEICRYLLKQPVREAERRHRVRLAVGNGLRPAIWEEFTERFGVRQIGEFYGATECNCSIANMDGKVGSCGFNSRILPHVYPIRLVKVNEDTMELLRDAQGLCIPCQAGEPGLLVGQINQQDPLRRFDGYVSESATSKKIAHSVFSKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKAGMAAVADP-HSLLDPNAIYQELQKVLAPYARPIFLRLLPQVDTTGTFKIQKTRLQREGFDPRQTSDRLFFLDLKQGHYLPLNEAVYTRICSG 642          
BLAST of slc27a-1 vs. UniProt/SwissProt
Match: sp|Q4R3Y4|S27A4_MACFA (Long-chain fatty acid transport protein 4 OS=Macaca fascicularis OX=9541 GN=SLC27A4 PE=2 SV=2)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 298/621 (47.99%), Postives = 415/621 (66.83%), Query Frame = 3
Query:  192 LSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFE--DEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            L +Y   GGW+F+++ I TI RD  G + LLKVK  V   +R R T+P +F  TV+R     A +FE  D  WTF  +D Y++ +AN+L   G+ SGD  A+FME+R  +V +W+G++K+G   ALIN NLR+++L HC+   +A  L+ G+E+ SA+ EI+  +    +  +F  GS    +P N +  S +  LD ++       P       +   D L +I+TSGTTGLPKAA V H+R+  M+  V     ++ +DIIY+ LPLYH+AG ++G+GQ ++ G  + IRKKFSAS +W DCIKYK T+VQYIGE+CRYLL QP R  ENQH VR+A GNG+R  IW  F +RF I Q+ EFYGATE N ++ N  ++VG+ GF +RIL FVYPI L++++ +T   +R  +G+CI C+P E G+LVG+I  KDP+R+FDGY++  AN +KI  DVF KGD+A+LTGD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L++ D  VYGVEVP TEG+AGMA       N  DL+   + L+++LP+YARP+F+RI   +  TGT+KL+KT+L K+GF+P ++ D LFYLD +   Y  LD   + +I  G
Sbjct:   30 LFLYLGSGGWRFIRVFIKTIRRDIFGGLVLLKVKAKVRQCLRERRTVPILFASTVRRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQARGLASGDVAAIFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFGSEMASAICEIHASLDP--SLSLFCSGSW---EP-NAVPTSTEH-LDPLLEDAPKHLPSCP---DKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIIYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYKCTIVQYIGELCRYLLNQPPREAENQHQVRMALGNGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVRVNEDTMELIRGPDGICIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANNKKIAKDVFKKGDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAGASPTGNC-DLERFAQDLEKELPLYARPIFLRILPELHKTGTYKLQKTELRKEGFDPAIVKDPLFYLDARKGRYVLLDQEAYSRIQAG 639          
BLAST of slc27a-1 vs. UniProt/SwissProt
Match: sp|Q3ZKN0|S27A1_BOVIN (Long-chain fatty acid transport protein 1 OS=Bos taurus OX=9913 GN=SLC27A1 PE=2 SV=1)

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 295/626 (47.12%), Postives = 400/626 (63.90%), Query Frame = 3
Query:  189 SLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQ--WTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISK----FITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            +L +Y   GGW+F++I+  T  RD  GL  L++V+  +    R RHTIP IF+  VQR+   +A +       WTF+ +D Y+N +AN   +LG   GD +A+FME RP +V +W+G++K G   AL+N NLR+E L  C+    A  L+ G EL +A+ E++ ++ K    F +  +  DG     + L+ L         K  +   +  PP      + + D L +I+TSGTTGLPKAA + H+R+  ++        +Q +D++Y+ LPLYH+AG ++GVGQ +I G  + +RKKFSAS +W DC+KY  TVVQYIGEICRYLL QP+R  E +H VRLA GNG+RP IW EF  RF ++QIGEFYGATE N +I N   KVGS GF +RILP VYPI L+K++ +T   LRD  GLCI C+  E G LVG+I+ +DP+R+FDGYIS++A  +KI H VF KGD A+L+GD+L+ DELG+ YFRDR GDTFRW+GENVST EVE V+S  L   D  VYGV VP  EGKA MA I +         L +E  K   P YARP+F+R+   +DTTGTFK++KT L  +GF+P    D LF+LD K  HY  LD  ++ +I  G
Sbjct:   31 ALGVYVGGGGWRFLRIVCKTARRDLFGLSVLIRVRLELRRHQRARHTIPQIFQAVVQRQPERLALVDAGSGACWTFAQLDAYSNAVANLFRRLGFAPGDVVAIFMEGRPEFVGLWLGLAKAGVEAALLNVNLRREPLAFCLGTSGAKALVFGGELAAAVAEMSGELGKSLVKFCSGDVGPDGVFPDTQLLDPLL--------KETSTAPLAQPPG-----KGMDDRLFYIYTSGTTGLPKAAIIVHSRYYRIAAFGHYSYSMQAADVLYDCLPLYHSAGNIMGVGQCLIYGLTVVLRKKFSASRFWDDCVKYNCTVVQYIGEICRYLLKQPVREAEGRHRVRLAVGNGLRPSIWEEFTERFGVRQIGEFYGATECNCSIANMDGKVGSRGFNSRILPHVYPIRLVKVNEDTMELLRDAQGLCIPCQTGEPGLLVGQINQQDPLRRFDGYISESATSKKIAHSVFRKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGVLSRLLGQTDVAVYGVAVPGVEGKACMAAIADPHGRLSPNALYEELQKVLAP-YARPIFLRLLPQVDTTGTFKIQKTRLQHEGFDPRQTSDRLFFLDLKQGHYLPLDQGVYTRICSG 642          
BLAST of slc27a-1 vs. UniProt/SwissProt
Match: sp|Q6P1M0|S27A4_HUMAN (Long-chain fatty acid transport protein 4 OS=Homo sapiens OX=9606 GN=SLC27A4 PE=1 SV=1)

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 291/621 (46.86%), Postives = 413/621 (66.51%), Query Frame = 3
Query:  192 LSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFE--DEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            L +Y   GGW+F+++ I TI RD  G + LLKVK  V   ++ R T+P +F  TV+R     A +FE  D  WTF  +D Y++ +AN+L   G+ SGD  A+FME+R  +V +W+G++K+G   ALIN NLR+++L HC+   +A  L+ G+E+ SA+ E++  +    +  +F  GS    +P  G    + + LD ++       P       +   D L +I+TSGTTGLPKAA V H+R+  M+  V     ++ +DI+Y+ LPLYH+AG ++G+GQ ++ G  + IRKKFSAS +W DCIKY  T+VQYIGE+CRYLL QP R  ENQH VR+A GNG+R  IW  F +RF I Q+ EFYGATE N ++ N  ++VG+ GF +RIL FVYPI L++++ +T   +R  +G+CI C+P E G+LVG+I  KDP+R+FDGY++  AN +KI  DVF KGD+A+LTGD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L++ D  VYGVEVP TEG+AGMA +     N  DL+   + L+++LP+YARP+F+R+   +  TGT+K +KT+L K+GF+P ++ D LFYLD +   Y  LD   + +I  G
Sbjct:   30 LFLYLGSGGWRFIRVFIKTIRRDIFGGLVLLKVKAKVRQCLQERRTVPILFASTVRRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQARGLASGDVAAIFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFGSEMASAICEVHASLDP--SLSLFCSGSW---EP--GAVPPSTEHLDPLLKDAPKHLPSCP---DKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIVYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAENQHQVRMALGNGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVRVNEDTMELIRGPDGVCIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANNKKIAKDVFKKGDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNC-DLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAG 639          
BLAST of slc27a-1 vs. UniProt/SwissProt
Match: sp|Q5RDY4|S27A4_PONAB (Long-chain fatty acid transport protein 4 OS=Pongo abelii OX=9601 GN=SLC27A4 PE=2 SV=1)

HSP 1 Score: 589.341 bits (1518), Expect = 0.000e+0
Identity = 293/621 (47.18%), Postives = 413/621 (66.51%), Query Frame = 3
Query:  192 LSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFE--DEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            L +Y   GGW+F+++ I TI RD  G + LLKVK  V   +R R T+P +F  TV+R     A +FE  D  WTF  +D Y++ +AN+L   G+ SGD  A+FME+R  +V +W+G++K+G   ALIN NLR+++  HC+   +A  L+ G+E+ SA+ EI+  +    +  +F  GS    +P N +  S +  LD ++       P       +   D L +I+TSGTTGLPKAA V H+R+  M+  V     ++ +DI+Y+ LPLYH+AG ++G+GQ ++ G  + IRKKFSAS +W DCIKY  T+VQYIGE+CRYLL QP R  ENQH VR+A GNG+R  IW  F +RF I Q+ EFYGATE N ++ N  ++VG+ GF +RIL FVYPI L++++ +T   +R  +G+CI C+P E G+LVG+I  KDP+R+FDGY++  AN +KI  DVF KGD+A+LTGD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L++ D  VYGVEVP TEG+AGMA +     N  DL+   + L+++LP+YARP+F+R+   +  TGT+K +KT+L K+GF+P ++ D LFYLD +   Y  LD   + +I  G
Sbjct:   30 LFLYLGSGGWRFIRVFIKTIRRDIFGGLVLLKVKAKVRQCLRERRTVPILFASTVRRHPDKTALIFEGTDTLWTFRQLDEYSSSVANFLQARGLASGDVAAIFMENRNEFVGLWLGMAKLGVEAALINTNLRRDAQLHCLTTSRARALVFGSEMASAICEIHASLDP--SLSLFCSGSW---EP-NAVPTSTEH-LDPLLKDAPKHLPICP---DKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPNDIVYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAENQHQVRMALGNGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVRVNEDTMELIRGPDGICIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANDKKIAKDVFKKGDQAYLTGDVLVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNC-DLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDARKGRYVPLDQEAYSRIQAG 639          
BLAST of slc27a-1 vs. TrEMBL
Match: A0A0H3YF74 (Slc27a-1 OS=Schmidtea mediterranea OX=79327 GN=slc27a-1 PE=2 SV=1)

HSP 1 Score: 1334.32 bits (3452), Expect = 0.000e+0
Identity = 658/658 (100.00%), Postives = 658/658 (100.00%), Query Frame = 3
Query:   87 MENFIENYRWLTFTFPFSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            MENFIENYRWLTFTFPFSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIDLKLLDEKLKQKLPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF
Sbjct:    1 MENFIENYRWLTFTFPFSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIDLKLLDEKLKQKLPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 658          
BLAST of slc27a-1 vs. TrEMBL
Match: A0A1S3IQ22 (long-chain fatty acid transport protein 4 OS=Lingula unguis OX=7574 GN=LOC106165824 PE=4 SV=1)

HSP 1 Score: 681.789 bits (1758), Expect = 0.000e+0
Identity = 344/673 (51.11%), Postives = 455/673 (67.61%), Query Frame = 3
Query:   69 FFLTPEMENFIENYRWLTFTFPFSVLFMLSYYSLIVNFLLSLSI--------YCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKP-LNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            F L   + +F+ +Y   T T   S+LF++    L   F LS+ I        Y   GGW+F  ++I T PRD R L  L+ +K  +  ++R    +  +F KTV+R+    A LFE++ WTF  VD Y+N +ANY    G + GD IA+FME+RP +V +W+G++KIG   ALINFNLR E+L HC+    A  LI GTEL  A+++ N    + ++  I+  G    R P LNG   +    LD +I M S+++PP    I  K++D L FI+TSGTTGLPKAA +TH RF  MS GV +M  ++ SD+IY+ LPLYH+AGG++GVGQ+II G  + ++KKFSAS +W DC+ Y  TV+QYIGEICRYLL QP RP E QH VRLA+GNG+RPQIW +F +RF +K+IGEFYGATE NAN++N   K+G+VGF TRI P +YP+TLIK+D ETG  +R +NGLC+ C+P E GELVGKI   D +R+FDGY + +A ++K+  DVF KGD AFLTGD+L+ D+ G+ YFRDR GDTFRWKGENVSTAEVEAVISN + L D  VYGVE+P  EG+AGMA IV+   + ++LK L   L++ LP YARP+FIR+   +DTTGTFKLKKT+L K GFNP L  D +FYLD K   +  L    +  I  G ++F
Sbjct:   34 FRLARVLRDFVWDYLLQTTTMK-SLLFLILASVLCFGFDLSIGISLLACFFIYLLTGGWRFAWVVIRTFPRDARALSYLIMIKLNMRWLMRTNGNLTTVFAKTVKRQPEKAAMLFENQTWTFRQVDEYSNAVANYFHDAGYRQGDVIAIFMETRPEFVCLWLGLAKIGVTGALINFNLRMEALVHCVKAADAKALIFGTELTQAMKDANGSFGRHMS--IYCTGP---RDPSLNGWASN----LDPLIEM-SLKHPPNAPVI--KLNDKLFFIYTSGTTGLPKAAVITHGRFYYMSQGVHKMFSMRSSDVIYDTLPLYHSAGGILGVGQMIISGCTLVVKKKFSASKFWDDCVAYNCTVIQYIGEICRYLLAQPFRPTETQHQVRLAYGNGLRPQIWEQFVSRFGVKKIGEFYGATEGNANVLNMEGKMGAVGFTTRIAPALYPVTLIKVDKETGEPVRGRNGLCVHCQPGEPGELVGKIIKGDIIREFDGYSNQSATEKKVARDVFSKGDMAFLTGDVLVMDQFGYLYFRDRTGDTFRWKGENVSTAEVEAVISNIIKLKDAAVYGVEIPGMEGRAGMAAIVDK-HHTVNLKALQRDLQKSLPPYARPIFIRLMEEVDTTGTFKLKKTELKKVGFNPALTGDKMFYLDSKIGEFTPLSKQSYNDICGGKIRF 692          
BLAST of slc27a-1 vs. TrEMBL
Match: K1PVG0 (Long-chain fatty acid transport protein 4 OS=Crassostrea gigas OX=29159 GN=CGI_10006416 PE=4 SV=1)

