plexin A

Overview
Nameplexin A (AJA72712.1)
Smed IDSMED30014347
Length (bp)6045
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of plexin A (SMED30014347) t-SNE clustered cells

Violin plots show distribution of expression levels for plexin A (SMED30014347) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of plexin A (SMED30014347) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for plexin A (SMED30014347) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014347

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014347h1SMcG0014154 Contig1414newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014347h1SMcG0014154 Contig1414uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014347h1SMcG0012484 Contig1414newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014347h1SMcG0012484 Contig1414uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30014347h1SMcG0014154 dd_Smed_v4_11934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014347h1SMcG0014154 dd_Smed_v4_11934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014347h1SMcG0014154 dd_Smed_v4_11934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014347h1SMcG0014154 dd_Smed_v4_11934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014347h1SMcG0014154 dd_Smed_v4_11934_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of plexin A vs. Ensembl Human
Match: PLXNA1 (plexin A1 [Source:HGNC Symbol;Acc:HGNC:9099])

HSP 1 Score: 259.225 bits (661), Expect = 1.257e-68
Identity = 325/1437 (22.62%), Postives = 605/1437 (42.10%), Query Frame = 2
Query: 1541 NMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSEN----DKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAE---NKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTA-IGSLS-ASNRLVC-----TFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGND-DSKWINSKF--QKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFK---TKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFV-NNSDIDCISPTTSNITQF------QKCSLLFAME--KGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTV-SGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQ--AAIQDEIHKNWN-----TAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNICVAMKNESL-----PASNTASVSHLESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            ++V++ N   +YA+ + ++ R  + +C   T+CE CL    P CGWC+ +  C  +D C  A   P +    +  C  + V P +           V   +S+ PL + + N       + C F      E         + +  + C  P  + + PI     ++  V L LK            +  YNC+  ++C  CVN  F C WC   + C + ++  C       N   DCP +  S + +   VG    I L  +N     + +  + CL     S A + +L   S+ L C     +++   V   + +  ++ V W  GN +   I+    I+  ++ C  L E C  C+     ++CG+C  + +C  +H C  D  + W++++    +C  P I+++ P        + + + G NLG    DV+  + +     +  C  +E  YIS++Q  C+I + +         +   +      + L  K F F +P  Y + P+ GP  GGT I + GS LN GS  +V  + G  P  C+        I C                  +P  A + +NI+   +   +V++ +  +P + +I     +++GG +  +TG NL  + +P +  +    +     C V N++ + C +P+ +N  +       +   L F M+  +  + + +TS   +  PVL      +S PT LL +     + +    N         + ++ + +G   CT ++     + C              +   L G++ +TV +G  +F  G + + + S++ +  I+ +     +L++VI+   +  K++ R     +  +++  + + +  R   E  +  A +Q +IH+  N       P   Y  Y +  LFP                                HP++  K+++V  N  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  +K  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+ LDCD ++QAK K+ +  YK  PYS           K    ++   +  +A I L++    T        L TL  Y + DG ++ +  K  S       ++ T S+S  ES    L+T  S + +    PM +  PD+     +  L  + H++  Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct:  489 DLVLSPNHQYLYAMTEKQVTRVPVESCVQYTSCELCLGSRDPHCGWCVLHSICSRRDACERADE-PQRFAADLLQCVQLTVQPRN-----------VSVTMSQVPLVLQAWNVPDLSAGVNCSFEDFTESE-------SVLEDGRIHCRSPSAREVAPITRGQGDQRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHVC-THNVADCAFLEGRVNVSEDCPQILPSTQ-IYVPVGVVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNSSYSYEGNDV---SDLPVNLSVVWN-GNFV---IDNPQNIQAHLYKCPALRESCGLCLKADPRFECGWCVAERRCSLRHHCAADTPASWMHARHGSSRCTDPKILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGVRVG----KVLCSPVESEYISAEQIVCEIGDASSVRAHDALVEVCVRDCSPHYRALSPKRFTFVTPTFYRVSPSRGPLSGGTWIGIEGSHLNAGS--DVAVSVGGRP--CSFSWRNSREIRCLTPP------------GQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGG-IERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVL----EPLS-PTGLLELKPSSPLILKGR-NLLPPAPGNSRLNYTVLIGSTPCT-LTVSETQLLC--------------EAPNLTGQHKVTVRAGGFEFSPGTLQVYSDSLLTLPAIVGIGGGGGLLLLVIVAVLIAYKRKSRDADRTL--KRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAMRVLFPGIE----------------------------DHPVL--KEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPENENAPEVPVKGLDCDTVTQAKEKLLDAAYKGVPYSQRP--------KAADMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSLSRYES---MLRTASSPDSLRSRTPMIT--PDLESGTKLWHLVKN-HDHLDQREGDRGS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQIHDADVRHTWKSNCLPLRFWVNVIKNPQFVFDI--HKNSITDACLSVVAQTFMDSCSTSEHK 1790          
BLAST of plexin A vs. Ensembl Human
Match: PLXNA2 (plexin A2 [Source:HGNC Symbol;Acc:HGNC:9100])

HSP 1 Score: 199.134 bits (505), Expect = 3.207e-50
Identity = 220/1063 (20.70%), Postives = 429/1063 (40.36%), Query Frame = 2
Query:  413 FADSYLVVCYDVFQGFCEII---DLYNQFSSSYKNKAY-SIVTNDRKFHSTVLY---HDQRLFFANEVYHPSNYREIDFNTMSILSFPN--MTYFKPDYPFQANF-GKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKH-----EPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEI-MELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYEL---------FEDTNYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSH--LVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNS----TAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWIN--SKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQN-INDRIETPVAF-----QFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPT 3481
            ++++ L+ C  ++QG C+++   DL+     S+K + Y S V      +  ++     D +LF    V    +Y    F T+S    P    +    DY   ++F   L+    +T+  +     F+IY      F    ++FL  QPE           +  +  R+VR+C  D  + S++ +   C       Y  + +  +A   D +A  +        I ++ D     +LF  F        Y    +    CA+PI  I +++ + +++ C  G G++  N       D +C +              NF    I    G ++ +    +        + +   +Y  +++  +G   G L K            +E  + L     +  +++F++    ++  +Y +++ ++ R  + +C   T C +CL    P CGWC  +  C  +D+C  A W P +   ++  C  + V PS   +  S  S  +   VS  P     +    + C F +     +  V+    +    + CI P  K++P I  ++++  L+L++   ++    V   +  YNC+  + C  CVN+ F C WC   N C       C       N   DCP L V  E +   VG    I L  +N     + +  + C+     +     A+   S+S +   +      +  +++     V W  GN +   I+    ++  ++ C    E C  C+   + ++CG+C+ + +C     C +  S W++  S   KC  P I EI+  +      + + + G NLG   +++ + + +        C  +   YI ++Q  C++ + +      PV       + +F TK      +++ F +P V S+ P  GP  GGT++ + G +L  GS   V     T    C       + I C           +    S+      + +++D   +  +++QFE+  +P V++I     +++G     ITG NL+ + +P +  +     S+     VN + + C++P+
Sbjct:  121 YSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKTGTMYGVIVRSEGEDGKLFIGTAVDGKQDY----FPTLSSRKLPRDPESSAMLDYELHSDFVSSLIKIPSDTLALVSHFDIFYIYGFASGGF----VYFLTVQPETPEGVAINSAGDLFYTSRIVRLCKDDPKFHSYVSLPFGC-TRAGVEYRLLQAAYLAKPGDSLAQAFN-------ITSQDD-----VLFAIFS--KGQKQYHHPPDDSALCAFPIRAINLQIKERLQS-CYQGEGNLELN--WLLGKDVQCTKAPVPID-------DNFCGLDINQPLGGSTPVEGLTLYTTSRDRMTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPILRDMAFSI----DQRYLYVMSERQVTRVPVESCEQYTTCGECLSSGDPHCGWCALHNMCSRRDKCQQA-WEPNRFAASISQCVSLAVHPSS--ISVSEHSRLLSLVVSDAP-----DLSAGIACAFGN-----LTEVEGQ--VSGSQVICISPGPKDVPVIPLDQDWFGLELQLRSKETGKIFVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPT-TCSFQEGRINISEDCPQL-VPTEEILIPVGEVKPITLKARNLPQPQSGQRGYECVLNIQGAIHRVPALRFNSSSVQCQNSSYQYDGMDISNLAVDFAVVWN-GNFI---IDNPQDLKVHLYKCAAQRESCGLCLKADRKFECGWCSGERRCTLHQHCTSPSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAG----VPCTPLPGEYIIAEQIVCEMGHALVGTTSGPVRLCIGECKPEFMTKSH----QQYTFVNPSVLSLNPIRGPESGGTMVTITGHYLGAGSSVAVYLGNQT----CEFYGRSMSEIVC-----------VSPPSSNGLGPVPVSVSVDRAHVD-SNLQFEYIDDPRVQRIEPEWSIASGHTPLTITGFNLDVIQEPRIRVKFNGKESVNVCKVVNTTTLTCLAPS 1101          

HSP 2 Score: 110.923 bits (276), Expect = 2.049e-23
Identity = 131/512 (25.59%), Postives = 231/512 (45.12%), Query Frame = 2
Query: 4277 HPLIVNKQIQVIENTVEYSRKLSKLFE----DELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMF--RQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALK-EVVGYTLKTLKDYDIKDGDNICVAMKNES---LPASNTASVSHLESNSASLK-TNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSK------IKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQN--------------KDV-----WLTQLFSDVIKL 5686
            HP++  ++++V  N  ++  K  KLF     +++F+L F   LE  +    + + ++ S +   L   L   T +LK L+ +  DK   N+    +   R   +  K+L+NWF  L++  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++IE+K L L   +   EN  E+ V+VL+CD I+Q K KI + +YK  PYS         L +  Q  +         I  K E     L TL  Y + D   + +  K  S   +PAS + S + +    +S + T    ++    PM +  PD+   + +  L  + H++  QK        +   Y T++ A K               L+  ++   + LF  +    ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K +    CL  V++  MD CS +++              KD+     W+ + ++D+ KL
Sbjct: 1332 HPVL--RELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDL-EWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTSISRYDSSFRYTGSPDSLRSRAPMIT--PDLESGVKVWHLVKN-HDHGDQKEGDRGSKMVSEIYLTRLLATKG-------------TLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADRHSIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDI--HKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYADIAKL 1821          
BLAST of plexin A vs. Ensembl Human
Match: PLXNB2 (plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104])

HSP 1 Score: 163.31 bits (412), Expect = 2.320e-39
Identity = 178/897 (19.84%), Postives = 351/897 (39.13%), Query Frame = 2
Query:  800 YIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNC-DIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVT-CAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFED---TNYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTA----MWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRT------CAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIET--------------ETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSK---EFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNK 3391
            Y+FF+ NQ ++KH  +N   +  L R+C  D +Y S++++ + C D D     +   + + A+V+   +                     ++L+  F     + + R +       C +P+ ++    +  RN C  G+    +  Y     D +C      S+    CG ++   + +G   G   + G  V+ R G+   + +  +     T+A +G +DG + K  L  D   + Y      +   +  ++V++ +   +YA+   K+ R  ++ C +   C  C     P+CGWC+  G+C  K +C  A     WL + R+   K+C  +      ++   +        Q++ +PL  LSE D+ L C F   +    A V+    I      C  P    + P  ++   V ++L +   +  L    Y  Y+C  + +      C  CV+N++ C W +  + C  +S    +      + +  CP          F    P+ I +  +   N+     D V      +S  +GS            ++K ++  +++ S   ++    L   + ET              ++ +   +++C      C  C      Y+C +C  + +CV + +C             +CP P I  I P    L     I + G NLG    D++       N     C +  + Y  S +  C I+      ETP     +     K   S    +F F  P+  S+EP  GP  GGT + ++G+ L+ GS+ +V+                 N + C++  F  + + +   +++   +  L+++   + +    + F +  NP ++     +  ++GG+   +TG   + + +
Sbjct:  227 YVFFVFNQ-QDKHPARN---RTLLARMCREDPNYYSYLEMDLQCRDPDIHAAAF--GTCLAASVAAPGSG--------------------RVLYAVF-----SRDSRSSGGPGAGLCLFPLDKVHAKMEANRNACYTGTREARDIFYKPFHGDIQCGGHAPGSSKSFPCGSEHL-PYPLGSRDG---LRGTAVLQRGGLN-LTAVTVAAENNHTVAFLGTSDGRILKVYLTPDGTSSEYDSILVEINKRVKRDLVLSGDLGSLYAMTQDKVFRLPVQECLSYPTCTQCRDSQDPYCGWCVVEGRCTRKAECPRAEEASHWL-WSRS---KSCVAVTSAQPQNMSRRAQGE----VQLTVSPLPALSEEDELL-CLF-GESPPHPARVEGEAVI------CNSPSSIPVTPPGQDHVAVTIQLLLRRGNIFLTSYQYPFYDCRQAMSLEENLPCISCVSNRWTCQWDLRYHECREASPNP-EDGIVRAHMEDSCP---------QFLGPSPLVIPMNHETDVNFQGKNLDTV----KGSSLHVGS-----------DLLKFMEPVTMQESGTFAFRTPKLSHDANETLPLHLYVKSYGKNIDSKLHVTLYNCSFGRSDCSLCRAANPDYRCAWCGGQSRCVYEALCNTTS---------ECPPPVITRIQPETGPLGGGIRITILGSNLGVQAGDIQRISVAGRN-----CSFQPERYSVSTRIVCVIEA----AETPFTGGVEVDVFGKLGRSPPNVQFTFQQPKPLSVEPQQGPQAGGTTLTIHGTHLDTGSQEDVRVTL--------------NGVPCKVTKFGAQLQCVTGPQATR-GQMLLEVSYGGSPVPNPGIFFTYRENPVLRAFEPLRSFASGGRSINVTGQGFSLIQR 1013          