HSP 1 Score: 662.914 bits (1709), Expect = 0.000e+0
Identity = 327/645 (50.70%), Postives = 446/645 (69.15%), Query Frame = 3
Query:  135 FSVLFMLSYY---SLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            F++   LSYY   S  V  L+   +Y A GGW+F  ++I T+PRD + L  L+K+K      I N  TI D+F KT  +  +    LFE ++WT+ DV++Y N++ANY  + G + GD +AL ME+RP YV  W+G+SKIGAV ALIN+NLR + L H +   ++ G++   ++  AL+EI   +S+    +++  GS+         +G +   +D I+  +S   PP  R +  K  D L ++FTSGTTGLPKAA ++H+RF  M+  V+Q + + E D++Y+ LPLYHTAGG+IGVGQ+II G+ + I+KKFSAS +W DC++YK T  QYIGEICRYLL QP++P E QH VR+ FGNG++PQIW EFQ RF + Q+GEFYGATE N N IN  N++G+VGF T I P +YPITLIKID  TG  +RD+NG+CI+ KP E GELVGKI   D +R+FDGY++  A  +K+  DVF KGD+AFLTGD+L+ DE G+FYFRDR GDTFRWKGENVST EVEAVISN + LND VVYGVE+P  EG+AGMATIV+   N++DL+ L   L++ LP YA+PLFIRI +++DTTGTFKLKK DL K+GF+P+++ D L+ L   +  Y  +   ++  I  G ++ 
Sbjct:    8 FALGCFLSYYLGLSCTVTTLVVFGVYLATGGWRFTWVVINTLPRDLKALQVLIKLKLQTKKYIANETTIADLFSKTAAKYPNKDCILFEKQKWTYRDVEIYVNRVANYFQEEGYQKGDVVALLMENRPEYVCFWLGLSKIGAVAALINYNLRNQPLAHSVKAAESKGIVFAGDMSLALEEIMPSLSR--DLRLYCIGSMAS-------SGISPIYMDPILQ-KSPDFPP--RKVRVKFTDKLFYVFTSGTTGLPKAAIISHSRFNYMTVAVNQFMNLTEEDVLYDCLPLYHTAGGVIGVGQMIIAGTTLVIKKKFSASRFWDDCVEYKCTAGQYIGEICRYLLAQPVKPAETQHKVRVMFGNGLKPQIWAEFQKRFGVAQMGEFYGATEGNCNTINPDNRIGAVGFTTMIAPALYPITLIKIDERTGEHIRDRNGVCIRAKPGEPGELVGKIVKGDALREFDGYVNKQATDKKVCSDVFRKGDQAFLTGDILMMDEFGYFYFRDRTGDTFRWKGENVSTNEVEAVISNIIKLNDAVVYGVEIPGLEGRAGMATIVDE-TNSLDLENLHSALQKSLPAYAKPLFIRIKKSVDTTGTFKLKKVDLRKEGFDPSIVKDPLYCL--ISGKYQPITEQVYNDICSGKIRL 637          
BLAST of slc27a-1 vs. TrEMBL
Match: A0A0B6Z9V5 (AMP-binding domain-containing protein OS=Arion vulgaris OX=1028688 GN=ORF54622 PE=4 SV=1)

HSP 1 Score: 656.751 bits (1693), Expect = 0.000e+0
Identity = 323/648 (49.85%), Postives = 433/648 (66.82%), Query Frame = 3
Query:  117 LTFTFPFSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            + F+   + L+M     +++   + L  Y A GGW+FM+I++LT+PRD  GL  L+ V   V   IR   T+P IF++ V +  +    +F ++QW+F D   ++N++ NY  + G + GD +A+F E+   Y+ +W+G+S+IG   ALINFNLR  SLTHCI    A G+I    L  AL++I   +S  + +   IDGS        G      KIL + +   S   PP   ++  K  D L+ ++TSGTTGLPKAA V+H RF  ++YGV     I  +DI Y  LPLYHTAGG++G GQ ++  S +AIR KFSAS +W+DC+KYKAT  QYIGEICRYLL QP+RPEE QH VRL FGNG++PQIW +FQ RF +K IGEFYGATE N  I+N  N++G+VGFGTRI PF+YPITL+K++PET   +RDKNG+C++ +P E GELVGKI   +P+R+FDGY+ D +  +K++HDVF KGD AF TGD+L+ DELG+ YFRDR GDTFRW+GENVST EVEAVISN + L D VVYGVEVP  EG+AGMA IV+   N++D+  L   L + LPVYARPLF+R  +  DTTGTFKLKK  L  +GF+ ++I D + YL+     Y  L  A+   I+ G L+ 
Sbjct:    6 VAFSALGASLWMFLNTGILLTLSMVLGAYLATGGWRFMRIVLLTLPRDVYGLRVLITVTLRVKYNIRMNRTVPKIFDENVLKYPNKTFLMFNEKQWSFKDSQDFSNRVGNYFYESGYRKGDVVAVFSENCLEYIPLWLGLSRIGVTAALINFNLRDISLTHCIQAANAKGVIYADNLQDALKDIKPHLSPSLNYYA-IDGS--------GSQVLQAKILSQEVTKRSSYTPP---NLDVKCADRLLLVYTSGTTGLPKAAVVSHTRFCYLAYGVQLFFKITPADIDYISLPLYHTAGGILGAGQGVLGASTLAIRAKFSASQFWTDCVKYKATTAQYIGEICRYLLAQPVRPEETQHTVRLMFGNGVKPQIWKQFQERFGVKLIGEFYGATEGNCAIVNFENRIGAVGFGTRIAPFLYPITLMKVNPETNEIIRDKNGICVKAEPGEPGELVGKIVKGNPVREFDGYVDDKSTSKKVIHDVFVKGDLAFSTGDILVMDELGYMYFRDRTGDTFRWRGENVSTNEVEAVISNAIRLQDAVVYGVEVPGNEGRAGMAAIVDE-TNSVDVAQLGLSLNRSLPVYARPLFLRFLKEADTTGTFKLKKNKLRDEGFDVSVIKDRIHYLNPDNKQYELLTPAVHANIISGKLRL 640          
BLAST of slc27a-1 vs. TrEMBL
Match: A0A433TUZ0 (AMP-binding domain-containing protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_006892 PE=4 SV=1)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 320/638 (50.16%), Postives = 423/638 (66.30%), Query Frame = 3
Query:  135 FSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKI---LDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQI 2039
             +VL  +   SL    L   +IY   GGW+FMK++I+T+PRD + L  L+ + + V   I    T+  IF +TVQ+  +    L++DE WTFS    Y+N++AN+L + G + GD +A+F E+ P YV +W+G+SKIG + ALINFNLR  +L HCI   KA  LI  + L  AL+ +   +     +                  GS+D     L + IN      PP    +  K  D L +++TSGTTGLPKAA +++ R+  M+YGV    G++  D+ Y PLPLYHTAGG++G GQ +++GS +AIR KFSAS +W+DC+KY AT  QYIGEICRYLL QP RPEE QH VR+ FGNGI+PQIW +FQ RF IK +GEFYGATE N NI+N  NK+G+VGF T I PF+YPITL+K+DP T   +RD +G+C+  KP E GELVGKI   +P+R+FDGY+  +A+ +K++ DVF KGD+AF TGD+L+ DE G+ +FRDR GDTFRW+GENVST EVEAVISN + LND +VYGVEVP  EGKAGMA IV+  Q  +D+  L E L + LP YARPLFIR     DTTGTFKL KT L  +GFN N I D +F+L+ K+  Y  L  A+++ I
Sbjct:   68 LTVLLFVFNMSLSTALLGLFAIYLVTGGWRFMKVVIITLPRDLQALKILITIMWRVRRNITQSKTVTRIFAETVQKYPNKAMMLYKDELWTFSQAYQYSNRVANFLHEEGYRKGDVVAIFTENCPEYVPLWLGMSKIGVIAALINFNLRDMALVHCIQASKAKALIFASSLTDALKMVRPQLPSNTVYYCLDQ------------VGSSDCPSVNLSQRINQYPDYEPPA---VDGKCTDALFYVYTSGTTGLPKAAVISNIRYCYMAYGVELFFGLKPEDVNYIPLPLYHTAGGILGTGQAVLKGSTLAIRNKFSASQFWADCVKYNATSAQYIGEICRYLLAQPPRPEEQQHLVRVMFGNGIKPQIWPQFQQRFGIKLVGEFYGATEGNCNIVNFENKIGAVGFTTMIAPFLYPITLVKVDPATNEVVRDADGVCVLAKPGEPGELVGKIVKGNPVREFDGYLDSSASSKKVITDVFRKGDQAFSTGDILVMDECGYMFFRDRTGDTFRWRGENVSTNEVEAVISNAIGLNDAIVYGVEVPGNEGKAGMAAIVDE-QGQVDVNKLGECLARSLPSYARPLFIRFIPVADTTGTFKLSKTKLRDEGFNVNEIQDPMFFLNPKSRLYEPLTEAVYKDI 689          
BLAST of slc27a-1 vs. Ensembl Cavefish
Match: slc27a1a (solute carrier family 27 member 1 [Source:NCBI gene;Acc:103031302])

HSP 1 Score: 616.305 bits (1588), Expect = 0.000e+0
Identity = 306/627 (48.80%), Postives = 416/627 (66.35%), Query Frame = 3
Query:  189 SLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFE--DEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDIS----KFITFKIFID-GSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            S  +Y   GGWK++ + + T  RD  GL  LL+VK  +W  +RN +TIP IF +TV+R  +  A ++E   E WTFS++D   N +A++ L  G  SGD +ALFMESRP  VA+W+G++KIG   ALINFNLR++SL HC+    A  L+ G EL  A+ E+N  +S    +F T  +  D  S++  KPL       D IL       S ++PP   H ++  +D L +I+TSGTTGLPKAA V H+R+  ++        +Q  DIIY+ LPLYH+AG ++GVGQ +I G  + ++KKFSAS +W DCIKY  TVVQYIGEICRYLL QP+RP E  H VRLA GNG+RP +W  F  RF IKQIGEFYGATE N +I N   KVG+ GF +RILP VYPI L+K+D ET   +R+K GLC+ C+P E G LVGKI+ +DP+R+FDGY +  A ++KI H+VF   D A+L+GD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L   D  VYGV VP  EGKAGMA I ++   + + +    ++++ LP YARP+F+RI  ++DTTGTFK++KT L K+G++P +  D +++L+ +   Y  ++  +F  +  G
Sbjct:   31 SFGVYLGTGGWKYLYVAVRTAKRDLNGLCVLLRVKLALWRHVRNGNTIPSIFAQTVKRHPNKPALVYEATGETWTFSELDQLCNAVAHWALSQGWTSGDVVALFMESRPLQVALWLGLAKIGVEAALINFNLRRDSLLHCLGVSGARALVFGAELADAVSEVNSALSTSTIRFSTGDLKPDVMSVLDAKPL-------DPIL-----AASPRHPPPCTH-SKGFNDRLFYIYTSGTTGLPKAAIVVHSRYFRIAAFGYFSFRMQSDDIIYDCLPLYHSAGNIMGVGQCVIHGLTVVVKKKFSASRFWDDCIKYNCTVVQYIGEICRYLLSQPVRPSERGHRVRLAVGNGLRPSVWEAFTERFGIKQIGEFYGATECNCSIANMDGKVGACGFNSRILPNVYPIRLVKVDEETMELVRNKEGLCVPCRPGEPGLLVGKINQQDPLRRFDGYANQEATRKKIAHNVFKPNDSAYLSGDVLVMDELGYMYFRDRSGDTFRWKGENVSTTEVEGTLSGLLGQTDVAVYGVSVPGVEGKAGMAAIADT-TGSFNGESFLREVQKALPPYARPVFLRISPHVDTTGTFKIQKTRLQKEGYDPRITADQIYFLNSRAGRYEVVNEELFSALEGG 643          
BLAST of slc27a-1 vs. Ensembl Cavefish
Match: slc27a1b (solute carrier family 27 member 1b [Source:ZFIN;Acc:ZDB-GENE-061013-672])

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 277/585 (47.35%), Postives = 381/585 (65.13%), Query Frame = 3
Query:  162 YSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFE--DEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESI-QNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTG 1907
            +S+ V F     +Y   GGW+F+     TI RD  GL  L++VKF V   ++ R TIP IF + V       A + E   E W+FS++D  ++ +  + L+ G +SGD +A+FME RP  VA+W+G++K+G   ALINFNLRK+SL HC+    A G++ G EL  A+ EI+  ++     K+F  GSL    P   L  S   + D  + + +  Q PP   H  +  +D L +I+TSGTTGLPKAA V H+RF  +S        ++  D+IY  LPLYH+AG ++GVGQ ++ G  + IR+KFSAS +W DC++Y  TVVQYIGEICRYLL QP+RP E  H VR+A GNG+RP +W  F  RF +KQIGEFYGATE N +I N   K+G+ GF + ILP +YPI L++++ E    +RD+ GLCI C+P E G LVG+I  +DP+R+FDGY +  A  +KI+H+VF KGD A+L+GDL++ D LG+ YFRDR GDTFRW+GENVST EVE ++S  LN  D  VYGV +P  EGKAGMA I +S   + D +   +++++ LP YARPLF+R+   +DTTG
Sbjct:   67 WSIAVGF----GVYLCSGGWRFIDTAARTIRRDVSGLWVLIRVKFLVRRHLQERSTIPSIFSERVALHPDKPALVEEATGEVWSFSELDQRSDAVGRWALEQGWRSGDVVAVFMEGRPLMVALWLGLAKVGVEAALINFNLRKDSLLHCVEVSGAQGMVFGAELVDAVVEISGCLAG--RMKLFCTGSL----PAGSLP-SELPVQDLDLQLANTPQTPPPVSH-NKGFNDRLFYIYTSGTTGLPKAAIVVHSRFYRISAFGYYSFKLRPDDVIYTCLPLYHSAGNIMGVGQCLVHGLTVVIRRKFSASRFWDDCVRYNCTVVQYIGEICRYLLSQPVRPSEANHCVRVAIGNGLRPNVWEAFAKRFGMKQIGEFYGATECNCSIANLDGKMGACGFNSMILPNIYPIRLLRVEEENMELIRDREGLCIPCRPGEPGVLVGRIIQQDPLRRFDGYANQEATNKKIIHNVFQKGDSAYLSGDLMVMDRLGYIYFRDRSGDTFRWRGENVSTTEVEGILSGLLNQTDVAVYGVSIPGVEGKAGMAAIADS-TGSFDCETFLQEVQKSLPSYARPLFLRLSPEVDTTG 638          
BLAST of slc27a-1 vs. Ensembl Cavefish
Match: slc27a1b (solute carrier family 27 member 1b [Source:ZFIN;Acc:ZDB-GENE-061013-672])

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 277/585 (47.35%), Postives = 381/585 (65.13%), Query Frame = 3
Query:  162 YSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFE--DEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESI-QNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTG 1907
            +S+ V F     +Y   GGW+F+     TI RD  GL  L++VKF V   ++ R TIP IF + V       A + E   E W+FS++D  ++ +  + L+ G +SGD +A+FME RP  VA+W+G++K+G   ALINFNLRK+SL HC+    A G++ G EL  A+ EI+  ++     K+F  GSL    P   L  S   + D  + + +  Q PP   H  +  +D L +I+TSGTTGLPKAA V H+RF  +S        ++  D+IY  LPLYH+AG ++GVGQ ++ G  + IR+KFSAS +W DC++Y  TVVQYIGEICRYLL QP+RP E  H VR+A GNG+RP +W  F  RF +KQIGEFYGATE N +I N   K+G+ GF + ILP +YPI L++++ E    +RD+ GLCI C+P E G LVG+I  +DP+R+FDGY +  A  +KI+H+VF KGD A+L+GDL++ D LG+ YFRDR GDTFRW+GENVST EVE ++S  LN  D  VYGV +P  EGKAGMA I +S   + D +   +++++ LP YARPLF+R+   +DTTG
Sbjct:   39 WSIAVGF----GVYLCSGGWRFIDTAARTIRRDVSGLWVLIRVKFLVRRHLQERSTIPSIFSERVALHPDKPALVEEATGEVWSFSELDQRSDAVGRWALEQGWRSGDVVAVFMEGRPLMVALWLGLAKVGVEAALINFNLRKDSLLHCVEVSGAQGMVFGAELVDAVVEISGCLAG--RMKLFCTGSL----PAGSLP-SELPVQDLDLQLANTPQTPPPVSH-NKGFNDRLFYIYTSGTTGLPKAAIVVHSRFYRISAFGYYSFKLRPDDVIYTCLPLYHSAGNIMGVGQCLVHGLTVVIRRKFSASRFWDDCVRYNCTVVQYIGEICRYLLSQPVRPSEANHCVRVAIGNGLRPNVWEAFAKRFGMKQIGEFYGATECNCSIANLDGKMGACGFNSMILPNIYPIRLLRVEEENMELIRDREGLCIPCRPGEPGVLVGRIIQQDPLRRFDGYANQEATNKKIIHNVFQKGDSAYLSGDLMVMDRLGYIYFRDRSGDTFRWRGENVSTTEVEGILSGLLNQTDVAVYGVSIPGVEGKAGMAAIADS-TGSFDCETFLQEVQKSLPSYARPLFLRLSPEVDTTG 610          
BLAST of slc27a-1 vs. Ensembl Cavefish
Match: slc27a4 (solute carrier family 27 member 4 [Source:ZFIN;Acc:ZDB-GENE-050417-248])

HSP 1 Score: 546.584 bits (1407), Expect = 0.000e+0
Identity = 282/646 (43.65%), Postives = 387/646 (59.91%), Query Frame = 3
Query:  129 FPFSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFED--EQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            F F +L  L +  ++   L+    +   GGW   ++ + TI RD      LLKVK  V            IF +TVQ+     A +FE   E+W+F ++D Y+N++AN L + G + GD +ALFME+R  YV +W+G++KIG   ALINFNLR E+L HC+N   +  +I G++                                                     NPP      R   D L +I+TSGTTG+PKAA V H+R+  M+  V    G++  D++Y+ LPLYH+AG ++GVGQ +I G  + I+KKFSAS +W DCIKY  T+VQYIGEICRYLL QP+R  E QH VR+A GNG+R  IW EF  RF + QI EFYGATE N ++ N  NK G+ GF +RILP+VYPI L+++D ET   +R  +G+CI C P E G+LVG+I   DP+R+FDGY+++ A  +KI H VF K      T D+L+ DE G+ YFRDR GDTFRWKGENVST EVE  +S  L++ D VVYGVEVP  EGKAGMA + +  +N+ DL+     L++ LPVYARP+F+R    ++ TGTFK +KT++ ++GF+P+L+ D L++LD     Y  LD+ +   I+ G  K 
Sbjct:   12 FVFRLLLGLPWLQVVAACLI---FFFGTGGWTSFRVFVKTIGRDLHAAGVLLKVKLNV-----------KIFAETVQKYGDKTALIFEGTGEKWSFRELDDYSNRVANLLYQRGFREGDVVALFMENRSQYVGLWLGMAKIGVEAALINFNLRLEALVHCVNISGSKAVIFGSD-----------------------------------------------------NPPQ-----RGFTDRLFYIYTSGTTGMPKAAIVVHSRYYRMAALVYYGFGMRSEDVLYDCLPLYHSAGNIVGVGQCLIHGMTVVIKKKFSASKFWDDCIKYNCTIVQYIGEICRYLLNQPVRHTEQQHRVRMALGNGLRQSIWEEFMQRFNVPQIAEFYGATECNCSLGNFNNKTGACGFNSRILPYVYPIRLVRVDEETMELIRGPDGVCIPCGPGEPGQLVGRIKQNDPLRRFDGYVNETATNKKIAHSVFKK--ETVPTCDVLVMDECGYMYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEVPGVEGKAGMAAVADP-ENSTDLEKFSRDLEKALPVYARPVFLRFLPEVNKTGTFKFQKTEMRREGFDPSLVSDRLYFLDCSKGSYVPLDAELHRSIVSGKQKL 582          
BLAST of slc27a-1 vs. Ensembl Cavefish
Match: slc27a1a (solute carrier family 27 member 1 [Source:NCBI gene;Acc:103031302])

HSP 1 Score: 456.833 bits (1174), Expect = 2.179e-152
Identity = 215/402 (53.48%), Postives = 285/402 (70.90%), Query Frame = 3
Query:  843 DPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            D L +I+TSGTTGLPKAA V H+R+  ++        +Q  DIIY+ LPLYH+AG ++GVGQ +I G  + ++KKFSAS +W DCIKY  TVVQYIGEICRYLL QP+RP E  H VRLA GNG+RP +W  F  RF IKQIGEFYGATE N +I N   KVG+ GF +RILP VYPI L+K+D ET   +R+K GLC+ C+P E G LVGKI+ +DP+R+FDGY +  A ++KI H+VF   D A+L+GD+L+ DELG+ YFRDR GDTFRWKGENVST EVE  +S  L   D  VYGV VP  EGKAGMA I ++   + + +    ++++ LP YARP+F+RI  ++DTTGTFK++KT L K+G++P +  D +++L+ +   Y  ++  +F  +  G
Sbjct:  188 DRLFYIYTSGTTGLPKAAIVVHSRYFRIAAFGYFSFRMQSDDIIYDCLPLYHSAGNIMGVGQCVIHGLTVVVKKKFSASRFWDDCIKYNCTVVQYIGEICRYLLSQPVRPSERGHRVRLAVGNGLRPSVWEAFTERFGIKQIGEFYGATECNCSIANMDGKVGACGFNSRILPNVYPIRLVKVDEETMELVRNKEGLCVPCRPGEPGLLVGKINQQDPLRRFDGYANQEATRKKIAHNVFKPNDSAYLSGDVLVMDELGYMYFRDRSGDTFRWKGENVSTTEVEGTLSGLLGQTDVAVYGVSVPGVEGKAGMAAIADT-TGSFNGESFLREVQKALPPYARPVFLRISPHVDTTGTFKIQKTRLQKEGYDPRITADQIYFLNSRAGRYEVVNEELFSALEGG 588          

HSP 2 Score: 156.762 bits (395), Expect = 5.381e-40
Identity = 73/155 (47.10%), Postives = 101/155 (65.16%), Query Frame = 3
Query:  189 SLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFE--DEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTEL 647
            S  +Y   GGWK++ + + T  RD  GL  LL+VK  +W  +RN +TIP IF +TV+R  +  A ++E   E WTFS++D   N +A++ L  G  SGD +ALFMESRP  VA+W+G++KIG   ALINFNLR++SL HC+    A  L+ G EL
Sbjct:   31 SFGVYLGTGGWKYLYVAVRTAKRDLNGLCVLLRVKLALWRHVRNGNTIPSIFAQTVKRHPNKPALVYEATGETWTFSELDQLCNAVAHWALSQGWTSGDVVALFMESRPLQVALWLGLAKIGVEAALINFNLRRDSLLHCLGVSGARALVFGAEL 185          
BLAST of slc27a-1 vs. Ensembl Sea Lamprey
Match: SLC27A5 (solute carrier family 27 member 5 [Source:HGNC Symbol;Acc:HGNC:10999])

HSP 1 Score: 382.874 bits (982), Expect = 7.467e-124
Identity = 233/635 (36.69%), Postives = 341/635 (53.70%), Query Frame = 3
Query:  210 FGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSS--HIAFL-FEDEQWTFSDVDMYANKIANYLLKLG-VKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGT-ELHSALQEINDDISKFITFKIFIDGSLIQRKPLN---GLTGSADKILDKIINMESIQNPPTT--RHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCK-------PNEVGELVGKIHDKDPMRQFDGYISDAA-NQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
               W F   L L   R  R L + +    ++     +R  +  + ++ ++R S+  H  FL FED++WT+ +      + A+ L + G V+ GDT+AL ME+ PA++ +    + +     L+N NLR   L HC+   KA  L+ G+  L  A++EI+ ++++            +Q +PL       GSA   L           P  +   HIT K  D  ++I+TSGTTGLPKA KV+H R    ++  S M G++  D++Y  LPLYH++  +      +  G+ + +RKKFSAS +W DC ++  TV QY+GEICRYLL QP    +  H+VR+A GNG+R  +W  F  R    +  E YGATE N   +N   K+G+ G     L  +   +L+K D E    +RD  G CI            + G LV  I    P   FDGY+ +A   QRK++H+VF  GDR F +GD++  D+ GF YF DR+GDTFRWKGENVST EV   + +   + +  VYGV +P+ EG+AGMA ++    +++D   L   +   LP YARP FIR+   ++ T T+K  KT L+++GFNP LI   LFYLD   C Y  L   I+E I+ G  K 
Sbjct:   21 LASWIFWPQLWLGAWRSLRVLRNAVYRHRYL-----SRKPLFSVLDRLLERASATPHKVFLTFEDDRWTYEEFVRDVARTAHALQEFGGVRPGDTVALLMENEPAFLFVLFACTSLACPATLMNTNLRGRMLLHCLTTSKAQFLVTGSGPLLVAVEEISVEMNE------------LQIRPLTMGEATPGSAVPSLASTFREAPCNLPAASVRAHITAK--DAFIYIYTSGTTGLPKAVKVSHTRAWCGNFTYS-MSGVRAEDVVYIFLPLYHSSAIIAAFIGSLDIGARLVLRKKFSASHFWGDCRRHGVTVFQYVGEICRYLLSQPKNELDRVHSVRMAVGNGMRADVWARFLERHGDVRFCELYGATEGNVGFVNVDGKLGACGRDLPFLRLLIKYSLVKYDHEKDGPVRDDKGFCIPLPRGMWAGGAGQPGLLVAPISKHMP---FDGYLGNAEFTQRKVLHNVFMHGDRYFNSGDIMRIDKEGFIYFIDRVGDTFRWKGENVSTMEVADTLGDLDFIKEVTVYGVTIPNNEGRAGMAAVILEEGHSLDGPELYRHVVAHLPTYARPYFIRLQEALELTNTYKQIKTHLLQEGFNPALIRAPLFYLDSAACSYTPLTRQIYEGIVSGKAKL 632          
BLAST of slc27a-1 vs. Ensembl Sea Lamprey
Match: SLC27A5 (solute carrier family 27 member 5 [Source:HGNC Symbol;Acc:HGNC:10999])