HSP 2 Score: 112.464 bits (280), Expect = 8.158e-24
Identity = 132/538 (24.54%), Postives = 248/538 (46.10%), Query Frame = 2
Query: 4337 KLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMFRQSD-LLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIAL---KEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMT--SFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDY-----ESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNKDVWLTQ-------LFSDVIKLYSPKVLNYYEGIK---GTGSFNYNEYYGS---SRIDGINISLAIVILYQNYINSVHKELVEVIQ 5860
            + S L   + F++ F   LE+ +E  ++ K    S L++ L   L  YT I+  L     ++  + +  + M R+S+ ++ ++LSNW  I +Y +L++ +AG  L  L+  I + +  GPV+    K++Y LN+  LL   +E+  L + V  +    D+ + V+VL+CD ISQ K KI +++Y+  P S W   +S  L    +     + ++L+ + L   +E     + TL  Y+++DG  + ++             VS    +S            +D+P    + L + ++   + R +D + E  S++  +K   K +  A  +         IY   L S ++G ++   D+ F        +VP  V   F   +        +D+  +   K+NSL LRFW+ ++ N  F+FDV +  H  V   L  +++  MD C+  ++K   L++       L++  I  Y   V +YY+GI+        + N +      +  D +N  +A+  LYQ Y    + E++  ++
Sbjct: 1318 QFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMHTLFLELLEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKD-SAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDA-IPVKVLNCDTISQVKEKIIDQVYRGQPCSCWPRPDSVVL----EWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILS----------KVGVSQQPEDS-----------QQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVK--EKERTKAITE---------IYLTRLLS-VKGTLQQFVDNFFQSVLAPGHAVPPAVKYFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHV--HEVVDASLSVIAQTFMDACTRTEHK---LSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQ-YTQKYYDEIINALE 1810          
BLAST of plexin A vs. Ensembl Human
Match: PLXNB2 (plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104])

HSP 1 Score: 163.31 bits (412), Expect = 2.320e-39
Identity = 178/897 (19.84%), Postives = 351/897 (39.13%), Query Frame = 2
Query:  800 YIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNC-DIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVT-CAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFED---TNYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTA----MWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRT------CAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIET--------------ETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSK---EFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNK 3391
            Y+FF+ NQ ++KH  +N   +  L R+C  D +Y S++++ + C D D     +   + + A+V+   +                     ++L+  F     + + R +       C +P+ ++    +  RN C  G+    +  Y     D +C      S+    CG ++   + +G   G   + G  V+ R G+   + +  +     T+A +G +DG + K  L  D   + Y      +   +  ++V++ +   +YA+   K+ R  ++ C +   C  C     P+CGWC+  G+C  K +C  A     WL + R+   K+C  +      ++   +        Q++ +PL  LSE D+ L C F   +    A V+    I      C  P    + P  ++   V ++L +   +  L    Y  Y+C  + +      C  CV+N++ C W +  + C  +S    +      + +  CP          F    P+ I +  +   N+     D V      +S  +GS            ++K ++  +++ S   ++    L   + ET              ++ +   +++C      C  C      Y+C +C  + +CV + +C             +CP P I  I P    L     I + G NLG    D++       N     C +  + Y  S +  C I+      ETP     +     K   S    +F F  P+  S+EP  GP  GGT + ++G+ L+ GS+ +V+                 N + C++  F  + + +   +++   +  L+++   + +    + F +  NP ++     +  ++GG+   +TG   + + +
Sbjct:  227 YVFFVFNQ-QDKHPARN---RTLLARMCREDPNYYSYLEMDLQCRDPDIHAAAF--GTCLAASVAAPGSG--------------------RVLYAVF-----SRDSRSSGGPGAGLCLFPLDKVHAKMEANRNACYTGTREARDIFYKPFHGDIQCGGHAPGSSKSFPCGSEHL-PYPLGSRDG---LRGTAVLQRGGLN-LTAVTVAAENNHTVAFLGTSDGRILKVYLTPDGTSSEYDSILVEINKRVKRDLVLSGDLGSLYAMTQDKVFRLPVQECLSYPTCTQCRDSQDPYCGWCVVEGRCTRKAECPRAEEASHWL-WSRS---KSCVAVTSAQPQNMSRRAQGE----VQLTVSPLPALSEEDELL-CLF-GESPPHPARVEGEAVI------CNSPSSIPVTPPGQDHVAVTIQLLLRRGNIFLTSYQYPFYDCRQAMSLEENLPCISCVSNRWTCQWDLRYHECREASPNP-EDGIVRAHMEDSCP---------QFLGPSPLVIPMNHETDVNFQGKNLDTV----KGSSLHVGS-----------DLLKFMEPVTMQESGTFAFRTPKLSHDANETLPLHLYVKSYGKNIDSKLHVTLYNCSFGRSDCSLCRAANPDYRCAWCGGQSRCVYEALCNTTS---------ECPPPVITRIQPETGPLGGGIRITILGSNLGVQAGDIQRISVAGRN-----CSFQPERYSVSTRIVCVIEA----AETPFTGGVEVDVFGKLGRSPPNVQFTFQQPKPLSVEPQQGPQAGGTTLTIHGTHLDTGSQEDVRVTL--------------NGVPCKVTKFGAQLQCVTGPQATR-GQMLLEVSYGGSPVPNPGIFFTYRENPVLRAFEPLRSFASGGRSINVTGQGFSLIQR 1013          

HSP 2 Score: 112.464 bits (280), Expect = 8.158e-24
Identity = 132/538 (24.54%), Postives = 248/538 (46.10%), Query Frame = 2
Query: 4337 KLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMFRQSD-LLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIAL---KEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMT--SFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDY-----ESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNKDVWLTQ-------LFSDVIKLYSPKVLNYYEGIK---GTGSFNYNEYYGS---SRIDGINISLAIVILYQNYINSVHKELVEVIQ 5860
            + S L   + F++ F   LE+ +E  ++ K    S L++ L   L  YT I+  L     ++  + +  + M R+S+ ++ ++LSNW  I +Y +L++ +AG  L  L+  I + +  GPV+    K++Y LN+  LL   +E+  L + V  +    D+ + V+VL+CD ISQ K KI +++Y+  P S W   +S  L    +     + ++L+ + L   +E     + TL  Y+++DG  + ++             VS    +S            +D+P    + L + ++   + R +D + E  S++  +K   K +  A  +         IY   L S ++G ++   D+ F        +VP  V   F   +        +D+  +   K+NSL LRFW+ ++ N  F+FDV +  H  V   L  +++  MD C+  ++K   L++       L++  I  Y   V +YY+GI+        + N +      +  D +N  +A+  LYQ Y    + E++  ++
Sbjct: 1318 QFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMHTLFLELLEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKD-SAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDA-IPVKVLNCDTISQVKEKIIDQVYRGQPCSCWPRPDSVVL----EWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILS----------KVGVSQQPEDS-----------QQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVK--EKERTKAITE---------IYLTRLLS-VKGTLQQFVDNFFQSVLAPGHAVPPAVKYFFDFLDEQAEKHNIQDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHV--HEVVDASLSVIAQTFMDACTRTEHK---LSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQ-YTQKYYDEIINALE 1810          
BLAST of plexin A vs. Ensembl Human
Match: PLXNA4 (plexin A4 [Source:HGNC Symbol;Acc:HGNC:9102])

HSP 1 Score: 162.54 bits (410), Expect = 4.810e-39
Identity = 244/1171 (20.84%), Postives = 455/1171 (38.86%), Query Frame = 2
Query:  158 ENLDKIMLHNNKSHKSILVSGKNYILQFSENNLKEPLAIRKTGPVNHSVMCTEPNQCQTSLCPKELISRDQCRIKLTDVFVKLWTFADSYLVVCYDVFQGFCEII---DLYNQFSSSYKNKAYSIVTNDRK--FHSTVLYH--DQRLFFANEVYHPSNYREIDFNTMSILSFPNMTYFKPDYPFQANFGKLVYQGGETIFPLEFVGSFHIYDSRK-------DAFF------KNYIFFLVNQPENKHEP----KNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDN-QWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNL---CLVGSGSVNENPYNFK----STDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDTNYLFSTENL----FNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPI-AENKN--FVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQ----PDCPT-LEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNS----TAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQV--FDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKW--INSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDR-----IETPVAF-QFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFR--CETFLSIYENCFVNNSDIDCISPTTS 3487
            E  + +++     H  I +   N I + S ++LK  L   +TGP   +  C  P   QT  C + L + +     L      L  + ++ L+ C  ++QG C+++   DL+      +K + Y    N+    F   V Y   D +LF A  V     Y            FP ++  K     +A+ G   Y     +F  EFV S     S         D ++       N+++FL  QPE    P    K  ++  +LVR+C  D  + S++++ + C+    ++   Q      A +S   A   R       +    D D   +LF  F     +   +    S    A  I  + ++ D ++     C  G G+++      K    S+    ++D F       CG        + D      + G  V + +  +  S+I + +Y+  +LA +G   G L K  +          E +       +  +M  +++   +Y +++ ++ R  + +C    +C +CL    P CGWC+ +  C  K++C  +   P +    +K C  + V P++  +  S  +  ++ +    P     E    + C F      +++ +     +  + + C  P  K +P I  EN +   V L+LK            +  YNC+   +C  CV + + C WC   + C         K    Q  +     DCP  L V    +   V  PI+  L  KN     + +  + C+     S     A+   S+S +   T    + ++  ++   + V W       G    + P + +V  + C  + E C  C+     + CG+C    +C  +  C   +S+W  ++    KC  P I EIIP        + + ++G NLG    D+ + + +        C  +   YI ++Q  C++           +E  VA  + +F  +   L    + F +  +  ++P+ GP  GGT + + G+ LN GS   V F  G  P  C       +YI C        D+++  K S    +A +            D+ F++  +P + +I     + +G     + G +L+ +  P +  +   +  ++I E   +N +++ C +P  +
Sbjct:   49 EGFNHLVVDERTGH--IYLGAVNRIYKLS-SDLKV-LVTHETGPDEDNPKCYPPRIVQT--CNEPLTTTNNVNKML------LIDYKENRLIACGSLYQGICKLLRLEDLFKLGEPYHKKEHYLSGVNESGSVFGVIVSYSNLDDKLFIATAVDGKPEY------------FPTISSRKLTKNSEAD-GMFAY-----VFHDEFVASMIKIPSDTFTIIPDFDIYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGCERSGVEYRLLQA-----AYLSKAGAVLGRT------LGVHPDDD---LLFTVF-----SKGQKRKMKSLDESALCIFILKQINDRIKERLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNF-------CGLDMNAPLGVSDM-----VRGIPVFTEDRDRMTSVIAY-VYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPGPVLRDMAFSKDHEQLYIMSERQLTRVPVESCGQYQSCGECLGSGDPHCGWCVLHNTCTRKERCERSKE-PRRFASEMKQCVRLTVHPNN--ISVSQYNVLLVLETYNVP-----ELSAGVNCTF-----EDLSEMDG--LVVGNQIQCYSPAAKEVPRIITENGDHHVVQLQLKSKETGMTFASTSFVFYNCSVHNSCLSCVESPYRCHWCKYRHVCTHDP-----KTCSFQEGRVKLPEDCPQLLRVDKILVPVEVIKPIT--LKAKNLPQPQSGQRGYECILNIQGSEQRVPALRFNSSSVQCQNTSYSYEGMEINNLPVELTVVW------NGHFNIDNPAQNKVHLYKCGAMRESCGLCLKADPDFACGWCQGPGQCTLRQHCPAQESQWLELSGAKSKCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVE----CSPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQL----YYFMTLTLSDLKPSRGPMSGGTQVTITGTNLNAGSNVVVMF--GKQP--CLFHRRSPSYIVCNTTS---SDEVLEMKVSVQVDRAKIH----------QDLVFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGKEHINICE--VLNATEMTCQAPALA 1102          