HSP 1 Score: 274.633 bits (701), Expect = 4.178e-86
Identity = 147/348 (42.24%), Postives = 201/348 (57.76%), Query Frame = 3
Query: 1041 GSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCK-------PNEVGELVGKIHDKDPMRQFDGYISDAA-NQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            G+ + +R+KFSAS +W DC ++  TV QY+GEICRYLL QP    +  H+VR+A GNG+R  +W  F  R    +  E YGATE N   +N   K+G+ G     L  +    L+K D E    +RD  G CI            + G LV  I    P   FDGY+ +A   QRK++H+VF  GDR F +GD++  D+ GF YF DR+GDTFRWKGENVST EV   + +   + +  VYGV +P+ EG+AGMA ++    +++D   L   +   LP YARP FIR+   ++ T T+K  KT L+++GFNP LI   LFYLD   C Y  L   I+E I+ G +K 
Sbjct:    4 GARLVLRRKFSASHFWGDCRRHGVTVFQYVGEICRYLLSQPKNELDRVHSVRMAVGNGMRADVWARFLERHGDVRFCELYGATEGNVGFVNVDGKLGACGRDLPFLRLLIKYALVKYDHEKDGPVRDDKGFCIPLPRGMWAGGAGQPGLLVAPISKHMP---FDGYLGNAEFTQRKVLHNVFMHGDRYFNSGDIMRIDKQGFIYFIDRVGDTFRWKGENVSTMEVADTLGDLDFIKEVTVYGVTIPNNEGRAGMAAVILEEGHSLDGPELYRHVVGHLPTYARPYFIRLQEALELTNTYKQIKTHLLQEGFNPALIRAPLFYLDSAACSYMPLTRQIYEGIVSGKVKL 348          
BLAST of slc27a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003024.1 (pep scaffold:Pmarinus_7.0:GL478098:51343:56450:1 gene:ENSPMAG00000002757.1 transcript:ENSPMAT00000003024.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.176 bits (313), Expect = 1.767e-32
Identity = 85/251 (33.86%), Postives = 121/251 (48.21%), Query Frame = 3
Query: 1227 IWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCK-------PNEVGELVGKIHDKDPMRQFDGYISDAA-NQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVES-GQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFN 1952
            +W  F  R    +  E YGATE N    N   K+ + G     L  +    L+K D E    +RD  G CI            + G LV  I    P   FDGY+ +A   QRK++H+VF  GDR F  GD++  D+ GF YF DR+GDTFRWKGENVST E+   +S+   + +  VYGV +P     + +   V   G  + + + +           + P  +     ++ T TFK  KT L+++GFN
Sbjct:    3 VWARFLERHGDVRFCELYGATEGNVGFANVDGKLRACGRDLPFLRLLIKYALVKNDHEKDGPVRDDKGFCIPLPRGMWAGGAGQPGLLVAPISKHMP---FDGYLGNAEFTQRKVLHNVFMHGDRYFNLGDIMRIDKEGFIYFIDRVGDTFRWKGENVSTMELADTLSDLDFIKEVTVYGVTIPSCIRMSYLVIEVTCIGSPSPNEQYVCIIYVVINYYMSHPEPLITQEALELTNTFKQIKTHLLQEGFN 250          
BLAST of slc27a-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005192.1 (pep scaffold:Pmarinus_7.0:GL479731:2711:5574:-1 gene:ENSPMAG00000004718.1 transcript:ENSPMAT00000005192.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.931 bits (289), Expect = 6.294e-29
Identity = 83/273 (30.40%), Postives = 139/273 (50.92%), Query Frame = 3
Query:  210 FGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSS--HIAFL-FEDEQWTFSDVDMYANKIANYLLKLG-VKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGT-ELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGM 1013
               W F   L L   R  R L + +    ++     +R  +  + ++ ++R S+  H  FL FED++WT+ +      + A+ L + G V+ GDT+AL ME+ PA++ +    + +     L+N NLR   L HC+   KA  L+ G+  L  A++EI+ ++++ +  +    G      P+  L   A    +   N+ +        HIT K  D  ++I+TSGTTGLPKA KV+H R    ++  S M G++  D++Y  LPLYH++  M
Sbjct:   20 LASWIFWPQLWLGAWRSLRVLRNAVYRHRYL-----SRKPLFSVLDRLLERASATPHKVFLTFEDDRWTYEEFVRDVARTAHALQEFGGVRPGDTVALLMENEPAFLFVLFACTSLACPATLMNTNLRGRMLLHCLTTSKAQFLVTGSGPLLVAVEEISVEMNE-LQIRPLTMGDATPGSPVPSL---ASTFREAPCNLPAAS---VRAHITAK--DAFIYIYTSGTTGLPKAVKVSHTRAWCGNFNYS-MSGVRAEDVVYIFLPLYHSSAIM 277          
BLAST of slc27a-1 vs. Ensembl Yeast
Match: FAT1 (Very long chain fatty acyl-CoA synthetase and fatty acid transporter; activates imported fatty acids with a preference for very long lengths (C20-C26); has a separate function in the transport of long chain fatty acids [Source:SGD;Acc:S000000245])

HSP 1 Score: 285.034 bits (728), Expect = 1.556e-86
Identity = 195/618 (31.55%), Postives = 313/618 (50.65%), Query Frame = 3
Query:  297 FVWNMIRNRHTIPDIFEKTVQRKSSHIAFLF--------EDEQWTFSDVDMYANKIANYLLKLG--------VKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMES---IQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVG------FGTRILPFV-YPITLIKIDP-ETGVALRDKNGLCIQCKPNEVGELVGKI-HDKDPMRQFDGYISDAANQR-KIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVI--SNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQN----AIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLID--DNLFYLDHKTCHYASLDSAIFEQI 2039
            ++ ++ R+R     +F K VQ+   H+A  +        E +  TF+ ++ Y     N +L+L         V++GD +A+   ++P +V +W+ +  IGA+PA +N+N +   L H +     + +    +  + ++E  ++I            + +    LN L      ++ +++N +S   +Q       +      P M I+TSGTTGLPK+A ++  +  +       +L +     ++  +PL+H+   ++G   ++  G  +A+  KFSAS +W       AT +QY+GE+CRYLL  PI   E  H V++A+GNG+RP IW +F+ RF I+ IGEFY ATE  A       + G  G      +GT I  F+ +  TL+++DP +  V  R+  G C      E GE++ +I   K P   F GY+ +A   + K+V DVF +GD  +  GDLL  DE G +YF DR+GDTFRWK ENVST EVE  +  SN       +V G++VP  EG+AG A I  +  +    A    L D   +  LP YA PLF++    I  T   K+ K  + ++   P  +D  D +F+L +    Y  L +A +E I
Sbjct:   67 YIIDVRRHRFQNWYLFIKQVQQNGDHLAISYTRPMAEKGEFQLETFTYIETY-----NIVLRLSHILHFDYNVQAGDYVAIDCTNKPLFVFLWLSLWNIGAIPAFLNYNTKGTPLVHSLKISNITQVFIDPDASNPIRESEEEIK-----------NALPDVKLNYL--EEQDLMHELLNSQSPEFLQQDNVRTPLGLTDFKPSMLIYTSGTTGLPKSAIMSWRKSSVGCQVFGHVLHMTNESTVFTAMPLFHSTAALLGACAILSHGGCLALSHKFSASTFWKQVYLTGATHIQYVGEVCRYLLHTPISKYEKMHKVKVAYGNGLRPDIWQDFRKRFNIEVIGEFYAATE--APFATTTFQKGDFGIGACRNYGTIIQWFLSFQQTLVRMDPNDDSVIYRNSKGFCEVAPVGEPGEMLMRIFFPKKPETSFQGYLGNAKETKSKVVRDVFRRGDAWYRCGDLLKADEYGLWYFLDRMGDTFRWKSENVSTTEVEDQLTASNKEQYAQVLVVGIKVPKYEGRAGFAVIKLTDNSLDITAKTKLLNDSLSRLNLPSYAMPLFVKFVDEIKMTDNHKILK-KVYREQKLPKGLDGNDTIFWLKNYK-RYEVLTAADWEAI 662          
BLAST of slc27a-1 vs. Ensembl Yeast
Match: ACS2 (Acetyl-coA synthetase isoform; along with Acs1p, acetyl-coA synthetase isoform is the nuclear source of acetyl-coA for histone acetylation; mutants affect global transcription; required for growth on glucose; expressed under anaerobic conditions [Source:SGD;Acc:S000004143])

HSP 1 Score: 96.2857 bits (238), Expect = 4.347e-21
Identity = 112/481 (23.28%), Postives = 198/481 (41.16%), Query Frame = 3
Query:  405 TFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEIN------------DDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQ-MLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSA----SAYWSDCIKYKAT----------VVQYIGE--ICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQ--IGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALR--DKNG-LCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGV 1745
            TF ++    ++IA  L   GVK GDT+A+++   P  V   + +++IGA+ +++       SL   + D  +  +I   E     + IN            D +S+ + F         QR    G+   A +  D   + E+ +       ++    DPL  ++TSG+TG PK    T   +++ +   ++ +  I   D+++    +    G    +   +  G+   I +   A      YW    ++KAT          +++ +GE  I +Y        + +   V  + G  I P +W  +  +   K   I +    TES +++I  +        G+  +PF + I    IDP TGV L   D  G L ++     +   V   HD    R  D Y+              Y G   + TGD   +D  G+++ R R+ D     G  +ST+E+EA ISN  N+++  V G+
Sbjct:  124 TFGELLRKVSQIAGVLKSWGVKKGDTVAIYLPMIPEAVIAMLAVARIGAIHSVVFAGFSAGSLKDRVVDANSKVVITCDEGKRGGKTINTKKIVDEGLNGVDLVSRILVF---------QRTGTEGIPMKAGR--DYWWHEEAAKQRTYLPPVSCDAEDPLFLLYTSGSTGSPKGVVHTTGGYLLGAALTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLTLGTASIIFESTPAYPDYGRYWRIIQRHKATHFYVAPTALRLIKRVGEAEIAKY--------DTSSLRVLGSVGEPISPDLWEWYHEKVGNKNCVICDTMWQTESGSHLIAPLAGAVPTKPGSATVPF-FGINACIIDPVTGVELEGNDVEGVLAVKSPWPSMARSVWNHHD----RYMDTYLKP------------YPGH--YFTGDGAGRDHDGYYWIRGRVDDVVNVSGHRLSTSEIEASISNHENVSEAAVVGI 566          
BLAST of slc27a-1 vs. Ensembl Yeast
Match: ACS1 (Acetyl-coA synthetase isoform; along with Acs2p, acetyl-coA synthetase isoform is the nuclear source of acetyl-coA for histone acetylation; expressed during growth on nonfermentable carbon sources and under aerobic conditions [Source:SGD;Acc:S000000050])