HSP 2 Score: 110.538 bits (275), Expect = 2.918e-23
Identity = 132/524 (25.19%), Postives = 235/524 (44.85%), Query Frame = 2
Query: 4277 HPLIVNKQIQVI-ENTVEYSRKL-SKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSN----------WSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSR------NISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQN--------------KDV-----WLTQLFSDVIKL 5686
            HP++ + ++    +  VE   KL ++L  +++F+L F   LE  +    + + ++ S +  +L   L   T +LK L+ +  DK  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L  L+  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L        N  E+ V++L+CD I+Q K KI + I+K  P S+          W       +I  ++D   + E               L TL  Y + DG    VA+ ++ + A N  + S +   SAS   N  R      ++    PM +  PD+   + +  L  + HE+  QK   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++              KD+     W+ + +SD+ K+
Sbjct: 1332 HPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSMRDRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLVLSCVSPDNANSPEVPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSGARMILQDEDITTKIENDWK----------RLNTLAHYQVPDGS--VVALVSKQVTAYNAVNNSTVSRTSASKYENMIRYTGSPDSLRSRTPMIT--PDLESGVKMWHLVKN-HEHGDQKEGDRGS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKSNCLPLRFWVNMIKNPQFVFDIH--KNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKNWVERYYSDIGKM 1821          
BLAST of plexin A vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 292.738 bits (748), Expect = 1.880e-79
Identity = 413/1791 (23.06%), Postives = 723/1791 (40.37%), Query Frame = 2
Query:  725 ETIFPLEFVGSFHIYDSRKDAFFK------------NYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYR--ETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTS-TGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDTNYL--FSTENLFNN--ISFNMVVNENKSVIYAVADSKIIRHNLRNCYN-GTNCEDCLRV-SPFCGWCISNGKCVVKDQC------TTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGI--YHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSL--GKCKKNF----------EIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNST--AIGSLSASNRLVCTFQMMK-----VLQKASIKCSMKVSWILGNLLTGS------IETETPIEFQVFDCLKLSEHCDDCVHL-PQIYKCGFCTVKDKCVQKHICGNDD--SKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKC-----KIQNINDRIETPVAFQFKFKTKDKYLVSKE-FKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFT-DVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIY-ENCFVNNSD-IDCISPTTSNITQ---FQKCSLLFAMEKGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIK--QKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXX-----XXXXKKVQSKQR-LRHEKENIFT--EKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQV--IENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESKKSDIVSFLSLILMKDLPNY-TRILKILIKNDYDK---KKLNEEERSMFRQSDLLS-KLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDS--ELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSS-------FESYCLIKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPA---------------CLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNKDVWLTQ-------LFSDVIKLYSPKVLNYYEGIKGT 5731
            E +FP  + G+    D R   ++K            +Y +F+  Q  N  +  +   Q RLVR+C+ D ++ S+ ++ + C      T   V   +V +V    A +   K+    +    D   + + +   K     N+YR  E       C + + EI   +      C  G+  + +N   F S D  C    FT+   +G   GK+ N  I GD     S      +  +     + I  +     T+A +G   G L+K  L E       ++TE L +N  I  +M    +   +Y +  SK+I+     C    T C+ CL    P+CGWC+SN  C  ++ C      T+  WL FQ ++    CP I  +    I   +     V  +  + P        + ++C F  +    + +    +   + SL C  P    +P I  N+  +  KL V+ + S L      +  Y+C    +C+ C  ++F C WC+  N C++  L   KC+K             I+     CP +      +S   G   +I +  +N    F    DF C       T   I   ++ + + C   + +     +L   S      V W       G       ++    +   V+ C  L+ +C  C+ L    Y CG+C++  KC + H C N      W+N+  Q CP P I +  P   ++   + + + G NLG + +DV+ A+ + N      C+ +E  Y+ S++  C      I+  N+R    VA   +  +   +  S E F +  P V S++P  GP  GGT + + G  L+ G+   V+F      I C ILE    ++ CR+              S    +  L +  D         + FEF  +P V+ IS NK + +GG    + G     L +P + F        Y   C + +   + C +PT          Q+    +A +     +Y + I +  +P        +S P    R ++  +  +T+N    + ++++A  + D  + VG   C   +     + C      Q  +        L  + V+TV G   F  G++S D+  +   +  +++   I ++ +     V+  +K  + QR +++ K  + T   K+  E  E        LNQ     ++     TAP  +Y  Y    LFPN                               H ++ N ++     E      R+  KL  ++ F+L     +E ++    K    V  L ++++++   Y T +LK L++   +K   KK   + + +FR+S+ ++ ++L+ WF  L++DHL+  +AG  L  L+  I   +  GP +  T +++Y+L+E  LL    E+K+L + V        S  ++ V VLDCD I+Q K K  +  Y+   +++  +       +++    K+   ++  S R+      +      L TL  Y++ +   + +  K+ SL   N  + S     +AS+ +++S   S  +             P   ++D  H +SS  +          + FK  H +KP                 L    ++K  +   I +L + IF   +VP C+  +F   +   +     D  +V A KSN+L LRFW+ LI N  FLFD+   K T +  CL  V++ LMD CS    +D  LT+       LF+  +  Y   V +YY  I  T
Sbjct:   15 EVVFPGLYGGTHVSLDYRSRGYYKYQIDYINGFESGDYAYFVTRQRVNIAD--DSSIQSRLVRVCTGDKNFHSYTEVPLEC------TQNGVEFNLVQDVYVTRAGYELAKSLDISVS---DPVLYGVFWEGDK-----NSYRSQEPTGKSAICMFTMREIETSFKQNIMKCYKGTSGLKKNLPWFSSNDD-CR---FTTLPWEGIKCGKDVNSKIGGDTPISTSAT---YVMEDSSNLLTAIAINTTRSSTVAFVGTQGGQLHKI-LIESKRSAEKYATEMLTDNEPILSDMEFGGDGKHVYILTPSKVIKMPTSRCEALSTQCDTCLSSRDPYCGWCVSNNHCTQEESCEREVPHTSRGWLDFQNSK----CPRIRSVKPDQIQINTADYLNVTIENLQAP------KGRRMQCLFQFSTGDAVVSDPMPF---DGSLKCATPPMNRLPRIPTNEYHLPAKLIVVSDGSKLPLATTNFSFYDCNRYTSCSTCSASQFPCDWCLESNECVAGKLTEDKCRKQHIVNGLNRDGSSIRKGPSKCPHIVAPVSKMSVATGERRNISVKVENVDATFMG--DFKCEFKYGTVTHEKIAMRTSDDTITCDEMLFEPYGTSLLGSGSTPYGFNVIWSATGFAVGKKSINRVLDNVASLAIDVYSCENLATNCGRCLTLDADKYDCGWCSLDSKCARPHQCSNRQIPENWLNAS-QLCPNPVIEDFKPKKGSIFGGTRVTINGINLGRHVSDVEKAVQIAN----VPCEVVE--YVPSQKIVCVTGKSPIKGSNER--GVVAVTLRHDSLKFFAHSTEHFSYVQPVVSSMKPVKGPRSGGTDVTLTGVDLDTGAEVTVRFGQ----IGCKILERASGWLRCRMG------------ASGEGGQFPLHIAFDGQLQNLPIPIYFEFTSDPSVQSISPNKTIPSGGITVDVYGQGFTLLQRPRMVFTGLGDEKSYGPACSIEDDQMMKCATPTAPGKDSDRGSQERITEYAFDFDGAELYRSRIKVMPSPTFET----LSEP----RFVRPGEDFLTLN---GNHLNLAA-SERDIDVKVGGEPCPLTALANKVLTC------QPPVKKPRGAGKLNPEIVVTV-GNASFSIGEVSYDSPGLSSSLFFIIMFFIIFMIALIICLIVLYRRKSNTHQRQMKYLKTQMDTIEMKVATECKEAFAELQTSLNQYTA--DLPLGTPTAPFLEYKDYCARVLFPNAGK---------------------------NHAVLKNLEVDTHKAEAIEAGLREFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELIEKTVEKKF--QPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSASDSVYSSTQDIPVRVLDCDTITQVKEKCLDAKYRGYRFADRPAPGDMELEWKTGMNGKMALQDIDSSSRVEGGNWKR------LNTLAHYNVPNNAILTLTSKSNSL--YNLVNFSSTSMKTASILSDRSEKSSVSMKTPGVGSPKPWGAPPSVIAD--HASSSADTD---------NGFKLYHLVKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESIFSSSTVPPCIKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDI--QKPTKIEGCLSVVAQTLMDACS---TQDHQLTKDSPSSKLLFAKDMYQYRDLVDSYYTEISMT 1667          
BLAST of plexin A vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 291.967 bits (746), Expect = 4.347e-79
Identity = 413/1791 (23.06%), Postives = 723/1791 (40.37%), Query Frame = 2
Query:  725 ETIFPLEFVGSFHIYDSRKDAFFK------------NYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYR--ETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTG-KGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDTNYL--FSTENLFNN--ISFNMVVNENKSVIYAVADSKIIRHNLRNCYN-GTNCEDCLRV-SPFCGWCISNGKCVVKDQC------TTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGI--YHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSL--GKCKKNF----------EIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNST--AIGSLSASNRLVCTFQMMK-----VLQKASIKCSMKVSWILGNLLTGS------IETETPIEFQVFDCLKLSEHCDDCVHL-PQIYKCGFCTVKDKCVQKHICGNDD--SKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKC-----KIQNINDRIETPVAFQFKFKTKDKYLVSKE-FKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFT-DVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIY-ENCFVNNSD-IDCISPTTSNITQ---FQKCSLLFAMEKGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIK--QKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXX-----XXXXKKVQSKQR-LRHEKENIFT--EKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQV--IENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESKKSDIVSFLSLILMKDLPNY-TRILKILIKNDYDK---KKLNEEERSMFRQSDLLS-KLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDS--ELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSS-------FESYCLIKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPA---------------CLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNKDVWLTQ-------LFSDVIKLYSPKVLNYYEGIKGT 5731
            E +FP  + G+    D R   ++K            +Y +F+  Q  N  +  +   Q RLVR+C+ D ++ S+ ++ + C      T   V   +V +V    A +   K+    +    D   + + +   K     N+YR  E       C + + EI   +      C  G+  + +N   F S D  C    FT+   +G   GK+ N  I GD     S      +  +     + I  +     T+A +G   G L+K  L E       ++TE L +N  I  +M    +   +Y +  SK+I+     C    T C+ CL    P+CGWC+SN  C  ++ C      T+  WL FQ ++    CP I  +    I   +     V  +  + P        + ++C F  +    + +    +   + SL C  P    +P I  N+  +  KL V+ + S L      +  Y+C    +C+ C  ++F C WC+  N C++  L   KC+K             I+     CP +      +S   G   +I +  +N    F    DF C       T   I   ++ + + C   + +     +L   S      V W       G       ++    +   V+ C  L+ +C  C+ L    Y CG+C++  KC + H C N      W+N+  Q CP P I +  P   ++   + + + G NLG + +DV+ A+ + N      C+ +E  Y+ S++  C      I+  N+R    VA   +  +   +  S E F +  P V S++P  GP  GGT + + G  L+ G+   V+F      I C ILE    ++ CR+              S    +  L +  D         + FEF  +P V+ IS NK + +GG    + G     L +P + F        Y   C + +   + C +PT          Q+    +A +     +Y + I +  +P        +S P    R ++  +  +T+N    + ++++A  + D  + VG   C   +     + C      Q  +        L  + V+TV G   F  G++S D+  +   +  +++   I ++ +     V+  +K  + QR +++ K  + T   K+  E  E        LNQ     ++     TAP  +Y  Y    LFPN                               H ++ N ++     E      R+  KL  ++ F+L     +E ++    K    V  L ++++++   Y T +LK L++   +K   KK   + + +FR+S+ ++ ++L+ WF  L++DHL+  +AG  L  L+  I   +  GP +  T +++Y+L+E  LL    E+K+L + V        S  ++ V VLDCD I+Q K K  +  Y+   +++  +       +++    K+   ++  S R+      +      L TL  Y++ +   + +  K+ SL   N  + S     +AS+ +++S   S  +             P   ++D  H +SS  +          + FK  H +KP                 L    ++K  +   I +L + IF   +VP C+  +F   +   +     D  +V A KSN+L LRFW+ LI N  FLFD+   K T +  CL  V++ LMD CS    +D  LT+       LF+  +  Y   V +YY  I  T
Sbjct:  204 EVVFPGLYGGTHVSLDYRSRGYYKYQIDYINGFESGDYAYFVTRQRVNIAD--DSSIQSRLVRVCTGDKNFHSYTEVPLEC------TQNGVEFNLVQDVYVTRAGYELAKSLDISVS---DPVLYGVFWEGDK-----NSYRSQEPTGKSAICMFTMREIETSFKQNIMKCYKGTSGLKKNLPWFSSNDD-CR---FTTLPWEGIKCGKDVNSKIGGDTPISTSAT---YVMEDSSNLLTAIAINTTRSSTVAFVGTQGGQLHKI-LIESKRSAEKYATEMLTDNEPILSDMEFGGDGKHVYILTPSKVIKMPTSRCEALSTQCDTCLSSRDPYCGWCVSNNHCTQEESCEREVPHTSRGWLDFQNSK----CPRIRSVKPDQIQINTADYLNVTIENLQAP------KGRRMQCLFQFSTGDAVVSDPMPF---DGSLKCATPPMNRLPRIPTNEYHLPAKLIVVSDGSKLPLATTNFSFYDCNRYTSCSTCSASQFPCDWCLESNECVAGKLTEDKCRKQHIVNGLNRDGSSIRKGPSKCPHIVAPVSKMSVATGERRNISVKVENVDATFMG--DFKCEFKYGTVTHEKIAMRTSDDTITCDEMLFEPYGTSLLGSGSTPYGFNVIWSATGFAVGKKSINRVLDNVASLAIDVYSCENLATNCGRCLTLDADKYDCGWCSLDSKCARPHQCSNRQIPENWLNAS-QLCPNPVIEDFKPKKGSIFGGTRVTINGINLGRHVSDVEKAVQIAN----VPCEVVE--YVPSQKIVCVTGKSPIKGSNER--GVVAVTLRHDSLKFFAHSTEHFSYVQPVVSSMKPVKGPRSGGTDVTLTGVDLDTGAEVTVRFGQ----IGCKILERASGWLRCRMG------------ASGEGGQFPLHIAFDGQLQNLPIPIYFEFTSDPSVQSISPNKTIPSGGITVDVYGQGFTLLQRPRMVFTGLGDEKSYGPACSIEDDQMMKCATPTAPGKDSDRGSQERITEYAFDFDGAELYRSRIKVMPSPTFET----LSEP----RFVRPGEDFLTLN---GNHLNLAA-SERDIDVKVGGEPCPLTALANKVLTC------QPPVKKPRGAGKLNPEIVVTV-GNASFSIGEVSYDSPGLSSSLFFIIMFFIIFMIALIICLIVLYRRKSNTHQRQMKYLKTQMDTIEMKVATECKEAFAELQTSLNQYTA--DLPLGTPTAPFLEYKDYCARVLFPNAGK---------------------------NHAVLKNLEVDTHKAEAIEAGLREFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELIEKTVEKKF--QPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSASDSVYSSTQDIPVRVLDCDTITQVKEKCLDAKYRGYRFADRPAPGDMELEWKTGMNGKMALQDIDSSSRVEGGNWKR------LNTLAHYNVPNNAILTLTSKSNSL--YNLVNFSSTSMKTASILSDRSEKSSVSMKTPGVGSPKPWGAPPSVIAD--HASSSADTD---------NGFKLYHLVKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESIFSSSTVPPCIKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQ--KPTKIEGCLSVVAQTLMDACS---TQDHQLTKDSPSSKLLFAKDMYQYRDLVDSYYTEISMT 1856          
BLAST of plexin A vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 287.345 bits (734), Expect = 8.038e-78
Identity = 411/1791 (22.95%), Postives = 719/1791 (40.15%), Query Frame = 2
Query:  725 ETIFPLEFVGSFHIYDSRKDAFFK------------NYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYR--ETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTS-TGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDTNYL--FSTENLFNN--ISFNMVVNENKSVIYAVADSKIIRHNLRNCYN-GTNCEDCLRV-SPFCGWCISNGKCVVKDQC------TTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGI--YHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSL--GKCKKNF----------EIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNST--AIGSLSASNRLVCTFQMMK-----VLQKASIKCSMKVSWILGNLLTGS------IETETPIEFQVFDCLKLSEHCDDCVHL-PQIYKCGFCTVKDKCVQKHICGNDD--SKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKC-----KIQNINDRIETPVAFQFKFKTKDKYLVSKE-FKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFT-DVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIY-ENCFVNNSD-IDCISPTTSNITQ---FQKCSLLFAMEKGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIK--QKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXX-----XXXXKKVQSKQR-LRHEKENIFT--EKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQV--IENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESKKSDIVSFLSLILMKDLPNY-TRILKILIKNDYDK---KKLNEEERSMFRQSDLLS-KLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDS--ELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSS-------FESYCLIKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPA---------------CLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNKDVWLTQ-------LFSDVIKLYSPKVLNYYEGIKGT 5731
            E +FP  + G+    D R   ++K            +Y +F+  Q  N  +  +   Q RLVR+C+ D ++ S+ ++ + C      T   V   +V +V    A +   K+    +    D   + + +   K     N+YR  E       C + + EI   +      C  G+  + +N   F S D  C    FT+   +G   GK+ N  I GD     S      +  +     + I  +     T+A +G   G L+K  L E       ++TE L +N  I  +M    +   +Y +  SK+I+     C    T C+ CL    P+CGWC+SN  C  ++ C      T+  WL FQ ++    CP I  +    I   +     V  +  + P        + ++C F  +    + +    +   + SL C  P    +P I  N+  +  KL V+ + S L      +  Y+C    +C+ C  ++F C WC+  N C++  L   KC+K             I+     CP +      +S   G   +I +  +N    F    DF C       T   I   ++ + + C   + +     +L   S      V W       G       ++    +   V+ C  L+ +C  C+ L    Y CG+C++  KC + H C N      W+N+  Q CP P I +  P   ++   + + + G NLG + +DV+ A+ + N      C+ +E  Y+ S++  C      I+  N+R    VA   +  +   +  S E F +  P V S++P  GP  GGT + + G  L+ G+   V+F      I C ILE    ++ CR+              S    +  L +  D         + FEF  +P V+ IS NK + +GG    + G     L +P + F        Y   C + +   + C +PT          Q+    +A +     +Y + I +  +P        +S P    R ++  +  +T+N    + ++++A  + D  + VG   C   +     + C      Q  +        L  + V+TV G   F  G++S D+  +   +  +++   I ++ +     V+  +K  + QR +++ K  + T   K+  E  E        LNQ     ++     TAP  +Y  Y    LFPN                               H ++ N ++     E      R+  KL  ++ F+L     +E ++    K    V  L ++++++   Y T +LK L++   +K   KK   + + +FR+S+ ++ ++L+ WF  L++DHL+  +AG  L  L+  I   +  GP +  T +++Y+L+E  LL    E+K+L + V        S  ++ V VLDCD I+Q K K  +  Y+   +++  +       +++    K+   ++  S R+      +      L TL  Y++ +   + +  K+ SL   +  S    E +S S+KT                P +    P       + +++S  +          + FK  H +KP                 L    ++K  +   I +L + IF   +VP C+  +F   +   +     D  +V A KSN+L LRFW+ LI N  FLFD+   K T +  CL  V++ LMD CS    +D  LT+       LF+  +  Y   V +YY  I  T
Sbjct:   15 EVVFPGLYGGTHVSLDYRSRGYYKYQIDYINGFESGDYAYFVTRQRVNIAD--DSSIQSRLVRVCTGDKNFHSYTEVPLEC------TQNGVEFNLVQDVYVTRAGYELAKSLDISVS---DPVLYGVFWEGDK-----NSYRSQEPTGKSAICMFTMREIETSFKQNIMKCYKGTSGLKKNLPWFSSNDD-CR---FTTLPWEGIKCGKDVNSKIGGDTPISTSAT---YVMEDSSNLLTAIAINTTRSSTVAFVGTQGGQLHKI-LIESKRSAEKYATEMLTDNEPILSDMEFGGDGKHVYILTPSKVIKMPTSRCEALSTQCDTCLSSRDPYCGWCVSNNHCTQEESCEREVPHTSRGWLDFQNSK----CPRIRSVKPDQIQINTADYLNVTIENLQAP------KGRRMQCLFQFSTGDAVVSDPMPF---DGSLKCATPPMNRLPRIPTNEYHLPAKLIVVSDGSKLPLATTNFSFYDCNRYTSCSTCSASQFPCDWCLESNECVAGKLTEDKCRKQHIVNGLNRDGSSIRKGPSKCPHIVAPVSKMSVATGERRNISVKVENVDATFMG--DFKCEFKYGTVTHEKIAMRTSDDTITCDEMLFEPYGTSLLGSGSTPYGFNVIWSATGFAVGKKSINRVLDNVASLAIDVYSCENLATNCGRCLTLDADKYDCGWCSLDSKCARPHQCSNRQIPENWLNAS-QLCPNPVIEDFKPKKGSIFGGTRVTINGINLGRHVSDVEKAVQIAN----VPCEVVE--YVPSQKIVCVTGKSPIKGSNER--GVVAVTLRHDSLKFFAHSTEHFSYVQPVVSSMKPVKGPRSGGTDVTLTGVDLDTGAEVTVRFGQ----IGCKILERASGWLRCRMG------------ASGEGGQFPLHIAFDGQLQNLPIPIYFEFTSDPSVQSISPNKTIPSGGITVDVYGQGFTLLQRPRMVFTGLGDEKSYGPACSIEDDQMMKCATPTAPGKDSDRGSQERITEYAFDFDGAELYRSRIKVMPSPTFET----LSEP----RFVRPGEDFLTLN---GNHLNLAA-SERDIDVKVGGEPCPLTALANKVLTC------QPPVKKPRGAGKLNPEIVVTV-GNASFSIGEVSYDSPGLSSSLFFIIMFFIIFMIALIICLIVLYRRKSNTHQRQMKYLKTQMDTIEMKVATECKEAFAELQTSLNQYTA--DLPLGTPTAPFLEYKDYCARVLFPNAGK---------------------------NHAVLKNLEVDTHKAEAIEAGLREFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELIEKTVEKKF--QPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSASDSVYSSTQDIPVRVLDCDTITQVKEKCLDAKYRGYRFADRPAPGDMELEWKTGMNGKMALQDIDSSSRVEGGNWKR------LNTLAHYNVPNNAILTLTSKSNSLYNLSILS-DRSEKSSVSMKT----------------PGVGSPKPWGAPPSVIADHASSSADTD-------NGFKLYHLVKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESIFSSSTVPPCIKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDI--QKPTKIEGCLSVVAQTLMDACS---TQDHQLTKDSPSSKLLFAKDMYQYRDLVDSYYTEISMT 1656          
BLAST of plexin A vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 286.96 bits (733), Expect = 1.488e-77
Identity = 411/1791 (22.95%), Postives = 719/1791 (40.15%), Query Frame = 2
Query:  725 ETIFPLEFVGSFHIYDSRKDAFFK------------NYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYR--ETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTS-TGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDTNYL--FSTENLFNN--ISFNMVVNENKSVIYAVADSKIIRHNLRNCYN-GTNCEDCLRV-SPFCGWCISNGKCVVKDQC------TTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGI--YHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSL--GKCKKNF----------EIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNST--AIGSLSASNRLVCTFQMMK-----VLQKASIKCSMKVSWILGNLLTGS------IETETPIEFQVFDCLKLSEHCDDCVHL-PQIYKCGFCTVKDKCVQKHICGNDD--SKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKC-----KIQNINDRIETPVAFQFKFKTKDKYLVSKE-FKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFT-DVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIY-ENCFVNNSD-IDCISPTTSNITQ---FQKCSLLFAMEKGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIK--QKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXX-----XXXXKKVQSKQR-LRHEKENIFT--EKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQV--IENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESKKSDIVSFLSLILMKDLPNY-TRILKILIKNDYDK---KKLNEEERSMFRQSDLLS-KLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDS--ELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSS-------FESYCLIKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPA---------------CLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNKDVWLTQ-------LFSDVIKLYSPKVLNYYEGIKGT 5731
            E +FP  + G+    D R   ++K            +Y +F+  Q  N  +  +   Q RLVR+C+ D ++ S+ ++ + C      T   V   +V +V    A +   K+    +    D   + + +   K     N+YR  E       C + + EI   +      C  G+  + +N   F S D  C    FT+   +G   GK+ N  I GD     S      +  +     + I  +     T+A +G   G L+K  L E       ++TE L +N  I  +M    +   +Y +  SK+I+     C    T C+ CL    P+CGWC+SN  C  ++ C      T+  WL FQ ++    CP I  +    I   +     V  +  + P        + ++C F  +    + +    +   + SL C  P    +P I  N+  +  KL V+ + S L      +  Y+C    +C+ C  ++F C WC+  N C++  L   KC+K             I+     CP +      +S   G   +I +  +N    F    DF C       T   I   ++ + + C   + +     +L   S      V W       G       ++    +   V+ C  L+ +C  C+ L    Y CG+C++  KC + H C N      W+N+  Q CP P I +  P   ++   + + + G NLG + +DV+ A+ + N      C+ +E  Y+ S++  C      I+  N+R    VA   +  +   +  S E F +  P V S++P  GP  GGT + + G  L+ G+   V+F      I C ILE    ++ CR+              S    +  L +  D         + FEF  +P V+ IS NK + +GG    + G     L +P + F        Y   C + +   + C +PT          Q+    +A +     +Y + I +  +P        +S P    R ++  +  +T+N    + ++++A  + D  + VG   C   +     + C      Q  +        L  + V+TV G   F  G++S D+  +   +  +++   I ++ +     V+  +K  + QR +++ K  + T   K+  E  E        LNQ     ++     TAP  +Y  Y    LFPN                               H ++ N ++     E      R+  KL  ++ F+L     +E ++    K    V  L ++++++   Y T +LK L++   +K   KK   + + +FR+S+ ++ ++L+ WF  L++DHL+  +AG  L  L+  I   +  GP +  T +++Y+L+E  LL    E+K+L + V        S  ++ V VLDCD I+Q K K  +  Y+   +++  +       +++    K+   ++  S R+      +      L TL  Y++ +   + +  K+ SL   +  S    E +S S+KT                P +    P       + +++S  +          + FK  H +KP                 L    ++K  +   I +L + IF   +VP C+  +F   +   +     D  +V A KSN+L LRFW+ LI N  FLFD+   K T +  CL  V++ LMD CS    +D  LT+       LF+  +  Y   V +YY  I  T
Sbjct:  204 EVVFPGLYGGTHVSLDYRSRGYYKYQIDYINGFESGDYAYFVTRQRVNIAD--DSSIQSRLVRVCTGDKNFHSYTEVPLEC------TQNGVEFNLVQDVYVTRAGYELAKSLDISVS---DPVLYGVFWEGDK-----NSYRSQEPTGKSAICMFTMREIETSFKQNIMKCYKGTSGLKKNLPWFSSNDD-CR---FTTLPWEGIKCGKDVNSKIGGDTPISTSAT---YVMEDSSNLLTAIAINTTRSSTVAFVGTQGGQLHKI-LIESKRSAEKYATEMLTDNEPILSDMEFGGDGKHVYILTPSKVIKMPTSRCEALSTQCDTCLSSRDPYCGWCVSNNHCTQEESCEREVPHTSRGWLDFQNSK----CPRIRSVKPDQIQINTADYLNVTIENLQAP------KGRRMQCLFQFSTGDAVVSDPMPF---DGSLKCATPPMNRLPRIPTNEYHLPAKLIVVSDGSKLPLATTNFSFYDCNRYTSCSTCSASQFPCDWCLESNECVAGKLTEDKCRKQHIVNGLNRDGSSIRKGPSKCPHIVAPVSKMSVATGERRNISVKVENVDATFMG--DFKCEFKYGTVTHEKIAMRTSDDTITCDEMLFEPYGTSLLGSGSTPYGFNVIWSATGFAVGKKSINRVLDNVASLAIDVYSCENLATNCGRCLTLDADKYDCGWCSLDSKCARPHQCSNRQIPENWLNAS-QLCPNPVIEDFKPKKGSIFGGTRVTINGINLGRHVSDVEKAVQIAN----VPCEVVE--YVPSQKIVCVTGKSPIKGSNER--GVVAVTLRHDSLKFFAHSTEHFSYVQPVVSSMKPVKGPRSGGTDVTLTGVDLDTGAEVTVRFGQ----IGCKILERASGWLRCRMG------------ASGEGGQFPLHIAFDGQLQNLPIPIYFEFTSDPSVQSISPNKTIPSGGITVDVYGQGFTLLQRPRMVFTGLGDEKSYGPACSIEDDQMMKCATPTAPGKDSDRGSQERITEYAFDFDGAELYRSRIKVMPSPTFET----LSEP----RFVRPGEDFLTLN---GNHLNLAA-SERDIDVKVGGEPCPLTALANKVLTC------QPPVKKPRGAGKLNPEIVVTV-GNASFSIGEVSYDSPGLSSSLFFIIMFFIIFMIALIICLIVLYRRKSNTHQRQMKYLKTQMDTIEMKVATECKEAFAELQTSLNQYTA--DLPLGTPTAPFLEYKDYCARVLFPNAGK---------------------------NHAVLKNLEVDTHKAEAIEAGLREFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELIEKTVEKKF--QPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSASDSVYSSTQDIPVRVLDCDTITQVKEKCLDAKYRGYRFADRPAPGDMELEWKTGMNGKMALQDIDSSSRVEGGNWKR------LNTLAHYNVPNNAILTLTSKSNSLYNLSILS-DRSEKSSVSMKT----------------PGVGSPKPWGAPPSVIADHASSSADTD-------NGFKLYHLVKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESIFSSSTVPPCIKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQ--KPTKIEGCLSVVAQTLMDACS---TQDHQLTKDSPSSKLLFAKDMYQYRDLVDSYYTEISMT 1845          
BLAST of plexin A vs. Ensembl Celegans
Match: plx-1 (PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90])

HSP 1 Score: 197.208 bits (500), Expect = 2.136e-50
Identity = 271/1142 (23.73%), Postives = 481/1142 (42.12%), Query Frame = 2
Query: 2519 IEFQVFDCLKLSEHCDDCVHL-PQIYKCGFCTVKDKCVQKHICGNDD--SKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKC-----KIQNINDRIETPVAFQFKFKTKDKYLVSKE-FKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFT-DVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIY-ENCFVNNSD-IDCISPTTSNITQ---FQKCSLLFAMEKGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIK--QKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXX-----XXXXKKVQSKQR-LRHEKENIFT--EKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQI-----QVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESKKSDIVSFLSLILMKDLPNY-TRILKILIKNDYDK---KKLNEEERSMFRQSDLLS-KLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDS--ELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSS-------FESYCLIKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPA---------------CLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNKDVWLTQ-------LFSDVIKLYSPKVLNYYEGIKGT 5731
            +   V+ C  L+ +C  C+ L    Y CG+C++  KC + H C N      W+N+  Q CP P I +  P   ++   + + + G NLG + +DV+ A+ + N      C+ +E  Y+ S++  C      I+  N+R    VA   +  +   +  S E F +  P V S++P  GP  GGT + + G  L+ G+   V+F      I C ILE    ++ CR+              S    +  L +  D         + FEF  +P V+ IS NK + +GG    + G     L +P + F        Y   C + +   + C +PT          Q+    +A +     +Y + I +  +P        +S P    R ++  +  +T+N    + ++++A  + D  + VG   C   +     + C      Q  +        L  + V+TV G   F  G++S D+  +   +  +++   I ++ +     V+  +K  + QR +++ K  + T   K+  E  E        LNQ     ++     TAP  +Y  Y    LFPN                               H ++ N ++     + IE  +   R+  KL  ++ F+L     +E ++    K    V  L ++++++   Y T +LK L++   +K   KK   + + +FR+S+ ++ ++L+ WF  L++DHL+  +AG  L  L+  I   +  GP +  T +++Y+L+E  LL    E+K+L + V        S  ++ V VLDCD I+Q K K  +  Y+   +++  +       +++    K+   ++  S R+      +      L TL  Y++ +   + +  K+ SL   N  + S     +AS+ +++S   S  +             P   ++D  H +SS  +          + FK  H +KP                 L    ++K  +   I +L + IF   +VP C+  +F   +   +     D  +V A KSN+L LRFW+ LI N  FLFD+   K T +  CL  V++ LMD CS    +D  LT+       LF+  +  Y   V +YY  I  T
Sbjct:   46 LAIDVYSCENLATNCGRCLTLDADKYDCGWCSLDSKCARPHQCSNRQIPENWLNAS-QLCPNPVIEDFKPKKGSIFGGTRVTINGINLGRHVSDVEKAVQIAN----VPCEVVE--YVPSQKIVCVTGKSPIKGSNER--GVVAVTLRHDSLKFFAHSTEHFSYVQPVVSSMKPVKGPRSGGTDVTLTGVDLDTGAEVTVRFGQ----IGCKILERASGWLRCRMG------------ASGEGGQFPLHIAFDGQLQNLPIPIYFEFTSDPSVQSISPNKTIPSGGITVDVYGQGFTLLQRPRMVFTGLGDEKSYGPACSIEDDQMMKCATPTAPGKDSDRGSQERITEYAFDFDGAELYRSRIKVMPSPTFET----LSEP----RFVRPGEDFLTLN---GNHLNLAA-SERDIDVKVGGEPCPLTALANKVLTC------QPPVKKPRGAGKLNPEIVVTV-GNASFSIGEVSYDSPGLSSSLFFIIMFFIIFMIALIICLIVLYRRKSNTHQRQMKYLKTQMDTIEMKVATECKEAFAELQTSLNQYTA--DLPLGTPTAPFLEYKDYCARVLFPNAGK---------------------------NHAVLKNLEVDTHKAEAIEAGL---REFHKLLMNKTFLLTMVRTMEANKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELIEKTVEKKF--QPKILFRRSESIAERMLAAWFTFLLHDHLKTYDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELMVFVSASDSVYSSTQDIPVRVLDCDTITQVKEKCLDAKYRGYRFADRPAPGDMELEWKTGMNGKMALQDIDSSSRVEGGNWKR------LNTLAHYNVPNNAILTLTSKSNSL--YNLVNFSSTSMKTASILSDRSEKSSVSMKTPGVGSPKPWGAPPSVIAD--HASSSADTD---------NGFKLYHLVKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLESIFSSSTVPPCIKYMFDFMDEQAREHGINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDI--QKPTKIEGCLSVVAQTLMDACS---TQDHQLTKDSPSSKLLFAKDMYQYRDLVDSYYTEISMT 1085          
BLAST of plexin A vs. Ensembl Fly
Match: PlexA (gene:FBgn0025741 transcript:FBtr0089223)