HSP 1 Score: 81.6481 bits (200), Expect = 1.801e-16
Identity = 99/464 (21.34%), Postives = 179/464 (38.58%), Query Frame = 3
Query:  459 LGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKV--------------------HDPLMFIFTSGTTGLPKAAKVTHARFVMMS-YGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSA----SAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRL-----AFGNGIRPQIWVEFQTRFKIKQIG--EFYGATESNANIINNV-NKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNG---LCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYG 1742
            +GV+ GDT+A++M   P  +   + IS+IGA+ +++       SL   IND  +  +I   E +           K I  K  +D +L +   +             ++      NP    H  R +                     DPL  ++TSG+TG PK  + + A +++ +   +       + D+ +    +    G    V   ++ G    + +   A    S YW    ++K T   Y+      LL +        H+++      + G  I  ++W  +  +    +I   + Y  TES ++++  +   V  +  G+   PF + I  + +DP TG  L   +    L ++         + K HD    R  D Y++             Y G   + TGD   +D+ G+ +   R+ D     G  +STAE+EA I     + +C V G
Sbjct:  184 MGVRKGDTVAVYMPMVPEAIITLLAISRIGAIHSVVFAGFSSNSLRDRINDGDSKVVITTDESNRG--------GKVIETKRIVDDALRETPGVR-----------HVLVYRKTNNPSVAFHAPRDLDWATEKKKYKTYYPCTPVDSEDPLFLLYTSGSTGAPKGVQHSTAGYLLGALLTMRYTFDTHQEDVFFTAGDIGWITGHTYVVYGPLLYGCATLVFEGTPAYPNYSRYWDIIDEHKVTQF-YVAPTALRLLKRAGDSYIENHSLKSLRCLGSVGEPIAAEVWEWYSEKIGKNEIPIVDTYWQTESGSHLVTPLAGGVTPMKPGSASFPF-FGIDAVVLDPNTGEELNTSHAEGVLAVKAAWPSFARTIWKNHD----RYLDTYLNP------------YPG--YYFTGDGAAKDKDGYIWILGRVDDVVNVSGHRLSTAEIEAAIIEDPIVAECAVVG 608          
BLAST of slc27a-1 vs. Ensembl Yeast
Match: PCS60 (Oxalyl-CoA synthetase; capable of catalyzing conversion of oxalate to oxalyl-CoA; catalyzes first step in pathway of oxalate degradation that functions to protect yeast from inhibitory effects of oxalate; peroxisomal protein that binds mRNA; localizes to both peroxisomal peripheral membrane and matrix, expression is highly inducible by oleic acid; similar to E. coli long chain acyl-CoA synthetase [Source:SGD;Acc:S000000426])

HSP 1 Score: 76.2554 bits (186), Expect = 6.204e-15
Identity = 109/480 (22.71%), Postives = 193/480 (40.21%), Query Frame = 3
Query:  393 DEQWTFSDVD--------MYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLIC----GTELHSA------------LQEINDDISKF-ITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIR--GSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRL--AFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGV 1745
            D Q T+ D+         M+ N   N  L   V   DT+A+ M +   ++  ++G +    + A +N N +++     +ND+K S  IC     T+L S+            + E+  D ++F + + I+      +R     L  +      K +N   ++ P   R       D  + + TSGTT  PK   + H   V  +  ++    +   D  Y  +PL+H   G+IGV     R  GS++ +   F    +W   +KY       +  I   +L  P +P    H +R   +  + + P  + + +  F    + E Y  TE++  + +N    G    GT   P    +T++ +D    V             P +VGE+   I  ++      GY    AN  K   + F K +  F TGD    D  GF     R+ +     GE +S  E++ ++ +   +++ V +GV
Sbjct:   29 DTQVTYRDLSHMVGHFQTMFTN--PNSPLYGAVFRQDTVAISMRNGLEFIVAFLGATMDAKIGAPLNPNYKEKEFNFYLNDLK-SKAICVPKGTTKLQSSEILKSASTFGCFIVELAFDATRFRVEYDIYSPEDNYKRVIYRSLNNA------KFVNTNPVKFPGFARS-----SDVALILHTSGTTSTPKTVPLLHLNIVRSTLNIANTYKLTPLDRSYVVMPLFH-VHGLIGVLLSTFRTQGSVV-VPDGFHPKLFWDQFVKYNCNWFSCVPTISMIMLNMP-KPNPFPH-IRFIRSCSSALAPATFHKLEKEFNAPVL-EAYAMTEASHQMTSNNLPPGKRKPGTVGQP--QGVTVVILDDNDNV-----------LPPGKVGEV--SIRGENVTL---GY----ANNPKANKENFTKRENYFRTGDQGYFDPEGFLVLTGRIKELINRGGEKISPIELDGIMLSHPKIDEAVAFGV 467          
BLAST of slc27a-1 vs. Ensembl Nematostella
Match: EDO43421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYU2])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 290/654 (44.34%), Postives = 418/654 (63.91%), Query Frame = 3
Query:  114 WLTFTFPFSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSL----LKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVH-DPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            WL +    S LF  + +         ++++   GG  F ++   TI RD + +++     LK +++ +  +     + D+FE T     +  AF+FE + WTF + D +AN+IANY    G   GD IAL +E+RP ++ IW+G+SKIG + ALIN NL ++SL HCI+   +  +I G+    ++ EI D + + + F  +  G+       NG +      LD+ +   S   P    H  +K H D LM+I+TSGTTGLPKAA + ++R+ M + G+  +LG    D++Y PLPLYH+A G++ VG  I+ GS + +RKKFSAS +W +CI++  TVVQYIGE+CRYLL QP RP +NQH+VRLA GNG+RP+IW EFQ+RF I +IGEFY +TE NAN+IN  N+VG+VGF +RI+P  YP+ ++++DPETG  +R  +GL + C+P E GE+V +I     + +FDGY++     +KI   VF K D AFL+GD+++QDE G+ YFRDR GDTFRW GENVSTAEVE++ S  + L D VVYGVEVP  EGKAGM  IV++ +N+++L  L  + K  LP YARP F+R+ + +D TGTFK +K  L K+GF+   + D L+YLD KT  Y  LDS  ++ I+   L+ 
Sbjct:   16 WLIYALQISWLFFPAIF---------MAVFLCSGGRNFPRVFFKTILRDLKAIIAFTIVQLKCRYYNYKNV----IMADLFESTAASLPNKPAFVFEGKSWTFKEADEFANRIANYFKSQGYAKGDVIALILENRPEFILIWLGLSKIGVISALINTNLHQDSLLHCISAANSKAIIFGSNFADSVVEIQDKLPENMLF--YCHGN-------NGNSAIPAVSLDQTLRDSS---PKKAVHSHQKSHLDVLMYIYTSGTTGLPKAALIRNSRYFMAT-GLYPLLGGTTKDVVYCPLPLYHSAAGILAVGYCIVHGSTLVLRKKFSASRFWDECIEHNVTVVQYIGELCRYLLAQPPRPTDNQHSVRLAIGNGLRPKIWTEFQSRFNITKIGEFYASTEGNANVINIDNQVGAVGFTSRIVPSAYPVKVVRVDPETGELIRGPDGLAVDCQPGEAGEMVSRIIKSSAVMRFDGYLNQRETSKKIARSVFSKDDYAFLSGDIVVQDEYGYVYFRDRTGDTFRWLGENVSTAEVESIASKFVGLRDVVVYGVEVPGAEGKAGMMAIVDT-ENSLELDDLACQFKTALPSYARPRFVRVMKAVDLTGTFKFQKFKLKKEGFDIGHVKDPLYYLDIKTGSYLPLDSKKYQLILDEKLRL 642          
BLAST of slc27a-1 vs. Ensembl Nematostella
Match: EDO46794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP51])

HSP 1 Score: 96.2857 bits (238), Expect = 8.853e-21
Identity = 115/505 (22.77%), Postives = 217/505 (42.97%), Query Frame = 3
Query:  324 HTIPDIFEKTVQRKSSHIAFL--FEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDD--ISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDII-YNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRP----QIWVEFQTRFKIKQIGEFYGATESNANIINNV---NKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTE-GKAGMATIVESG 1799
            H+ P    K ++      A +       +T++ +     K  + L++ G+++ D +A+ + + P Y  ++ G++ +G +   IN     + + + + D  A  L+   +L    ++  D   + +  TF  ++DG                K L  +++ +   + P +  +  K  D +   ++SGTTGLPK   +TH   +  +   S    +   D+I    LP++H+ G  I +G  +I+G+ +    +F  + +     K+K T++  +  I  +L   P+  + N  +++    +G  P    QI         I  + + YG TE++  +  +     K GSVG    +LP +       ID +TG  L           PN+ GE+   +     M+   GY ++     K +       +    TGD+   D  G FY  DR+ +  ++KG  V  AE+EA++ +   + D  V G  VP  E G+   A +V SG
Sbjct:   18 HSFPRYVLKHMESYGEETAMVDSTSGRSYTYNKLTEMIKKCGSALIRQGLQTKDMVAVLLPNMPEYPIVFYGVTSVGGIVTTINPAYTTDEIIYQLKDSGAKYLVTVPQLAQKAKQAADQAGVKRIYTFG-YVDGC---------------KSLFDLLHEDDGGSYPVSVSVNWK-EDVVCLPYSSGTTGLPKGVMLTHYNLIHHAAMFSNDDVMSSEDLITLGLLPMFHSYGLSILMGVCLIKGASVICMTQFEPTHFLEAIQKFKITMLPVVPPIVLFLAKHPLVEKYNLMSIK-QVTSGAAPLGAEQINALMTRMPWITILRQGYGLTETSPAVTTSPLGKCKPGSVGV---LLPGLKAKV---IDLKTGALL----------PPNQDGEIC--VAGPTIMK---GYYNNPEATAKTI-----DCEGWLHTGDVGHYDNEGHFYVVDRIKELIKYKGFQVPPAELEALLLSHPKITDAAVIG--VPDDEAGELPKALVVTSG 476          
BLAST of slc27a-1 vs. Ensembl Nematostella
Match: EDO46392 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPW4])

HSP 1 Score: 87.4261 bits (215), Expect = 5.773e-18
Identity = 110/465 (23.66%), Postives = 200/465 (43.01%), Query Frame = 3
Query:  396 EQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFI-FTSGTTGLPKAAKVTHARFVMMS------YGVSQMLGIQESDIIYNPL-PLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRP---QIWVEFQTRFKIKQIGEFYGATESNANII--NNVNKVGSVGFGTRILPFVYPITLIK-IDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDA-ANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGV 1745
            + +TFS++     K  + L++ G + GDT+A+ + +   Y  +  G   +G     +N       +   + D +A+ +I   EL   + ++N   +K          S ++R  +   T     + D+I+N +    P    H+       + +I ++SGTTGLPK   +TH   +         + ++     + S II   + P++H  G  I +G  I  G  M   ++F   ++     KYK T +  +  +  +L   P   + +  +V+ + G G  P   ++   F +RF   +  + YG TE    +I   N+ K  SVG        V P + +K +D +TGVA                G+  G+I  K P+    GY+++  A    I H+ +        TGD+   D+   FY   R+ +  ++KG  V  AE+E ++ +  ++ D  V GV
Sbjct:   44 KSFTFSELCTLIRKCGSVLVRRGAQIGDTMAVILPNMIEYPVVCYGALSVGMRVTTLNPQYTVREMVPQLKDSQANYIITTPEL---IHQVNQAAAKC---------SCVRRVFVLADTPGHQTLYDQILNDDGSAFP---SHVPVNWKQDVAYILYSSGTTGLPKGVLLTHYNLISAVVILNNFWAMTSEQTTEASKIIQVLIVPMFHVFGLAIMLGINIAIGVTMVCIRQFDPVSFLEAIQKYKVTNISVVPPLLIFLAKHPSVLKYDLSSVK-SVGCGAAPLGEEMMDAFMSRFPNVESNQGYGLTEFCVALIGRKNLKKPASVG-------EVLPCSQVKVVDLKTGVA-------------QPAGKQ-GEICIKGPL-MMKGYLNNPEATANTIDHEGWLH------TGDIGYYDDQEHFYIVGRVKELIKYKGFQVPPAELEDLLQSHPDIADAAVIGV 464          
BLAST of slc27a-1 vs. Ensembl Nematostella
Match: EDO30960 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZA8])

HSP 1 Score: 84.7297 bits (208), Expect = 4.504e-17
Identity = 111/465 (23.87%), Postives = 187/465 (40.22%), Query Frame = 3
Query:  396 EQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTEL-HSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVM--MSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPE------ENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANII-----NNVNKVGSVGFGTRILPFVY-PITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGV 1745
            E +T++D+     K  + +L+ GV   D + L + S   Y     G   +G V +  N     + L + + D  A  +I  ++L H+A++       K     +F+     +           D + D    +  I  P  T              ++SGTTGL K    +H   +   +  G    +   +  +  + +PL+H  G +I +G     GS + + + F          KYK T    +  +  +L   P+  +      E+  +     G G+  +   E     KI + G  YG TE  A  I      N +K GSVG    +LP +   IT    D +TG AL           PN+ GE    I  + PM    GY+    N+ +   + F   +    TGD+   D+  +FY  DRL +  ++KG  V  AE+EA++ +  +++D  V G+
Sbjct:   86 ETFTYTDLITLTKKCGSAMLRAGVTPKDVVLLHLPSIMQYAVYLYGAQAMGGVVSTANPGYSADELAYQVTDCDAKYIITNSKLYHTAIEAAR----KANVEHVFVSEEFFK-----------DVLEDDGSALTGIYCPSDTTETA-------CLPYSSGTTGLSKGVMQSHFNLIANALCLGSKNFMQHDKQLVTLSLMPLFHAFGLVINIGMHFYLGSKVVLLQGFEPEQLLKTIEKYKVTDFPMVPPLALFLAKHPLVDKYDLSSLESMVSAAAPVGKGVL-RTMAERIPSLKIVRQG--YGLTECTAGAIITPVDPNKSKDGSVGV---LLPNLEGKIT----DLKTGEAL----------GPNQEGE----ICIRGPMVT-RGYL----NKPEQTANTF-TNEGWLHTGDIGYYDDDEYFYITDRLKELIKYKGHQVPPAELEALLVSHPHISDAAVIGI 498          
BLAST of slc27a-1 vs. Ensembl Nematostella
Match: EDO38127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDT0])

HSP 1 Score: 82.4185 bits (202), Expect = 2.187e-16
Identity = 115/466 (24.68%), Postives = 189/466 (40.56%), Query Frame = 3
Query:  396 EQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTEL-HSALQEINDDISK--FITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFV--MMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPE------ENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNAN-IINNVN----KVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGV 1745
            E +T++D+     K  + LL+ GVK  D   L + +   Y     G   IGAV    N     + L + + D  A  +I  ++L H+A++       +  F + + F D        L G+    D         E+I  P                 ++SGTTG+ K    +H  ++   +S G  + +   +  +  + LPL+H  G  + VG     GS + + + F          KYK      +  +  +L   P+  +      E+  +     G GI  +   E     KI + G  YG TE+ A  I+N ++    K GSVG    +LP +        D +TG AL           PN+ GE    I  + P+    GY+    N+ +   + F   D    TGD+   D   +FY  DRL +  ++KG  V  AE+EA++ +  ++ D  V G+
Sbjct:   44 ETYTYTDLITLIKKCGSALLQAGVKPKDVALLHLPNIMQYPVYLYGAQAIGAVVTTANPGYTVDELAYQLIDSSAKYIITDSKLYHTAIEAARKANVEHVFESVEFFKDLLKDDGSKLKGVYSPTDP-------TEAICMP-----------------YSSGTTGVSKGVLQSHYNYIGHALSLGSKEFMQWDKRLVTLSLLPLFHAFGLAVNVGMHFYLGSKVILLQGFEPEQLLKTIEKYKVNDFPMVPPLALFLAKHPLVDKYDLSSLESMISAAAPVGKGIL-RTMAERIPSLKIVRQG--YGLTEATAGAIVNPIDPTKCKDGSVGV---LLPNLEGKV---TDLDTGEAL----------GPNQEGE----ICLRGPIVTH-GYL----NKPEQTANTF-TSDGWLRTGDIGYYDTEDYFYITDRLKELIKYKGHQVPPAELEALLVSHPHIADAAVIGI 456          
BLAST of slc27a-1 vs. Ensembl Medaka
Match: slc27a4 (solute carrier family 27 member 4 [Source:NCBI gene;Acc:101158619])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 292/625 (46.72%), Postives = 408/625 (65.28%), Query Frame = 3
Query:  192 LSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFED--EQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            L  Y   GGW F+ I++ T+ RD      LL+VK  V   +R ++T+P IF +TVQR     A +FE   E+WTF  +D Y+N++AN LL+ G + GD +ALFME+R  YV +W+G++K+G   ALINFNLR E+L HCI    A  ++ G+EL  A+ E++  + K +  ++F  G    ++   G      + L+ +++      P   R   R   D L +I+TSGTTG+PKAA V H+R+  M+  V     +   D++Y+ LPLYH+AG ++GVGQ +I G  + IRKKFSAS +W DC+KY  T+VQYIGEICRYLL QP+R  E QH VR+A GNG+R  IW EF  RF I QI EFYGATE N ++ N  NK+G+ GF ++ILPF+YPI L+++D ET   +R  +G+CI CKP E G+LVG+I   DP+R+FDGY++++A  +KI H VF KGD A+L+GD+LI D+ G  YF+DR GDTFRWKGENVST EVE  +S  L++ D VVYGVE+P  EGKAGMA I +   ++ DL+     +++ LP YARP+F+R    ++ TGTFK +KT+L ++GF+P  + D L +LD     Y  LD  ++  I+ G  K 
Sbjct:   32 LIFYLGSGGWSFVDIIVKTLGRDLHAAYVLLRVKLNVRRHLREKNTVPKIFAETVQRHGDKTALIFEGTGERWTFRQLDEYSNRVANLLLERGFREGDVVALFMENRAQYVGLWLGMAKVGIEAALINFNLRLEALVHCIIISNAKAVVFGSELTDAVTEVHKSMGKAV--QMFCCGDWDPKRVPQG-----TECLEPLLDGAPSHLP---RRPQRCFTDRLFYIYTSGTTGMPKAAIVVHSRYYRMAALVYYGFRMTSEDVVYDCLPLYHSAGNIVGVGQCVIHGMTVVIRKKFSASRFWDDCVKYNCTIVQYIGEICRYLLNQPVRDAERQHRVRMALGNGLRQSIWEEFMNRFNIPQIAEFYGATECNCSLGNFGNKIGACGFNSQILPFIYPIRLVRVDEETMELIRGPDGVCIPCKPGEPGQLVGRIIQNDPLRRFDGYVNESATSKKIAHSVFKKGDSAYLSGDVLIMDKYGHMYFKDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEIPGAEGKAGMAAIADPSHSS-DLEKFVRDMEKVLPPYARPVFLRFLPEVNKTGTFKFQKTELRREGFDPTAVTDKLCFLDSSRGRYVQLDEELYRSILSGKHKL 645          
BLAST of slc27a-1 vs. Ensembl Medaka
Match: slc27a1a (long-chain fatty acid transport protein 1 [Source:NCBI gene;Acc:101165396])

HSP 1 Score: 586.645 bits (1511), Expect = 0.000e+0
Identity = 290/626 (46.33%), Postives = 407/626 (65.02%), Query Frame = 3
Query:  192 LSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFE--DEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDIS----KFITFKIFIDG-SLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            L  Y     WK+  I   T  RD  GL  L +VK  +W  +RN   IP IF + V++  +  A ++E   E WTF+ +D  +N +A++    G  SGD +ALF+ESRP  VA+W+G++K+G   ALINF+LR + L HCI    +  ++ G EL  AL E+N  IS    +F T ++  +  + +  +PL+ +  +A +      +  S   PP      + ++D L +I+TSGTTGLPKAA V H+R+  ++        ++  DIIY+ LPLYH+AG ++GVGQ +I G  + +++KFSAS +W DCIKY  TVVQYIGEICRYLL QP+RP E  H VRLA GNG+RP +W  F  RF ++QIGEFYGATE N +I N   KVG+ GF +RILPFVYPI L++++ E    LRD  GLC+ C+P E G LVG+I  KDP+R+FDGY +  A ++KI H+VF K D A+++GD+L+ DELG+ YFRDR GDTFRW+GENVST EVE +ISN L+  D  VYGV VP  EGKAGMA I ++ + ++D     + +++ LP YARP+F+R    +DTTGTFK++KT L ++GF+P L  D L+YL+ +   Y  +D  ++  I++G
Sbjct:   32 LGAYLGARSWKYFYIAAKTATRDINGLYVLCRVKLALWRYMRNGSNIPSIFTQVVKQHPNKPALIYEATGEVWTFTQLDETSNAVAHWARGQGWVSGDVVALFLESRPLQVALWLGLAKVGVEAALINFSLRCDPLLHCIGVSGSRAIVFGAELADALLEVNSAISQSMVRFCTGELSAEMLACLGAQPLDAVLATAPR------HSPSPCVPP------KGMNDRLFYIYTSGTTGLPKAAIVVHSRYYRIAAFGYYAFRMRTEDIIYDCLPLYHSAGNILGVGQCLIHGLTVVVKRKFSASRFWDDCIKYNCTVVQYIGEICRYLLSQPVRPSEKGHKVRLAIGNGLRPSVWEAFMERFGVRQIGEFYGATECNCSIANMDGKVGACGFNSRILPFVYPIRLVRVNEENMEPLRDSRGLCVPCRPGEPGLLVGRIDQKDPLRRFDGYANQDATKKKIAHNVFRKNDCAYMSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTEVEGIISNLLDQTDVAVYGVAVPGVEGKAGMAAIADASE-SLDCDKFLKNIQRALPSYARPVFLRTSPQVDTTGTFKIQKTRLQREGFDPRLTTDQLYYLNSRAGRYEPIDEELYNAIVEG 644          
BLAST of slc27a-1 vs. Ensembl Medaka
Match: ENSORLT00000018813.2 (long-chain fatty acid transport protein 1 [Source:NCBI gene;Acc:101162431])

HSP 1 Score: 551.206 bits (1419), Expect = 0.000e+0
Identity = 282/664 (42.47%), Postives = 407/664 (61.30%), Query Frame = 3
Query:  111 RWLTFTFPFSVLFMLSYYSLIVNF----LLSLSIYCAF-----------GGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFED--EQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTG-SADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            RW    F F  +  L   SL+V      LLSL  +C+            G WK + I + TI RD   L+ +++VK  + +  R RHT+P +F +T +   +  A ++E   E W+F ++    + +A++ L  G   GD +AL MESRP  VA+W+G++ +G   A IN NLR++ L HCI+  +A  ++ G E+  AL E++  +     F  FI G   Q + L  L   + D  LD++     +        + ++ +D L +I+TSGTTG+PKAA V H+R+  ++       G+Q  DI+YN LPLYH+AG ++GVGQ ++ G  + IR+KFSAS +W DC+KY  TV+QYIGEICRYLL QP+   E +H VRLA GNG+R  +W +F  RFKIK++GEFYGATE N ++IN   KVG+ GF +RILP  YP+ L+++  +    LRD  GLCI C P E G LVG+I+  DP+R+FDGY   AA  +KI ++VF KGD  +++GD+L+ DE G+ YF+DR GDTFRW+GENVST EVE V+S  L   D  VYGV VP  EG AGMA +  +G   +DL      ++Q LP YARP+F+R+  ++DTTGTFK++K  L K+G+ PN   D +++L+ +   Y  +   + + I +G
Sbjct:    2 RW----FVFLQIMNLCLRSLVVVVAAAGLLSLPWFCSLFTGLGVLVVWIGSWKNLHIALHTIRRDLSCLLVIVRVKLSIHSHHRRRHTVPSLFARTAKLHPNKPALIYETTGEVWSFRELQERCHAVAHWALAQGWAEGDVVALLMESRPLVVALWLGLAMVGVEAAFINHNLRRDPLLHCISTSRARAIVFGAEMTEALSEVSGSLQLCTAF--FISGEEKQTQKLCRLKAQNLDARLDQLPRHRPVYK------LKKEFNDRLFYIYTSGTTGMPKAAIVVHSRYFRIAAFGFHAFGLQHDDIVYNFLPLYHSAGTIMGVGQCLLFGLTVVIRRKFSASRFWDDCVKYNCTVIQYIGEICRYLLAQPVTSSETRHRVRLAVGNGLRASVWDKFVQRFKIKRVGEFYGATECNCSLINIDGKVGACGFSSRILPTFYPVRLVRVQEDQKELLRDSQGLCIPCLPGEPGMLVGRINPSDPLRRFDGYRDPAATNQKIAYNVFEKGDAVYVSGDVLVMDEYGYMYFKDRSGDTFRWRGENVSTTEVEGVLSGLLGHTDVAVYGVSVPGVEGSAGMAALAHTG-GRMDLDAFLSAVQQALPSYARPVFLRLMPSVDTTGTFKIQKMRLQKEGYKPNATSDRIYFLNSRAESYELVTEELCKAIDEG 652          
BLAST of slc27a-1 vs. Ensembl Medaka
Match: ENSORLT00000036528.1 (long-chain fatty acid transport protein 1 [Source:NCBI gene;Acc:101162431])

HSP 1 Score: 550.436 bits (1417), Expect = 0.000e+0
Identity = 274/636 (43.08%), Postives = 397/636 (62.42%), Query Frame = 3
Query:  183 LLSLSIYCAF-----------GGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFED--EQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTG-SADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKG 2048
            LLSL  +C+            G WK + I + TI RD   L+ +++VK  + +  R RHT+P +F +T +   +  A ++E   E W+F ++    + +A++ L  G   GD +AL MESRP  VA+W+G++ +G   A IN NLR++ L HCI+  +A  ++ G E+  AL E++  +     F  FI G   Q + L  L   + D  LD++     +        + ++ +D L +I+TSGTTG+PKAA V H+R+  ++       G+Q  DI+YN LPLYH+AG ++GVGQ ++ G  + IR+KFSAS +W DC+KY  TV+QYIGEICRYLL QP+   E +H VRLA GNG+R  +W +F  RFKIK++GEFYGATE N ++IN   KVG+ GF +RILP  YP+ L+++  +    LRD  GLCI C P E G LVG+I+  DP+R+FDGY   AA  +KI ++VF KGD  +++GD+L+ DE G+ YF+DR GDTFRW+GENVST EVE V+S  L   D  VYGV VP  EG AGMA +  +G   +DL      ++Q LP YARP+F+R+  ++DTTGTFK++K  L K+G+ PN   D +++L+ +   Y  +   + + I +G
Sbjct:   17 LLSLPWFCSLFTGLGVLVVWIGSWKNLHIALHTIRRDLSCLLVIVRVKLSIHSHHRRRHTVPSLFARTAKLHPNKPALIYETTGEVWSFRELQERCHAVAHWALAQGWAEGDVVALLMESRPLVVALWLGLAMVGVEAAFINHNLRRDPLLHCISTSRARAIVFGAEMTEALSEVSGSLQLCTAF--FISGEEKQTQKLCRLKAQNLDARLDQLPRHRPVYK------LKKEFNDRLFYIYTSGTTGMPKAAIVVHSRYFRIAAFGFHAFGLQHDDIVYNFLPLYHSAGTIMGVGQCLLFGLTVVIRRKFSASRFWDDCVKYNCTVIQYIGEICRYLLAQPVTSSETRHRVRLAVGNGLRASVWDKFVQRFKIKRVGEFYGATECNCSLINIDGKVGACGFSSRILPTFYPVRLVRVQEDQKELLRDSQGLCIPCLPGEPGMLVGRINPSDPLRRFDGYRDPAATNQKIAYNVFEKGDAVYVSGDVLVMDEYGYMYFKDRSGDTFRWRGENVSTTEVEGVLSGLLGHTDVAVYGVSVPGVEGSAGMAALAHTG-GRMDLDAFLSAVQQALPSYARPVFLRLMPSVDTTGTFKIQKMRLQKEGYKPNATSDRIYFLNSRAESYELVTEELCKAIDEG 643          
BLAST of slc27a-1 vs. Ensembl Medaka
Match: slc27a4 (solute carrier family 27 member 4 [Source:NCBI gene;Acc:101158619])