HSP 1 Score: 295.819 bits (756), Expect = 3.808e-80
Identity = 440/1961 (22.44%), Postives = 794/1961 (40.49%), Query Frame = 2
Query:  206 ILVSGKNYILQFSEN-NLKEPLAIRKTGPVNHSVMCTEPNQCQTSLCPKELISRDQCRIKLTDVF--VKLWTFADSYLVVCYDVFQGFCEIIDLYNQFSSSYKNKAYSIVTNDRKFHSTVLYHDQRLFFANEVYHPSNYREIDFNTMSI-LSFPNMTYFKPDYPFQANFG----KL--VYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIF---------FLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWT--YYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDT---NYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRV-SPFCGWCISNGKCVVKDQCTTAM-----WLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLI-NDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQN---------NQPD-CPTLEVSNETLSFHVGFPISIGLMTK-NFRNYFNSKTDFVCLETCDNS-TAIGSLSASNRLVC-TFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETP--IEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICG-NDDSK--WINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKE-FKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKN--------KFLSNGGQMFKITGDNLNRLNKPS--VAFRCETFLSIYENCFV-NNSDIDCISPTT---SNITQFQKCSLL---FAME-----KGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNII-EVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLD---NMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLR--HEKENIFTEKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXX-----------XNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSN----------WSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHL-KPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQN---KDVWLTQ-LFSDVIKLYSPKVLNYYEGIK 5725
            + V G N + Q S +  L E +   KTGP N SV      +C    CP   +         TD +  V L   A S L+ C  +FQG C + +L N  S        ++V ND    STV +            HP        N M + +++ N + ++ + P  A+      K+  +     T     F+ S+      ++ +F NY++         FL  Q ++ H      +  +LVRIC  D +Y S+ +I + C  D Q    +  V +  +   S D+A           +   +  D    +F   +    TNN          C Y +  I   +      C  GSG       +F S    C+     + G+  CG        +    G  + I    ++    +  S+   S    +T+  +G +DG L K  +   +    Y     +L + I+ +M  +     IY ++ +K+ +  + +C +   C DCL    P+CGWC    KC  +  C         W+ +   +T K   + +V+P H +   + ++  +I       L  L EN   L C FT+ +     N         + ++C  P    +P I + K+    KL V   N   LV   +  ++C+   +C  CV+++F C WCV  + C   +   C+ +  +           + P  CPT+  + +     V    S  +  K +    F  +T FVC    +   T++ +    + + C + +     +  ++  +  V W       GS   + P  I   ++ C ++++ C  C+ L + Y CG+C+  + C  +  C  N + K  W+N + + CP P I    P        + I ++G NLG   ND+ + + +        C    Q YI +KQ  C + +  +++      +   +  D    SKE ++F  P++    P FGP  GGT I + G  LN GSR +   N               +++ C++   +    + R   S    +  L+++ D    +F D  F++  +P V+ +S          K +  GG    +TG     +  P+  V +  E + S    C V ++++++C SP     S++ + ++  LL   F M+     +    V+N    ++  P   I   ++       +  K + +TIN    D+    A  +SD ++ +G   C   S     + C    E       +  ++ + +G ++    G + +E  +I LD   N+   +I  I+++++  + L+V    K  +S + LR   E+ +I   ++  E  E      AEL                P   Y  Y +  LFPN    +  +                     +  P ++ K+  +        R   +L  ++ F+L+F   LE ++    + + ++ S + + L   L   T ILK L+ +  +K  +  +  +  + R   +  K+LS WF  L+Y  L+   AG  L +L+  +   ++ GPV+  T +++Y+L+E  L+ + I+F+ + +                   +   + V+VLDCD I Q K K  E IY+  P S           W +  +  +I  ++D   ++E               L TL+ Y++ DG  + +  K  S+      + S L   +      ++ NISK    TS  P  S+      L++ +HEN  +   +   + + +   K+G  + K    IY T++L +K  G ++   DD+F+          ++PL +  +F   ++  +     D  +V   KSNSL LRFW+ LI N +F+FD+   K   V  CL  V++  MD CS + +   KD   ++ L++  I  Y   V  YY  I+
Sbjct:   87 VFVGGVNRLYQLSPDLELSETV---KTGPQNDSV------ECSILDCPLNAVRSP------TDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQN-VSIIEHEVPDAVVANDAN-SSTVAF-----IAPGPPQHPVT------NVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASSAVTTGTRTFINSY-----ARETYFVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRICQEDSNYYSYTEIPVECISDAQGGTKFNLVQAGFLGKPSSDLAQ---------SLGISIQDDVLFAVFSKGEGNTPTNNS-------ALCIYSLKSIRRKFMQNIKSCFNGSGMRG---LDFISPSMPCVLTKLQTIGEDFCG------LDVNSPLGGETPITSVPVAMFNTKLTSVAATST-SGYTVVFVGTSDGFLKKVVIESSSIANEYASFAVDLGSEINRDMQFDNQNLYIYVMSKTKVSKVKVFDCSDYKTCGDCLGARDPYCGWCSLENKCSPRSNCQDDANDPLYWVSY---KTGKCTTITSVVP-HQLQRTTARTLELIID----HLPQLKEN---LICAFTTEDKALFTNATKK----RNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGPDLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPSYRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLNAQLLGDTIYCDSMEFQYTSRSPNLTATFAVIW------GGSKPLDNPHNIHVVIYRCREMADSCGICLALSEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLN-RSEICPNPEIHTFQPKTGPWEGGTNITIRGINLGKNYNDIYSGVRIAG----INCMPFPQFYIDTKQIVCTVDSPGEQMYR--NGKIVVQIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASIN---------------DHLPCKILSTDSSQAICRTSASPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPSGQIKVPKGIPAGGIRISVTGTQFTSIQNPNIYVVYNGEMYAS---PCRVQSDTEMECASPVVDVDSHVIEAERPILLEYGFLMDNVLRVQNLSKVHNNHFELYPNPEYFIFEERV-------KYFKSEYLTINGRNLDR----ACKESDVEVKIGNGFCNITSLSRQQLTCRPPSEATATKSMNGPEVIVRIGTSLEYRIGILSYESSNIILDWGENVIFAVIATIVILLLIFVALLVAYKKKSSESSRVLRNMQEQMDILELRVAAECKEAF----AELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQ---------------------WERPELLRKEKGL--------RIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKEC-AGEPLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEWK----------KLNTLQHYNVPDGAGLSLVPKQSSI-----YNFSILSDKNEKSHKYETLNISK---YTSSSPTFSR--AGSPLNNDMHENGLRYWHLVKHHDSDMQ--KEGERVNKLVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIH--KSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYRKWVDRYYRDIR 1871          
BLAST of plexin A vs. Ensembl Fly
Match: PlexA (gene:FBgn0025741 transcript:FBtr0309865)

HSP 1 Score: 288.115 bits (736), Expect = 8.460e-78
Identity = 436/1961 (22.23%), Postives = 788/1961 (40.18%), Query Frame = 2
Query:  206 ILVSGKNYILQFSEN-NLKEPLAIRKTGPVNHSVMCTEPNQCQTSLCPKELISRDQCRIKLTDVF--VKLWTFADSYLVVCYDVFQGFCEIIDLYNQFSSSYKNKAYSIVTNDRKFHSTVLYHDQRLFFANEVYHPSNYREIDFNTMSI-LSFPNMTYFKPDYPFQANFG----KL--VYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIF---------FLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWT--YYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDT---NYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRV-SPFCGWCISNGKCVVKDQCTTAM-----WLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLI-NDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQN---------NQPD-CPTLEVSNETLSFHVGFPISIGLMTK-NFRNYFNSKTDFVCLETCDNS-TAIGSLSASNRLVC-TFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETP--IEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICG-NDDSK--WINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKE-FKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKN--------KFLSNGGQMFKITGDNLNRLNKPS--VAFRCETFLSIYENCFV-NNSDIDCISPTT---SNITQFQKCSLL---FAME-----KGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNII-EVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLD---NMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLR--HEKENIFTEKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXX-----------XNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSN----------WSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHL-KPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQN---KDVWLTQ-LFSDVIKLYSPKVLNYYEGIK 5725
            + V G N + Q S +  L E +   KTGP N SV      +C    CP   +         TD +  V L   A S L+ C  +FQG C + +L N  S        ++V ND    STV +            HP        N M + +++ N + ++ + P  A+      K+  +     T     F+ S+      ++ +F NY++         FL  Q ++ H      +  +LVRIC  D +Y S+ +I + C  D Q    +  V +  +   S D+A           +   +  D    +F   +    TNN          C Y +  I   +      C  GSG       +F S    C+     + G+  CG        +    G  + I    ++    +  S+   S    +T+  +G +DG L K  +   +    Y     +L + I+ +M  +     IY ++ +K+ +  + +C +   C DCL    P+CGWC    KC  +  C         W+ +   +T K   + +V+P H +   + ++  +I       L  L EN   L C FT+ +     N         + ++C  P    +P I + K+    KL V   N   LV   +  ++C+   +C  CV+++F C WCV  + C   +   C+ +  +           + P  CPT+  + +     V    S  +  K +    F  +T FVC    +   T++ +    + + C + +     +  ++  +  V W       GS   + P  I   ++ C ++++ C  C+ L + Y CG+C+  + C  +  C  N + K  W+N + + CP P I    P        + I ++G NLG   ND+ + + +        C    Q YI +KQ  C + +  +++      +   +  D    SKE ++F  P++    P FGP  GGT I + G  LN GSR +   N               +++ C++   +    + R   S    +  L+++ D    +F D  F++  +P V+ +S          K +  GG    +TG     +  P+  V +  E + S    C V ++++++C SP     S++ + ++  LL   F M+     +    V+N    ++  P   I   ++       +  K + +TIN    D+    A  +SD ++ +G   C   S     + C    E       +  ++ + +G ++    G + +E  +I LD   N+   +I  I+++++  + L+V    K  +S + LR   E+ +I   ++  E  E      AEL                P   Y  Y +  LFPN    +  +                     +  P ++ K+  +        R   +L  ++ F+L+F   LE ++    + + ++ S + + L   L   T ILK L+ +  +K  +  +  +  + R   +  K+LS WF  L+Y  L+   AG  L +L+  +   ++ GPV+  T +++Y+L+E  L+ + I+F+ + +                   +   + V+VLDCD I Q K K  E IY+  P S           W +  +  +I  ++D   ++E               L TL+ Y++ DG  + +  K  S+   N + +S         K  KS N +                    L++ +HEN  +   +   + + +   K+G  + K    IY T++L +K  G ++   DD+F+          ++PL +  +F   ++  +     D  +V   KSNSL LRFW+ LI N +F+FD+   K   V  CL  V++  MD CS + +   KD   ++ L++  I  Y   V  YY  I+
Sbjct:   87 VFVGGVNRLYQLSPDLELSETV---KTGPQNDSV------ECSILDCPLNAVRSP------TDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQN-VSIIEHEVPDAVVANDAN-SSTVAF-----IAPGPPQHPVT------NVMYVGVTYTNNSPYRSEIPAVASRSLEKTKMFQIASSAVTTGTRTFINSY-----ARETYFVNYVYGFSSERFSYFLTTQLKHSHHSSPKEYITKLVRICQEDSNYYSYTEIPVECISDAQGGTKFNLVQAGFLGKPSSDLAQ---------SLGISIQDDVLFAVFSKGEGNTPTNNS-------ALCIYSLKSIRRKFMQNIKSCFNGSGMRG---LDFISPSMPCVLTKLQTIGEDFCG------LDVNSPLGGETPITSVPVAMFNTKLTSVAATST-SGYTVVFVGTSDGFLKKVVIESSSIANEYASFAVDLGSEINRDMQFDNQNLYIYVMSKTKVSKVKVFDCSDYKTCGDCLGARDPYCGWCSLENKCSPRSNCQDDANDPLYWVSY---KTGKCTTITSVVP-HQLQRTTARTLELIID----HLPQLKEN---LICAFTTEDKALFTNATKK----RNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGPDLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPSYRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLNAQLLGDTIYCDSMEFQYTSRSPNLTATFAVIW------GGSKPLDNPHNIHVVIYRCREMADSCGICLALSEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLN-RSEICPNPEIHTFQPKTGPWEGGTNITIRGINLGKNYNDIYSGVRIAG----INCMPFPQFYIDTKQIVCTVDSPGEQMYR--NGKIVVQIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASIN---------------DHLPCKILSTDSSQAICRTSASPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPSGQIKVPKGIPAGGIRISVTGTQFTSIQNPNIYVVYNGEMYAS---PCRVQSDTEMECASPVVDVDSHVIEAERPILLEYGFLMDNVLRVQNLSKVHNNHFELYPNPEYFIFEERV-------KYFKSEYLTINGRNLDR----ACKESDVEVKIGNGFCNITSLSRQQLTCRPPSEATATKSMNGPEVIVRIGTSLEYRIGILSYESSNIILDWGENVIFAVIATIVILLLIFVALLVAYKKKSSESSRVLRNMQEQMDILELRVAAECKEAF----AELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQ---------------------WERPELLRKEKGL--------RIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKEC-AGEPLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEWK----------KLNTLQHYNVPDGAGLSLVPKQSSI--YNFSILSD--------KNEKSHNRAGS-----------------PLNNDMHENGLRYWHLVKHHDSDMQ--KEGERVNKLVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIH--KSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYRKWVDRYYRDIR 1854          
BLAST of plexin A vs. Ensembl Fly
Match: PlexA (gene:FBgn0025741 transcript:FBtr0089224)