HSP 1 Score: 454.907 bits (1169), Expect = 9.909e-152
Identity = 215/430 (50.00%), Postives = 293/430 (68.14%), Query Frame = 3
Query:  771 LDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            L+ +++   I N       +    D L +I+TSGTTG+PKAA V H+R+  M+  V     +   D++Y+ LPLYH+AG ++GVGQ +I G  + IRKKFSAS +W DC+KY  T+VQYIGEICRYLL QP+R  E QH VR+A GNG+R  IW EF  RF I QI EFYGATE N ++ N  NK+G+ GF ++ILPF+YPI L+++D ET   +R  +G+CI CKP E G+LVG+I   DP+R+FDGY++++A  +KI H VF KGD A+L+GD+LI D+ G  YF+DR GDTFRWKGENVST EVE  +S  L++ D VVYGVE+P  EGKAGMA I +   ++ DL+     +++ LP YARP+F+R    ++ TGTFK +KT+L ++GF+P  + D L +LD     Y  LD  ++  I+ G  K 
Sbjct:  162 LEALVHCIIISNAKAVVFGSELTDDRLFYIYTSGTTGMPKAAIVVHSRYYRMAALVYYGFRMTSEDVVYDCLPLYHSAGNIVGVGQCVIHGMTVVIRKKFSASRFWDDCVKYNCTIVQYIGEICRYLLNQPVRDAERQHRVRMALGNGLRQSIWEEFMNRFNIPQIAEFYGATECNCSLGNFGNKIGACGFNSQILPFIYPIRLVRVDEETMELIRGPDGVCIPCKPGEPGQLVGRIIQNDPLRRFDGYVNESATSKKIAHSVFKKGDSAYLSGDVLIMDKYGHMYFKDRTGDTFRWKGENVSTTEVEGTLSRLLDMKDVVVYGVEIPGAEGKAGMAAIADPSHSS-DLEKFVRDMEKVLPPYARPVFLRFLPEVNKTGTFKFQKTELRREGFDPTAVTDKLCFLDSSRGRYVQLDEELYRSILSGKHKL 590          

HSP 2 Score: 148.288 bits (373), Expect = 3.619e-37
Identity = 70/154 (45.45%), Postives = 99/154 (64.29%), Query Frame = 3
Query:  192 LSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFED--EQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTEL 647
            L  Y   GGW F+ I++ T+ RD      LL+VK  V   +R ++T+P IF +TVQR     A +FE   E+WTF  +D Y+N++AN LL+ G + GD +ALFME+R  YV +W+G++K+G   ALINFNLR E+L HCI    A  ++ G+EL
Sbjct:   30 LIFYLGSGGWSFVDIIVKTLGRDLHAAYVLLRVKLNVRRHLREKNTVPKIFAETVQRHGDKTALIFEGTGERWTFRQLDEYSNRVANLLLERGFREGDVVALFMENRAQYVGLWLGMAKVGIEAALINFNLRLEALVHCIIISNAKAVVFGSEL 183          
BLAST of slc27a-1 vs. Planmine SMEST
Match: SMESG000064689.1 (SMESG000064689.1)

HSP 1 Score: 1328.15 bits (3436), Expect = 0.000e+0
Identity = 655/658 (99.54%), Postives = 657/658 (99.85%), Query Frame = 3
Query:   87 MENFIENYRWLTFTFPFSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            MENFIENYRWLTFTFPFSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNM RNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVP+TEGKAGMATIVESGQNAIDLKLLDEKLKQKLP+YARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF
Sbjct:    1 MENFIENYRWLTFTFPFSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMKRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPNTEGKAGMATIVESGQNAIDLKLLDEKLKQKLPLYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 658          
BLAST of slc27a-1 vs. Planmine SMEST
Match: SMESG000064689.1 (SMESG000064689.1)

HSP 1 Score: 1283.86 bits (3321), Expect = 0.000e+0
Identity = 634/637 (99.53%), Postives = 636/637 (99.84%), Query Frame = 3
Query:  150 MLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            MLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNM RNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVP+TEGKAGMATIVESGQNAIDLKLLDEKLKQKLP+YARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF
Sbjct:    1 MLSYYSLIVNFLLSLSIYCAFGGWKFMKILILTIPRDFRGLMSLLKVKFFVWNMKRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPNTEGKAGMATIVESGQNAIDLKLLDEKLKQKLPLYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 637          
BLAST of slc27a-1 vs. Planmine SMEST
Match: SMESG000064689.1 (SMESG000064689.1)

HSP 1 Score: 1229.93 bits (3181), Expect = 0.000e+0
Identity = 608/611 (99.51%), Postives = 610/611 (99.84%), Query Frame = 3
Query:  228 MKILILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPHTEGKAGMATIVESGQNAIXXXXXXXXXXXXXPVYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 2060
            MKILILTIPRDFRGLMSLLKVKFFVWNM RNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVP+TEGKAGMATIVESGQNAIDLKLLDEKLKQKLP+YARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF
Sbjct:    1 MKILILTIPRDFRGLMSLLKVKFFVWNMKRNRHTIPDIFEKTVQRKSSHIAFLFEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGATESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGVEVPNTEGKAGMATIVESGQNAIDLKLLDEKLKQKLPLYARPLFIRICRNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQIMKGLLKF 611          
BLAST of slc27a-1 vs. Planmine SMEST
Match: SMESG000041777.1 (SMESG000041777.1)

HSP 1 Score: 111.694 bits (278), Expect = 1.800e-25
Identity = 133/503 (26.44%), Postives = 215/503 (42.74%), Query Frame = 3
Query:  306 NMIRNRHTIPDIFEKTVQRKSSHIAFL--FEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFK-IFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVE--FQTRFKIKQIG----EFYGATESN--ANIINNVN---KVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLCIQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGV------EVP 1754
            N+   + TI +       + S++IAF+       +T+SDV    + IA+ L K GVK G    +   + P YV +   +S +G    + N N     + + ++D + S +    E    L ++ + IS+  T K I++ G      PL G   + DK++    NM    NP    ++    H  LM  ++SGTTGLPK   +TH   V     +++   I +   +   LPLYH    +I +      GS M  + KF  + Y     +YK +V+  +     +LL        N  ++   F         VE  F   F+  Q      + YG +E++   +I+ N+    K GSVG             L+  D E  +     N    +   NE GE++ K    + M+   GY   +A   K   D ++K      TGD+   D+  +FY  DR+ +  + KG  V+ AE+E V+ +   + DC V GV      EVP
Sbjct:   29 NISYKKETIAEHVFTFCDKYSNNIAFIDDVRKTSYTYSDVKGLVSSIASALTKRGVKQGTMAGIISTNSPEYVMLIYALSSMGCSVTICNQNFTSREIINQLSDSQPSIIFTNKE---CLSKVTNVISELSTVKNIYLIGD-----PLPGYE-TVDKLMADSGNM----NPIGQINLDLDSHIALM-PYSSGTTGLPKGVMLTHNNLVANFRQINKAHEISDVKKMLIALPLYHIYSQVIIISMGFFSGSQMVFQSKFEPTNYLRAIEQYKISVLHLVPPQILFLLNNHETKNFNLTSIEKCFSAAAPLDAVVENRFIETFREHQPNFDTFQGYGLSETSPLTHIMPNIKIPGKQGSVG-------------LLVSDMECKII---DNFSRKEVFANESGEILLK--GPNIMK---GYFGKSAETEKAFEDGWFK------TGDIGHYDDDHYFYISDRIKELIKVKGFQVAPAELEGVLLSIPGVVDCAVIGVPDERCGEVP 490          
BLAST of slc27a-1 vs. Planmine SMEST
Match: SMESG000041777.1 (SMESG000041777.1)

HSP 1 Score: 105.531 bits (262), Expect = 2.064e-23
Identity = 134/529 (25.33%), Postives = 219/529 (41.40%), Query Frame = 3
Query:  306 NMIRNRHTIPDIFEKTVQRKSSHIAFL--FEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGISKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISKFITFK-IFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRKVHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPLPLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGEICRYLLCQPIRPEENQHNVRLAFGNGIRP----------QIWVEFQTRFKIKQIGEF----YGATESNANIINNVNKVGSV--------GFG-TRILPFVYPITLIKIDPETGVALRDKNGLCI---QCK-----------PNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFLTGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVVYGV------EVP 1754
            N+   + TI +       + S++IAF+       +T+SDV    + IA+ L K GVK G    +   + P YV +   +S +G    + N N     + + ++D + S +    E    L ++ + IS+  T K I++ G      PL G   + DK++    NM    NP    ++    H  LM  ++SGTTGLPK   +TH   V     +++   I +   +   LPLYH    +I +      GS M  + KF  + Y     +YK +V+  +     +LL        N  ++   F +   P          + + E Q  F   Q  E     Y       +   +V K  ++        G+G +   P  + +  IKI  + G       GL +   +CK            NE GE++ K    + M+   GY   +A   K   D ++K      TGD+   D+  +FY  DR+ +  + KG  V+ AE+E V+ +   + DC V GV      EVP
Sbjct:   29 NISYKKETIAEHVFTFCDKYSNNIAFIDDVRKTSYTYSDVKGLVSSIASALTKRGVKQGTMAGIISTNSPEYVMLIYALSSMGCSVTICNQNFTSREIINQLSDSQPSIIFTNKE---CLSKVTNVISELSTVKNIYLIGD-----PLPGYE-TVDKLMADSGNM----NPIGQINLDLDSHIALM-PYSSGTTGLPKGVMLTHNNLVANFRQINKAHEISDVKKMLIALPLYHIYSQVIIISMGFFSGSQMVFQSKFEPTNYLRAIEQYKISVLHLVPPQILFLLNNHETKNFNLTSIEKCF-SAAAPLDAVVENRFIETFREHQPNFDTFQGCEVSIPTYNCDSKQYSSHLHVQKPKALSMVDHSWPGYGLSETSPLTHIMPNIKIPGKQGSV-----GLLVSDMECKIIDNFSRKEVFANESGEILLK--GPNIMK---GYFGKSAETEKAFEDGWFK------TGDIGHYDDDHYFYISDRIKELIKVKGFQVAPAELEGVLLSIPGVVDCAVIGVPDERCGEVP 526          
The following BLAST results are available for this feature:
BLAST of slc27a-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC27A10.000e+047.75solute carrier family 27 member 1 [Source:HGNC Sym... [more]
SLC27A40.000e+046.86solute carrier family 27 member 4 [Source:HGNC Sym... [more]
SLC27A15.499e-15953.16solute carrier family 27 member 1 [Source:HGNC Sym... [more]
SLC27A23.920e-13341.05solute carrier family 27 member 2 [Source:HGNC Sym... [more]
SLC27A61.335e-12537.37solute carrier family 27 member 6 [Source:HGNC Sym... [more]
back to top
BLAST of slc27a-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acs-221.773e-15941.82Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-222.494e-15941.82Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-201.177e-15240.68Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-225.225e-14744.28Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
acs-225.225e-14744.28Fatty Acid CoA Synthetase family [Source:UniProtK... [more]
back to top
BLAST of slc27a-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fatp20.000e+044.44gene:FBgn0265187 transcript:FBtr0339108[more]
Fatp20.000e+044.44gene:FBgn0265187 transcript:FBtr0339109[more]
Fatp20.000e+044.44gene:FBgn0265187 transcript:FBtr0339110[more]
Fatp10.000e+046.39gene:FBgn0267828 transcript:FBtr0347403[more]
Fatp10.000e+046.39gene:FBgn0267828 transcript:FBtr0347405[more]
back to top
BLAST of slc27a-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc27a1a0.000e+048.00solute carrier family 27 member 1a [Source:ZFIN;Ac... [more]
slc27a1a0.000e+047.15solute carrier family 27 member 1a [Source:ZFIN;Ac... [more]
slc27a1a0.000e+047.15solute carrier family 27 member 1a [Source:ZFIN;Ac... [more]
slc27a1b0.000e+047.50solute carrier family 27 member 1b [Source:ZFIN;Ac... [more]
slc27a40.000e+046.37solute carrier family 27 member 4 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc27a-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC27A40.000e+047.20solute carrier family 27 member 4 [Source:NCBI gen... [more]
SLC27A40.000e+047.20solute carrier family 27 member 4 [Source:NCBI gen... [more]
SLC27A40.000e+047.09solute carrier family 27 member 4 [Source:NCBI gen... [more]
SLC27A40.000e+047.09solute carrier family 27 member 4 [Source:NCBI gen... [more]
SLC27A40.000e+047.17solute carrier family 27 member 4 [Source:NCBI gen... [more]
back to top
BLAST of slc27a-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc27a40.000e+047.22solute carrier family 27 (fatty acid transporter),... [more]
Slc27a10.000e+046.62solute carrier family 27 (fatty acid transporter),... [more]
Slc27a10.000e+046.62solute carrier family 27 (fatty acid transporter),... [more]
Slc27a65.793e-13738.83solute carrier family 27 (fatty acid transporter),... [more]
Slc27a21.525e-13139.89solute carrier family 27 (fatty acid transporter),... [more]
back to top
BLAST of slc27a-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6PCB7|S27A1_HUMAN0.000e+047.75Long-chain fatty acid transport protein 1 OS=Homo ... [more]
sp|Q4R3Y4|S27A4_MACFA0.000e+047.99Long-chain fatty acid transport protein 4 OS=Macac... [more]
sp|Q3ZKN0|S27A1_BOVIN0.000e+047.12Long-chain fatty acid transport protein 1 OS=Bos t... [more]
sp|Q6P1M0|S27A4_HUMAN0.000e+046.86Long-chain fatty acid transport protein 4 OS=Homo ... [more]
sp|Q5RDY4|S27A4_PONAB0.000e+047.18Long-chain fatty acid transport protein 4 OS=Pongo... [more]
back to top
BLAST of slc27a-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF740.000e+0100.00Slc27a-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A1S3IQ220.000e+051.11long-chain fatty acid transport protein 4 OS=Lingu... [more]
K1PVG00.000e+050.70Long-chain fatty acid transport protein 4 OS=Crass... [more]
A0A0B6Z9V50.000e+049.85AMP-binding domain-containing protein OS=Arion vul... [more]
A0A433TUZ00.000e+050.16AMP-binding domain-containing protein (Fragment) O... [more]
back to top
BLAST of slc27a-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc27a1a0.000e+048.80solute carrier family 27 member 1 [Source:NCBI gen... [more]
slc27a1b0.000e+047.35solute carrier family 27 member 1b [Source:ZFIN;Ac... [more]
slc27a1b0.000e+047.35solute carrier family 27 member 1b [Source:ZFIN;Ac... [more]
slc27a40.000e+043.65solute carrier family 27 member 4 [Source:ZFIN;Acc... [more]
slc27a1a2.179e-15253.48solute carrier family 27 member 1 [Source:NCBI gen... [more]
back to top
BLAST of slc27a-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
SLC27A57.467e-12436.69solute carrier family 27 member 5 [Source:HGNC Sym... [more]
SLC27A54.178e-8642.24solute carrier family 27 member 5 [Source:HGNC Sym... [more]
ENSPMAT00000003024.11.767e-3233.86pep scaffold:Pmarinus_7.0:GL478098:51343:56450:1 g... [more]
ENSPMAT00000005192.16.294e-2930.40pep scaffold:Pmarinus_7.0:GL479731:2711:5574:-1 ge... [more]
back to top
BLAST of slc27a-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
FAT11.556e-8631.55Very long chain fatty acyl-CoA synthetase and fatt... [more]
ACS24.347e-2123.28Acetyl-coA synthetase isoform; along with Acs1p, a... [more]
ACS11.801e-1621.34Acetyl-coA synthetase isoform; along with Acs2p, a... [more]
PCS606.204e-1522.71Oxalyl-CoA synthetase; capable of catalyzing conve... [more]
back to top
BLAST of slc27a-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO434210.000e+044.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467948.853e-2122.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463925.773e-1823.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO309604.504e-1723.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO381272.187e-1624.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc27a-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc27a40.000e+046.72solute carrier family 27 member 4 [Source:NCBI gen... [more]
slc27a1a0.000e+046.33long-chain fatty acid transport protein 1 [Source:... [more]
ENSORLT00000018813.20.000e+042.47long-chain fatty acid transport protein 1 [Source:... [more]
ENSORLT00000036528.10.000e+043.08long-chain fatty acid transport protein 1 [Source:... [more]
slc27a49.909e-15250.00solute carrier family 27 member 4 [Source:NCBI gen... [more]
back to top
BLAST of slc27a-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064689.10.000e+099.54SMESG000064689.1[more]
SMESG000064689.10.000e+099.53SMESG000064689.1[more]
SMESG000064689.10.000e+099.51SMESG000064689.1[more]
SMESG000041777.11.800e-2526.44SMESG000041777.1[more]
SMESG000041777.12.064e-2325.33SMESG000041777.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014353
GenBankAKN21615.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014353 ID=SMED30014353|Name=slc27a-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2220bp
TTTGTATGACCTTTAGAGGTTATAATGTAAATTATAATTCAATTTTTATT
AAAAGTTTGTAAGCTTTATTCTTTTTGACACCAGAAATGGAAAATTTTAT
TGAAAATTATCGTTGGCTGACATTTACCTTTCCATTTTCTGTGCTTTTTA
TGTTATCTTATTATTCCCTGATTGTGAATTTTTTACTTTCTTTATCTATT
TACTGCGCATTTGGAGGTTGGAAATTTATGAAAATTTTGATATTGACAAT
ACCTAGAGATTTTCGCGGTTTGATGTCGTTGCTTAAAGTTAAATTCTTTG
TTTGGAATATGATAAGAAACAGACACACGATTCCTGATATTTTTGAGAAA
ACCGTACAAAGAAAGTCTTCTCATATTGCATTTTTATTCGAGGATGAACA
GTGGACATTTTCAGATGTCGACATGTATGCAAATAAAATTGCGAACTATT
TATTAAAACTAGGTGTGAAATCAGGTGATACAATTGCATTGTTTATGGAA
TCAAGACCAGCTTATGTTGCAATTTGGATGGGTATTAGTAAGATTGGAGC
AGTACCTGCTTTAATTAATTTTAATTTGAGAAAAGAAAGTTTAACTCATT
GTATAAATGATGTAAAAGCCAGTGGTTTGATTTGTGGAACTGAGCTTCAT
AGTGCTCTCCAGGAAATTAATGATGACATTTCAAAATTCATTACATTCAA
AATTTTTATTGACGGCTCTCTAATACAACGAAAACCCTTAAATGGGTTGA
CTGGCAGTGCGGATAAAATATTAGACAAAATTATTAATATGGAATCAATA
CAAAATCCTCCTACGACTAGGCATATTACTAGAAAGGTTCACGATCCTCT
TATGTTTATATTTACCAGTGGTACGACAGGACTACCGAAGGCAGCCAAGG
TCACTCATGCACGTTTTGTCATGATGTCATACGGCGTAAGTCAGATGTTG
GGAATTCAAGAATCTGACATCATATATAATCCTTTACCCCTTTATCACAC
TGCTGGTGGAATGATAGGCGTGGGCCAAGTAATAATTAGAGGATCAATTA
TGGCTATTCGAAAGAAATTCTCGGCAAGTGCATATTGGTCTGACTGCATA
AAATACAAAGCTACGGTTGTCCAATATATAGGTGAAATATGTAGATATTT
ACTGTGCCAACCAATCAGACCCGAAGAAAATCAGCACAACGTTAGATTAG
CATTTGGAAATGGTATACGGCCACAAATTTGGGTCGAATTTCAAACAAGA
TTCAAAATCAAACAAATTGGTGAATTTTACGGCGCTACTGAGTCCAATGC
TAATATTATTAATAATGTTAATAAGGTTGGATCTGTTGGTTTTGGTACCA
GAATATTACCTTTTGTATACCCAATAACACTTATTAAAATCGACCCAGAA
ACCGGGGTTGCTTTGCGCGATAAAAATGGTCTTTGCATACAGTGCAAACC
AAACGAAGTCGGAGAACTGGTAGGTAAAATCCACGATAAAGATCCAATGC
GGCAATTCGACGGGTATATTAGTGATGCCGCTAATCAACGAAAAATTGTC
CATGACGTTTTCTATAAAGGCGACCGAGCATTTCTTACAGGCGACTTGCT
AATTCAAGACGAATTGGGATTTTTTTATTTCCGCGATCGCCTGGGAGACA
CATTTCGATGGAAAGGTGAAAATGTGTCGACAGCAGAAGTCGAAGCAGTG
ATTAGCAATTGCTTAAATCTGAATGATTGTGTTGTTTATGGAGTTGAAGT
TCCACATACCGAAGGCAAAGCTGGAATGGCAACGATTGTGGAATCGGGAC
AAAATGCCATTGATTTGAAACTTTTAGATGAGAAATTGAAACAAAAACTT
CCTGTATACGCTCGACCGCTTTTTATTCGGATTTGCAGAAATATCGATAC
GACAGGTACTTTTAAATTGAAAAAAACTGATTTAATGAAAGATGGCTTCA
ATCCGAACTTGATTGATGATAACTTGTTTTACCTCGACCATAAAACATGC
CACTATGCATCATTAGACAGCGCAATTTTTGAACAAATCATGAAAGGGTT
ACTGAAATTTTGAGAGCAAATTGAATGTTTTGAAGTTATATTTCTCTTTG
GGTGGATTTTGCTATTTATATTTTGAAATTTTAGAATTTTGTAATAATTG
AATACTCATTGTCCGATGTGTCTGATTAGATTTGATGAATACATTGGATC
TTTTTCAACATCATTTTCAG
back to top

protein sequence of SMED30014353-orf-1

>SMED30014353-orf-1 ID=SMED30014353-orf-1|Name=SMED30014353-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=659bp
MENFIENYRWLTFTFPFSVLFMLSYYSLIVNFLLSLSIYCAFGGWKFMKI
LILTIPRDFRGLMSLLKVKFFVWNMIRNRHTIPDIFEKTVQRKSSHIAFL
FEDEQWTFSDVDMYANKIANYLLKLGVKSGDTIALFMESRPAYVAIWMGI
SKIGAVPALINFNLRKESLTHCINDVKASGLICGTELHSALQEINDDISK
FITFKIFIDGSLIQRKPLNGLTGSADKILDKIINMESIQNPPTTRHITRK
VHDPLMFIFTSGTTGLPKAAKVTHARFVMMSYGVSQMLGIQESDIIYNPL
PLYHTAGGMIGVGQVIIRGSIMAIRKKFSASAYWSDCIKYKATVVQYIGE
ICRYLLCQPIRPEENQHNVRLAFGNGIRPQIWVEFQTRFKIKQIGEFYGA
TESNANIINNVNKVGSVGFGTRILPFVYPITLIKIDPETGVALRDKNGLC
IQCKPNEVGELVGKIHDKDPMRQFDGYISDAANQRKIVHDVFYKGDRAFL
TGDLLIQDELGFFYFRDRLGDTFRWKGENVSTAEVEAVISNCLNLNDCVV
YGVEVPHTEGKAGMATIVESGQNAIDLKLLDEKLKQKLPVYARPLFIRIC
RNIDTTGTFKLKKTDLMKDGFNPNLIDDNLFYLDHKTCHYASLDSAIFEQ
IMKGLLKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001676long-chain fatty acid metabolic process
GO:0015908fatty acid transport
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0004467long-chain fatty acid-CoA ligase activity
GO:0015245fatty acid transporter activity
GO:0031957very long-chain fatty acid-CoA ligase activity
GO:0003824catalytic activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042099AMP-dep_Synthh-like_sf
IPR000873AMP-dep_Synth/Lig
IPR025110AMP-bd_C
IPR020845AMP-binding_CS
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025110AMP-binding enzyme, C-terminal domainPFAMPF13193AMP-binding_Ccoord: 534..610
e-value: 8.8E-6
score: 26.6
NoneNo IPR availableGENE3DG3DSA:3.30.300.30coord: 521..620
e-value: 2.2E-11
score: 46.3
NoneNo IPR availablePANTHERPTHR43107LONG-CHAIN FATTY ACID TRANSPORT PROTEINcoord: 38..655
NoneNo IPR availableCDDcd05939hsFATP4_likecoord: 103..623
e-value: 0.0
score: 708.037
NoneNo IPR availableSUPERFAMILYSSF56801Acetyl-CoA synthetase-likecoord: 68..620
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
IPR000873AMP-dependent synthetase/ligasePFAMPF00501AMP-bindingcoord: 86..525
e-value: 2.6E-67
score: 227.3
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 63..518
e-value: 4.0E-74
score: 251.8
IPR020845AMP-binding, conserved sitePROSITEPS00455AMP_BINDINGcoord: 257..268