HSP 1 Score: 264.233 bits (674), Expect = 8.828e-71
Identity = 344/1532 (22.45%), Postives = 639/1532 (41.71%), Query Frame = 2
Query: 1430 FTLAMIGGNDGILYKYELFEDT---NYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRV-SPFCGWCISNGKCVVKDQCTTAM-----WLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLI-NDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQN---------NQPD-CPTLEVSNETLSFHVGFPISIGLMTK-NFRNYFNSKTDFVCLETCDNS-TAIGSLSASNRLVC-TFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETP--IEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDD---SKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKE-FKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKN--------KFLSNGGQMFKITGDNLNRLNKPS--VAFRCETFLSIYENCFV-NNSDIDCISPTT---SNITQFQKCSLL---FAME-----KGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNII-EVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLD---NMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLR--HEKENIFTEKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXX-----------XNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSN----------WSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHL-KPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQN---KDVWLTQ-LFSDVIKLYSPKVLNYYEGIK 5725
            +T+  +G +DG L K  +   +    Y     +L + I+ +M  +     IY ++ +K+ +  + +C +   C DCL    P+CGWC    KC  +  C         W+ +   +T K   + +V+P H +   + ++  +I       L  L EN   L C FT+ +     N         + ++C  P    +P I + K+    KL V   N   LV   +  ++C+   +C  CV+++F C WCV  + C   +   C+ +  +           + P  CPT+  + +     V    S  +  K +    F  +T FVC    +   T++ +    + + C + +     +  ++  +  V W       GS   + P  I   ++ C ++++ C  C+ L + Y CG+C+  + C  +  C  +    + W+N + + CP P I    P        + I ++G NLG   ND+ + + +        C    Q YI +KQ  C + +  +++      +   +  D    SKE ++F  P++    P FGP  GGT I + G  LN GSR +   N               +++ C++   +    + R   S    +  L+++ D    +F D  F++  +P V+ +S          K +  GG    +TG     +  P+  V +  E + S    C V ++++++C SP     S++ + ++  LL   F M+     +    V+N    ++  P   I   ++       +  K + +TIN    D+    A  +SD ++ +G   C   S     + C    E       +  ++ + +G ++    G + +E  +I LD   N+   +I  I+++++  + L+V    K  +S + LR   E+ +I   ++  E  E      AEL                P   Y  Y +  LFPN    +  +                     +  P ++ K+  +        R   +L  ++ F+L+F   LE ++    + + ++ S + + L   L   T ILK L+ +  +K  +  +  +  + R   +  K+LS WF  L+Y  L+   AG  L +L+  +   ++ GPV+  T +++Y+L+E  L+ + I+F+ + +                   +   + V+VLDCD I Q K K  E IY+  P S           W +  +  +I  ++D   ++E               L TL+ Y++ DG  + +  K  S+      + S L   +      ++ NISK    TS  P  S+      L++ +HEN  +   +   + + +   K+G  + K    IY T++L +K  G ++   DD+F+          ++PL +  +F   ++  +     D  +V   KSNSL LRFW+ LI N +F+FD+   K   V  CL  V++  MD CS + +   KD   ++ L++  I  Y   V  YY  I+
Sbjct:   17 YTVVFVGTSDGFLKKVVIESSSIANEYASFAVDLGSEINRDMQFDNQNLYIYVMSKTKVSKVKVFDCSDYKTCGDCLGARDPYCGWCSLENKCSPRSNCQDDANDPLYWVSY---KTGKCTTITSVVP-HQLQRTTARTLELIID----HLPQLKEN---LICAFTTEDKALFTNATKK----RNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGPDLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPSYRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLNAQLLGDTIYCDSMEFQYTSRSPNLTATFAVIW------GGSKPLDNPHNIHVVIYRCREMADSCGICLALSEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLN-RSEICPNPEIHTFQPKTGPWEGGTNITIRGINLGKNYNDIYSGVRIAG----INCMPFPQFYIDTKQIVCTVDSPGEQMYR--NGKIVVQIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASIN---------------DHLPCKILSTDSSQAICRTSASPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPSGQIKVPKGIPAGGIRISVTGTQFTSIQNPNIYVVYNGEMYAS---PCRVQSDTEMECASPVVDVDSHVIEAERPILLEYGFLMDNVLRVQNLSKVHNNHFELYPNPEYFIFEERV-------KYFKSEYLTINGRNLDR----ACKESDVEVKIGNGFCNITSLSRQQLTCRPPSEATATKSMNGPEVIVRIGTSLEYRIGILSYESSNIILDWGENVIFAVIATIVILLLIFVALLVAYKKKSSESSRVLRNMQEQMDILELRVAAECKEAF----AELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQ---------------------WERPELLRKEKGL--------RIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKEC-AGEPLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEWK----------KLNTLQHYNVPDGAGLSLVPKQSSI-----YNFSILSDKNEKSHKYETLNISK---YTSSSPTFSR--AGSPLNNDMHENGLRYWHLVKHHDSDMQ--KEGERVNKLVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIH--KSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYRKWVDRYYRDIR 1431          
BLAST of plexin A vs. Ensembl Fly
Match: PlexA (gene:FBgn0025741 transcript:FBtr0089225)

HSP 1 Score: 264.233 bits (674), Expect = 8.828e-71
Identity = 344/1532 (22.45%), Postives = 639/1532 (41.71%), Query Frame = 2
Query: 1430 FTLAMIGGNDGILYKYELFEDT---NYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRV-SPFCGWCISNGKCVVKDQCTTAM-----WLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLI-NDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQN---------NQPD-CPTLEVSNETLSFHVGFPISIGLMTK-NFRNYFNSKTDFVCLETCDNS-TAIGSLSASNRLVC-TFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETP--IEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDD---SKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKE-FKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKN--------KFLSNGGQMFKITGDNLNRLNKPS--VAFRCETFLSIYENCFV-NNSDIDCISPTT---SNITQFQKCSLL---FAME-----KGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNII-EVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLD---NMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLR--HEKENIFTEKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXX-----------XNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSN----------WSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHL-KPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQN---KDVWLTQ-LFSDVIKLYSPKVLNYYEGIK 5725
            +T+  +G +DG L K  +   +    Y     +L + I+ +M  +     IY ++ +K+ +  + +C +   C DCL    P+CGWC    KC  +  C         W+ +   +T K   + +V+P H +   + ++  +I       L  L EN   L C FT+ +     N         + ++C  P    +P I + K+    KL V   N   LV   +  ++C+   +C  CV+++F C WCV  + C   +   C+ +  +           + P  CPT+  + +     V    S  +  K +    F  +T FVC    +   T++ +    + + C + +     +  ++  +  V W       GS   + P  I   ++ C ++++ C  C+ L + Y CG+C+  + C  +  C  +    + W+N + + CP P I    P        + I ++G NLG   ND+ + + +        C    Q YI +KQ  C + +  +++      +   +  D    SKE ++F  P++    P FGP  GGT I + G  LN GSR +   N               +++ C++   +    + R   S    +  L+++ D    +F D  F++  +P V+ +S          K +  GG    +TG     +  P+  V +  E + S    C V ++++++C SP     S++ + ++  LL   F M+     +    V+N    ++  P   I   ++       +  K + +TIN    D+    A  +SD ++ +G   C   S     + C    E       +  ++ + +G ++    G + +E  +I LD   N+   +I  I+++++  + L+V    K  +S + LR   E+ +I   ++  E  E      AEL                P   Y  Y +  LFPN    +  +                     +  P ++ K+  +        R   +L  ++ F+L+F   LE ++    + + ++ S + + L   L   T ILK L+ +  +K  +  +  +  + R   +  K+LS WF  L+Y  L+   AG  L +L+  +   ++ GPV+  T +++Y+L+E  L+ + I+F+ + +                   +   + V+VLDCD I Q K K  E IY+  P S           W +  +  +I  ++D   ++E               L TL+ Y++ DG  + +  K  S+      + S L   +      ++ NISK    TS  P  S+      L++ +HEN  +   +   + + +   K+G  + K    IY T++L +K  G ++   DD+F+          ++PL +  +F   ++  +     D  +V   KSNSL LRFW+ LI N +F+FD+   K   V  CL  V++  MD CS + +   KD   ++ L++  I  Y   V  YY  I+
Sbjct:   17 YTVVFVGTSDGFLKKVVIESSSIANEYASFAVDLGSEINRDMQFDNQNLYIYVMSKTKVSKVKVFDCSDYKTCGDCLGARDPYCGWCSLENKCSPRSNCQDDANDPLYWVSY---KTGKCTTITSVVP-HQLQRTTARTLELIID----HLPQLKEN---LICAFTTEDKALFTNATKK----RNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRTRNGPDLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSRIGPSYRSGPGFCPTINATGDGSEVLVAGGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRVTSLNAQLLGDTIYCDSMEFQYTSRSPNLTATFAVIW------GGSKPLDNPHNIHVVIYRCREMADSCGICLALSEKYNCGWCSSTNTCEVEEQCNKNKEGKTDWLN-RSEICPNPEIHTFQPKTGPWEGGTNITIRGINLGKNYNDIYSGVRIAG----INCMPFPQFYIDTKQIVCTVDSPGEQMYR--NGKIVVQIGDYRGESKEDYEFVDPKILDFNPKFGPTSGGTEIHITGKHLNAGSRIQASIN---------------DHLPCKILSTDSSQAICRTSASPGIIEGRLKMSFDNGPREFNDYNFKYVLDPTVEHVSSGPSGQIKVPKGIPAGGIRISVTGTQFTSIQNPNIYVVYNGEMYAS---PCRVQSDTEMECASPVVDVDSHVIEAERPILLEYGFLMDNVLRVQNLSKVHNNHFELYPNPEYFIFEERV-------KYFKSEYLTINGRNLDR----ACKESDVEVKIGNGFCNITSLSRQQLTCRPPSEATATKSMNGPEVIVRIGTSLEYRIGILSYESSNIILDWGENVIFAVIATIVILLLIFVALLVAYKKKSSESSRVLRNMQEQMDILELRVAAECKEAF----AELQTEMTDLTGDLTSGGIPFLDYRSYAMKILFPNHEDHIVLQ---------------------WERPELLRKEKGL--------RIFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQSKLEYCTDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKEC-AGEPLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQSIDFRPMNVYASIIQQPIFCNNLDMLPSHTENVSVKVLDCDTIGQVKEKCLETIYRNIPSSQRPRKDDLDLEWRTGATGRVILYDEDVTSKTESEWK----------KLNTLQHYNVPDGAGLSLVPKQSSI-----YNFSILSDKNEKSHKYETLNISK---YTSSSPTFSR--AGSPLNNDMHENGLRYWHLVKHHDSDMQ--KEGERVNKLVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDDQAQLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIH--KSNIVDSCLSVVAQTFMDSCSTSDHRLGKDSPSSKLLYAKDIPEYRKWVDRYYRDIR 1431          
BLAST of plexin A vs. Ensembl Fly
Match: PlexB (gene:FBgn0025740 transcript:FBtr0308297)

HSP 1 Score: 180.259 bits (456), Expect = 8.963e-45
Identity = 259/1167 (22.19%), Postives = 452/1167 (38.73%), Query Frame = 2
Query:  197 HKSILVSGKNYILQFSENNLKEPLAIRKTGPVNHSVMCTEPNQCQTSLCPKELISRDQCRIKLTDVFVKLWTFA---DSYLVVCYDVFQGFCEIIDLYNQFSSSYKNKAYSIVTNDRKFHSTVLYHDQR--------LFFANEVYHPSNYREIDFNTMSILSFPNMTYFKPDYPFQANFGKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCD-IDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKS---TDKRCMEDGFTSTGKGECGGKNFNKFIIGDHY-GENSIIGHRVIS-RNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDT--NYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRV-SPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSE------------NDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSH--LVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSA---SNRLVCTFQM--MKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEH-----CDDCVHLPQIYKCGFCTVKDKCVQKHICGNDD---SKWINSKFQ-KCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITL-----ENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSI--------QFTDVQFEFFP-----------NPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSD-IDCISP 3478
            H  +     N IL+ +EN     LA   TGP++ S       QC    CP+++         L + F K+   +   D  L+ C  + QG CEI  L  +F ++ +  A  +  ND    +       R        L+      +  +YR  D   +S     ++ Y   ++  Q +   +  +  +  F ++++  F+  +         Y +F++ Q +  H      +  RL RIC  D +Y S+ +I + C   +N   Y  V    V   S  +A            K  +  D H +L   F      +N  E+ ++   C Y I +I +++  + N+ L  +G+  +    + S    D RC   G          G  +N   +G    G + I  H +    N          +  ++ +LA +G N G++ K  L   +   Y     +  N I  N +++  K  +Y ++  KI +  + +C   TNC  CL    PFCGWC    +C V+  C           R   A   +++      +E+ +  P       K P+S LS             N K+ +C F ++   +         I  + L C  P     P I  N + + + L V  ++++   V   +  ++C+H   C  C+ + + C+WC+ DN C+  SL +C+      +    CP L+ +   +   V  PI I L  +N     ++   F+C  T     A   L A   SN++V   +      +     +  + V+W   + +  +I T       ++ C  L  H     C  CV     YKC +C+  + CV    C  D    S    S  + +CPLP I  I P +  +   ++I ++G NLG  E DV+  I +     E  ++Q   K   ++  S  +    I+  ND   T  + QF FK              +  +  + P  GP  GGT + + G FLNIGS      +     I  ++ +   + +SC  ++    + +       +    +L+  I   SI         F   Q    P           +P + +I   +   +GG++  + G  LN + KP +    +       +C V NS+ ++C SP
Sbjct:   96 HNVLFAGATNKILKLNEN--LRVLAEAVTGPLHDS------PQCHAGGCPEDI------ETSLVNNFNKILVVSYAHDGILIACGSIRQGACEIYSL-PRFPATPQFFAVPLAANDENASTYAFVGPARYAWKEEDILYVGTTFTNVGDYRH-DVPAISSRRLDDLNY--AEFSIQQSIINIDVKYRDH-FLVDYIYGFNSSE---------YAYFIIVQ-KKSHLADEAGYVTRLARICITDPNYDSYTEITVQCTATENNVDYNIVRDAKVTPASHKLAQ-----------KMGIKKDDH-VLVTVFSPSREISNQPESKSAM--CIYSIKDIEDMF--IENIHLCFNGTTKDRNLGYISGTINDGRCPIVGSL--------GNIYNFCSVGLKISGVSPITAHALFHFDNVSVTSVTATSTTDQQHSLAFLGTNMGVIKKVLLSGQSPGEYEEIVVDAGNRILPNTMMSPKKDFLYVLSQRKITKLRIEHCSVYTNCSACLESRDPFCGWCSLEKRCTVRSTC----------QRDTSASRWLSLGSGQQCIEFESIIP------EKIPISELSHLHLIIRTLPEPFNAKY-RCVFGNSTPIDAE-------ILENGLGCATPPLDERPLIPTNTDHILVPLSVRSSETNKDFVSRNFAFFDCSHHGNCQECLQSSWGCNWCIFDNKCVHKSL-QCRNIENAVSTVGHCPHLKKNRPEILLPVRVPIEIRLEIENLPKPKSAHAGFLC--TIHIEAAQMLLPAHVESNKIVVCEKTPYFYEINTHEYQAKVVVTWNFQHYVDTAIVT-------LYKCDVLGSHREHPDCSLCVTRDPKYKCAWCS--NSCVYNETCIADKNSISSGSKSAIENECPLPRIDIIKPLSGPVEGGTLITIEGSNLGIREEDVRGKIFIGSVPCELENYQISVKIECRTGASLYEMSAPIKVANDAGFTESSVQFHFK--------------NVLLTGLYPTIGPRSGGTQLSLIGKFLNIGSTMRAFLDEYECHI--DVTQASSSQVSCTTSEATQPEPIRSLHLVIDGANRTLECQISTPSITNTNPTRSNFGSYQLRSLPRQPCSIFNYTQDPRIMQIKPLRSFKSGGRVLTVHGIYLNSIQKPELEVFYDNERVNKTSCVVINSNQMECPSP 1157          

HSP 2 Score: 95.5153 bits (236), Expect = 4.507e-19
Identity = 210/937 (22.41%), Postives = 393/937 (41.94%), Query Frame = 2
Query: 2990 PRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFK----RSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPTTSNITQFQKCSLLFAMEKGSVCVYNTSI---TIFSTPVLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRC-----NIIEVNQIDIYHKYQISLLM---GKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEAN--EVLKRGIAELNQAAIQDEIHKNWNTA-PIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKL---SKLFEDELFVLMFFSFLEDHQEVES--KKSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMFRQSD-LLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYS----------NWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGY-TLKTLKDYDIKDGDNICVAMK---NESLPASNTASVSHLES----NSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDY-----ESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            PR+  I+P      GG ++ V+G +LN   + E++  Y    +      N+ + +    N  E     + +K    + +N +K   +L++  +S Q T+ +++   N + +K  +  F           GD           FR  T      N FVNN ++D  +    + TQ     L F M+   + V N +     I ST V   +P  +  P + +++ K   + I  E+ +     A  + D  + +G   C   S   N + C       +  ++  +     + L++   G+N+  V GY++++     + + ++++ I  + +++ + ++V++I  +K    +R   E + I  + I  E+N     K+  AEL Q  + D      +T  P   ++ YI+   FP                                HP++ + + +       Y   +    +L  ++ F+LMF   LE  +   S   + ++ S + ++LM  +   T ILK L+    DK   ++  + M R+++ ++ K+L+N+  I MYD+L+   AG +L +L+  I + I  G V+  T+ ++Y+L+E  LL  ++    + L +  +    D ++   V D D ISQ KLKI + I+K +P+S           W       L   ++D           +  K V G+  L TL  Y +K+   + +  +   N  +P S   + +   +    N++      + +I   +        +   IP H ++    +NS             ++   D  +     +  T++L +K  G I+   DD F       E +P  V  LF   +   +     D  IV A KSN L LRFW+  I N DF+FDV   K   V  CL  +++  MD CS ++++
Sbjct: 1097 PRIMQIKPLRSFKSGGRVLTVHGIYLNSIQKPELEVFYDNERV------NKTSCVVINSNQMECPSPPVNYKFETFKKTN-RKMDTELHLQNSSFQ-TETRYK---NEYDRKKRRADF-----------GD----------TFRLYTNAGSSANYFVNN-NMDVTTFVKVHETQLN-LQLSFVMDNVQL-VRNLNKYFHDIRSTIVYLADPKYLPFPNDGVKLYKGDSLVIEGELLNL----AADEYDVNVTIGTSQCNITSLALNQLLCIPPEQQPLPTDENGVDQSTDLPLVVVKVGRNLRFVIGYLKYDLNKPYVFSHALLVGILTVALLVVVFVIVLIIFRRKSTQAER---EYKRIQIQMITLESNVRSECKQAFAEL-QTDMTDLTADLESTGIPTLDHVNYIMKVFFPGVS----------------------------DHPILNSPKFREGSPQTNYDAAMVQFEQLIGNKYFLLMFIETLEAQRSSFSIRDRVNVASLIMVVLMNKMEYATEILKSLLLRLIDKSLASKHPQLMLRRTESVVEKMLTNYLAICMYDYLKEY-AGSNLFLLFKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHILQDDL--DEKVQCRVNDWDTISQVKLKILDAIFKNTPFSMRPSVNEVDLEWRHGRGGHLTLQDED-----------LTTKTVNGWKRLNTLAHYGVKESAVMSLIARQNDNYHIPYSKNQNSAPYHNFYFINNSQSHIIINNDIESGLQQPRVYHLVKPNIPDHYMNI---KNSVLSGGSPAFQSHVVNNCNDRVNKTIPEVYLTRLLATK--GTIQKFVDDFFSIILTVNEELPPAVKWLFDLLDEAARRHDIADTDIVHAWKSNCLPLRFWVNFIKNPDFIFDVN--KTYSVDSCLSVIAQTFMDACSTSEHR 1941          
BLAST of plexin A vs. Ensembl Zebrafish
Match: plxna1a (plexin A1a [Source:ZFIN;Acc:ZDB-GENE-140106-137])

HSP 1 Score: 268.855 bits (686), Expect = 7.986e-72
Identity = 332/1486 (22.34%), Postives = 625/1486 (42.06%), Query Frame = 2
Query: 1394 GYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDTNYLFSTENLF----NNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAEN---KNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNS----TAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETP--IEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKF--QKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNIND-RIETPVAFQFKFKTKD-----KYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFV-NNSDIDCISPTTSNI------TQFQKCSLLFAMEK-GSVCVYNTSITIFSTPVLR-INPNKI--SLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTV-SGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQ--AAIQDEIHK-----NWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNIC-VAMKNESLPASNTASVSH-LESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            G + +    Y   T+A  G   G + K  +   T      EN+     + I  +M+ + +   IY +AD ++ R  + +C   ++C +CL    P CGWC+ +  C  KD+C  A   P +    ++ C  + V P++  +  S     ++ Q    P      N     C F      +    + H  I    + C+ P  + I PI  N   K  V L LK            +  YNC+  ++C  CVN  F C WC   + C  ++   C       N   +CP +  S + +   VG    I L+ +N     + + ++ C+          TA+   S S +   T    +    + +   + V W       G    + P  I+  ++ C  + + C  C+     + CG+C  + KC  +  C   +S W+N      +C  P I ++ P        + + + G NLG    D+   + L     +  C  IE+ Y+S+++  C + +    R++     Q +   +D     + L  + F F +P    ++P  GP  GGT I + G+ LN GS   V  N G  P              C       K+ +       N     + ++ID+  ++  +V+F +  +P V KI  +  +++GG +  I+G NL  + +P +  +  +  S + NC V NNS + C++P+ ++       T      + F M+   ++ V N S + +  P+   ++P  I    PT+ L I+K + +      N ++        ++ +F+G   C             ++ +++  +  ++    L G++ +T+ +G  ++  G + + + S++ +  I+ +     +L++VII   +  K++ R     +  +++  + + +  R   E  +  A +Q +IH+     +    P   Y  Y +  LFP                                HP++   +++V  N  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  DK  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  +   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+ L+CD I+Q K K+ + +YK SPYS           K    ++   +  LA I L++    T        L +L  Y + DG  I  V  +N +   SN+++ +  L    + L+T  S + +    PM +  PD+     +  L  + H+++ Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct:  431 GMTSVAAYDYRGQTVAFTGTRSGRMKKILVNSITQPALLYENVVVSEGSPILRDMLFSPDHQYIYTLADKEVKRVPVESCSQYSSCGECLASGDPHCGWCVLHSVCSRKDRCERADE-PQRFASRLEQCVRLTVQPNNISVTMSEVQ--LVLQAQNVPSLAAGVN-----CSF-----EDFTETEGH--IMGGRIYCLSPSTREISPITRNQGDKRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHMCTHNA-NDCSFQEGRVNMSEECPQILPSTQ-IYIPVGVMKPITLLARNLPQPQSGQRNYECIFYIQGKEYSVTALRFNSTSIQCQKTMYDYEGNDISDLPVDLSVVW------NGDFVIDNPYNIQAHLYKCFAMRDSCGMCLKADPRFDCGWCVQEKKCSLRQECAPPESSWMNPSAGNSRCAHPKINKLFPETGPRQGGTRLTITGENLGLQFRDIMTGVRLG----KVPCIPIEEEYVSAERIVCLLNDATGYRVQEA---QVEVCVRDCVADYRALSPRAFTFVTPYFARVQPAQGPLSGGTRITIEGNHLNAGS--SVAVNIGRHP--------------CHFKKRSSKEIVCVTPAGVNAVSTPVMVDIDSAELRNPEVKFNYTDDPTVLKIDPDWSIASGGTLLTISGTNLATIKEPKIRAKYGSAES-FHNCTVFNNSVMVCLAPSVADSERGFAETGSGPDEIGFYMDNVHALVVVNESFSYYPDPIFEPLSPTGILELKPTSPL-ILKGRNLIPAAPGNSRL--------NYTVFIGETPC-------------VLTLSETQLLCEW--PNLTGQHKVTIRAGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLVIIAVLIAYKRKSRDADRTL--KRLQLQMDNLESRVALECKEAFAELQTDIHELTQELDGAGIPFLDYRTYAMRVLFPGIE----------------------------DHPVLKEMEVRVQANVEKALTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAMKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVNPENENGPEVTVKCLNCDTITQVKEKLLDAVYKGSPYSQRP--------KAGDMDLEWRQGRLARIILQDEDVTTKIDNDWKRLNSLAHYQVTDGSVIALVPKQNSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMIT--PDLESGTKLWHLVKN-HDHADQREGDRGS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQITDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDI--HKNSITDACLSVVAQTFMDSCSTSEHK 1785          
BLAST of plexin A vs. Ensembl Zebrafish
Match: plxna2 (plexin A2 [Source:ZFIN;Acc:ZDB-GENE-090311-6])

HSP 1 Score: 206.068 bits (523), Expect = 1.359e-52
Identity = 251/1141 (22.00%), Postives = 448/1141 (39.26%), Query Frame = 2
Query:  188 NKSHKSILVSGKNYILQFSENNLKEPLAIRKTGPVNHSVMCTEPNQCQTSLCPKELISRDQCRIKLTDVFVKLWTFADSYLVVCYDVFQGFCEII---DLYNQFSSSYKNKAYSIVTNDRKFHSTVLY----HDQRLFFANEVYHPSNYREIDFNTMSILSFPN--MTYFKPDYPFQANF-GKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHE------PKNGLFQV-RLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRC------MEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDTNYLFSTENL-----FNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNF--VDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCL----ETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDD---SKWIN--SKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNIN-DRIETPVAFQF-KFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDV-QFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPT 3481
            +K+  ++ +   N + + S N     L    TGP + +  C  P   Q   C + LIS +     L      L  ++ + L+ C  ++QG C+++   DL+     S+K + Y    N       V+      D  LF    V    +Y    F T+S    P    +    DY    +F   L+    +T+  +     ++IY         N+++FL  QPE          P N LF   R+VR+C  D  + S++ + + C + N+  Y  + +  +       A         + +      D   +LF  F        Y    +    C + I +I          C  G G++  N       D  C      ++D F         G + N+ + G       + GH + + +  +  S+  + +Y  F +A +G   G L K  +          E L      N+I  +M  + + S IY +++ ++ R  + +C   + C +CL    P CGWC+ +  C  +D+C  A   P++   T+  C    V P       +   P+V   V  T +  LS     + C F   N  E+        ++ + + CI P  K++P I  ++++  V+L+L        L+      YNC+  + C  CV + F C WC   N C       C       N   DCP L  S E L    G    I L  +N     + +  + C+          TA+   S+S +   +  + + ++ + +     V W  GN +   I+    I+  ++ C    + C  C+   + ++CG+C+++ +C  +  C   +   S+W++  S   KC  P I E+ P        + + ++G NLG   +D+ N + +        C   E  YI ++Q  C++     D    PV     + K + +   S+ + F  P V  + P+ GP  GGT + + G  L  GS   V F   T    C   E     I C             +   S     S+Q+++  +  Q  D+  FE+  +P V++I     +++G     +TG NL+ + +P +  +     S+     +N + + C +P+
Sbjct:   59 HKTTGALYIGAVNRVYKLSGNLTL--LVSHDTGPEDDNKACYPPLIVQP--CSEPLISTNNINKLL------LIDYSQNRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNQTGTMYGVIVPSQGKDGTLFIGTAVDGKQDY----FPTISSRKLPRDPESSAMLDYELHTDFVSSLIKIPSDTLALVSHFDIYYIYGFASG----NFVYFLTVQPETPENSMSSSGPSNDLFYTSRIVRLCKDDHKFHSYVSLPIGC-VRNRVEYRLLQAAYLGKPGRVFA---------ASLNISAQDD---VLFAVFS--KGQKQYHHPPDDSALCVFSIRDINARIKERMQSCYQGEGNLELN--WLLGKDVPCTKAPVPIDDSFC--------GLDINQPLGGSQL----VTGHTLYTESRDRMTSVTSY-VYNGFCVAFVGTKSGRLKKIRVDGPPQGGVQYETLSVIKDGNSILRDMAFSLDNSYIYVMSERQVTRVPIESCEQYSTCGECLSSGDPHCGWCVLHNICSQRDRCERANE-PYRFAATLNQCVKATVYPD----SIAVSEPSVPLLVKVTDVPDLSAG---ITCSF--GNLTEVEG-----RVNGNQILCISPAAKDVPIIPADQDWSGVELRLNSKETGQMLISTEVKFYNCSVHQLCLSCVTSSFRCHWCKYRNLCTHDP-SSCSFQEGRVNASEDCPQLVRSEEIL-IPAGEVKPITLKARNLPQPQSGQRGYECVLHIQGVSHRVTALRFNSSSVQCQNSSYLYEGMRISELPVDFSVVWN-GNFI---IDNPENIKVHLYKCGAQRDSCGVCLKAERKFQCGWCSMEGRCTLRQHCPMTNPYTSRWLHLASTNVKCTNPRITEVTPVAGPPEGGTRVTIRGVNLGLSFSDMVNNVQVAGVQ----CTPQENGYIIAEQIVCEMDAAPVDSKAGPVHLCVGECKPELQTRSSQLYSFVMPSVTGLSPSRGPESGGTKVTIMGENLGAGSSVTVLFGNQT----CEFYERTMTEIVC-------------YSAPSLTGVGSVQISVSVDRAQVRDILAFEYIDDPTVQRIEPEWSIASGHTPLVVTGTNLDVIQEPRIRIKYGGRESVNVCKVLNTTTMSCFAPS 1109          

HSP 2 Score: 105.531 bits (262), Expect = 6.341e-22
Identity = 122/486 (25.10%), Postives = 226/486 (46.50%), Query Frame = 2
Query: 4277 HPLIVNKQIQVIENT---VEYSRKL-SKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNICVAMKNES---LPASNTASVSHLESNSASLK-TNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSK------IKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            HP++  ++++V  N    VE + KL ++L  +++F+L F   LE  +    + + ++ S +   L   L   T +LK L+ +  DK  +  N  +  + R   +  K+L+NWF  L++  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+VL+CD I+Q K KI + +YK  PYS           K    ++   +  +A + L++    T        L TL  Y + D   + +  K  S   +P + + S + +    ++ + T    ++    PM +  PD+   + +  L  + HE+  QK        +   Y T++ A K               L+  ++   + LF  +    ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K +    CL  V++  MD CS ++++
Sbjct: 1340 HPVL--RELEVSGNGQLCVEKALKLFAQLINNKVFLLTFIRTLEMQRSFSMRDRGNVASLIMTALQGRLEYATDVLKHLLSDLIDKNLESKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLILNCVNPENENSPEIPVKVLNCDTITQVKEKILDAVYKNMPYSQRP--------KAVDMDLEWRQGRMARVVLQDEDITTKIENDWKRLNTLMHYQVSDRCVVALVPKQTSSYNIPPTTSISRTSISRYDSTFRYTGSPDSLRSRAPMIT--PDLESGVKVWHLVKN-HEHGDQKEGDRGSKMVSEIYLTRLLATKG-------------TLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADKHGIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KSSITDACLSVVAQTFMDSCSTSEHR 1796          
BLAST of plexin A vs. Ensembl Zebrafish
Match: plxna2 (plexin A2 [Source:ZFIN;Acc:ZDB-GENE-090311-6])

HSP 1 Score: 206.068 bits (523), Expect = 1.359e-52
Identity = 251/1141 (22.00%), Postives = 448/1141 (39.26%), Query Frame = 2
Query:  188 NKSHKSILVSGKNYILQFSENNLKEPLAIRKTGPVNHSVMCTEPNQCQTSLCPKELISRDQCRIKLTDVFVKLWTFADSYLVVCYDVFQGFCEII---DLYNQFSSSYKNKAYSIVTNDRKFHSTVLY----HDQRLFFANEVYHPSNYREIDFNTMSILSFPN--MTYFKPDYPFQANF-GKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHE------PKNGLFQV-RLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRC------MEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDTNYLFSTENL-----FNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNF--VDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCL----ETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDD---SKWIN--SKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNIN-DRIETPVAFQF-KFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDV-QFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPT 3481
            +K+  ++ +   N + + S N     L    TGP + +  C  P   Q   C + LIS +     L      L  ++ + L+ C  ++QG C+++   DL+     S+K + Y    N       V+      D  LF    V    +Y    F T+S    P    +    DY    +F   L+    +T+  +     ++IY         N+++FL  QPE          P N LF   R+VR+C  D  + S++ + + C + N+  Y  + +  +       A         + +      D   +LF  F        Y    +    C + I +I          C  G G++  N       D  C      ++D F         G + N+ + G       + GH + + +  +  S+  + +Y  F +A +G   G L K  +          E L      N+I  +M  + + S IY +++ ++ R  + +C   + C +CL    P CGWC+ +  C  +D+C  A   P++   T+  C    V P       +   P+V   V  T +  LS     + C F   N  E+        ++ + + CI P  K++P I  ++++  V+L+L        L+      YNC+  + C  CV + F C WC   N C       C       N   DCP L  S E L    G    I L  +N     + +  + C+          TA+   S+S +   +  + + ++ + +     V W  GN +   I+    I+  ++ C    + C  C+   + ++CG+C+++ +C  +  C   +   S+W++  S   KC  P I E+ P        + + ++G NLG   +D+ N + +        C   E  YI ++Q  C++     D    PV     + K + +   S+ + F  P V  + P+ GP  GGT + + G  L  GS   V F   T    C   E     I C             +   S     S+Q+++  +  Q  D+  FE+  +P V++I     +++G     +TG NL+ + +P +  +     S+     +N + + C +P+
Sbjct:   59 HKTTGALYIGAVNRVYKLSGNLTL--LVSHDTGPEDDNKACYPPLIVQP--CSEPLISTNNINKLL------LIDYSQNRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNQTGTMYGVIVPSQGKDGTLFIGTAVDGKQDY----FPTISSRKLPRDPESSAMLDYELHTDFVSSLIKIPSDTLALVSHFDIYYIYGFASG----NFVYFLTVQPETPENSMSSSGPSNDLFYTSRIVRLCKDDHKFHSYVSLPIGC-VRNRVEYRLLQAAYLGKPGRVFA---------ASLNISAQDD---VLFAVFS--KGQKQYHHPPDDSALCVFSIRDINARIKERMQSCYQGEGNLELN--WLLGKDVPCTKAPVPIDDSFC--------GLDINQPLGGSQL----VTGHTLYTESRDRMTSVTSY-VYNGFCVAFVGTKSGRLKKIRVDGPPQGGVQYETLSVIKDGNSILRDMAFSLDNSYIYVMSERQVTRVPIESCEQYSTCGECLSSGDPHCGWCVLHNICSQRDRCERANE-PYRFAATLNQCVKATVYPD----SIAVSEPSVPLLVKVTDVPDLSAG---ITCSF--GNLTEVEG-----RVNGNQILCISPAAKDVPIIPADQDWSGVELRLNSKETGQMLISTEVKFYNCSVHQLCLSCVTSSFRCHWCKYRNLCTHDP-SSCSFQEGRVNASEDCPQLVRSEEIL-IPAGEVKPITLKARNLPQPQSGQRGYECVLHIQGVSHRVTALRFNSSSVQCQNSSYLYEGMRISELPVDFSVVWN-GNFI---IDNPENIKVHLYKCGAQRDSCGVCLKAERKFQCGWCSMEGRCTLRQHCPMTNPYTSRWLHLASTNVKCTNPRITEVTPVAGPPEGGTRVTIRGVNLGLSFSDMVNNVQVAGVQ----CTPQENGYIIAEQIVCEMDAAPVDSKAGPVHLCVGECKPELQTRSSQLYSFVMPSVTGLSPSRGPESGGTKVTIMGENLGAGSSVTVLFGNQT----CEFYERTMTEIVC-------------YSAPSLTGVGSVQISVSVDRAQVRDILAFEYIDDPTVQRIEPEWSIASGHTPLVVTGTNLDVIQEPRIRIKYGGRESVNVCKVLNTTTMSCFAPS 1109          

HSP 2 Score: 105.531 bits (262), Expect = 6.341e-22
Identity = 122/486 (25.10%), Postives = 226/486 (46.50%), Query Frame = 2
Query: 4277 HPLIVNKQIQVIENT---VEYSRKL-SKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNICVAMKNES---LPASNTASVSHLESNSASLK-TNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSK------IKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            HP++  ++++V  N    VE + KL ++L  +++F+L F   LE  +    + + ++ S +   L   L   T +LK L+ +  DK  +  N  +  + R   +  K+L+NWF  L++  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+VL+CD I+Q K KI + +YK  PYS           K    ++   +  +A + L++    T        L TL  Y + D   + +  K  S   +P + + S + +    ++ + T    ++    PM +  PD+   + +  L  + HE+  QK        +   Y T++ A K               L+  ++   + LF  +    ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K +    CL  V++  MD CS ++++
Sbjct: 1340 HPVL--RELEVSGNGQLCVEKALKLFAQLINNKVFLLTFIRTLEMQRSFSMRDRGNVASLIMTALQGRLEYATDVLKHLLSDLIDKNLESKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLILNCVNPENENSPEIPVKVLNCDTITQVKEKILDAVYKNMPYSQRP--------KAVDMDLEWRQGRMARVVLQDEDITTKIENDWKRLNTLMHYQVSDRCVVALVPKQTSSYNIPPTTSISRTSISRYDSTFRYTGSPDSLRSRAPMIT--PDLESGVKVWHLVKN-HEHGDQKEGDRGSKMVSEIYLTRLLATKG-------------TLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADKHGIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KSSITDACLSVVAQTFMDSCSTSEHR 1796          
BLAST of plexin A vs. Ensembl Zebrafish
Match: plxna2 (plexin A2 [Source:ZFIN;Acc:ZDB-GENE-090311-6])

HSP 1 Score: 205.682 bits (522), Expect = 1.776e-52
Identity = 251/1141 (22.00%), Postives = 450/1141 (39.44%), Query Frame = 2
Query:  188 NKSHKSILVSGKNYILQFSENNLKEPLAIRKTGPVNHSVMCTEPNQCQTSLCPKELISRDQCRIKLTDVFVKLWTFADSYLVVCYDVFQGFCEII---DLYNQFSSSYKNKAY-SIVTNDRKFHSTVL---YHDQRLFFANEVYHPSNYREIDFNTMSILSFPN--MTYFKPDYPFQANF-GKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHE------PKNGLFQV-RLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRC------MEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDTNYLFSTENL-----FNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNF--VDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCL----ETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDD---SKWIN--SKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNIN-DRIETPVAFQF-KFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDV-QFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPT 3481
            +K+  ++ +   N + + S N     L    TGP + +  C  P   Q   C + LIS +     L      L  ++ + L+ C  ++QG C+++   DL+     S+K + Y S V      +  ++     D  LF    V    +Y    F T+S    P    +    DY    +F   L+    +T+  +     ++IY         N+++FL  QPE          P N LF   R+VR+C  D  + S++ + + C + N+  Y  + +  +       A         + +      D   +LF  F        Y    +    C + I +I          C  G G++  N       D  C      ++D F         G + N+ + G       + GH + + +  +  S+  + +Y  F +A +G   G L K  +          E L      N+I  +M  + + S IY +++ ++ R  + +C   + C +CL    P CGWC+ +  C  +D+C  A   P++   T+  C    V P       +   P+V   V  T +  LS     + C F   N  E+        ++ + + CI P  K++P I  ++++  V+L+L        L+      YNC+  + C  CV + F C WC   N C       C       N   DCP L  S E L    G    I L  +N     + +  + C+          TA+   S+S +   +  + + ++ + +     V W  GN +   I+    I+  ++ C    + C  C+   + ++CG+C+++ +C  +  C   +   S+W++  S   KC  P I E+ P        + + ++G NLG   +D+ N + +        C   E  YI ++Q  C++     D    PV     + K + +   S+ + F  P V  + P+ GP  GGT + + G  L  GS   V F   T    C   E     I C             +   S     S+Q+++  +  Q  D+  FE+  +P V++I     +++G     +TG NL+ + +P +  +     S+     +N + + C +P+
Sbjct:    7 HKTTGALYIGAVNRVYKLSGNLTL--LVSHDTGPEDDNKACYPPLIVQP--CSEPLISTNNINKLL------LIDYSQNRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNQTGTMYGVIVPSQGKDGTLFIGTAVDGKQDY----FPTISSRKLPRDPESSAMLDYELHTDFVSSLIKIPSDTLALVSHFDIYYIYGFASG----NFVYFLTVQPETPENSMSSSGPSNDLFYTSRIVRLCKDDHKFHSYVSLPIGC-VRNRVEYRLLQAAYLGKPGRVFA---------ASLNISAQDD---VLFAVFS--KGQKQYHHPPDDSALCVFSIRDINARIKERMQSCYQGEGNLELN--WLLGKDVPCTKAPVPIDDSFC--------GLDINQPLGGSQL----VTGHTLYTESRDRMTSVTSY-VYNGFCVAFVGTKSGRLKKIRVDGPPQGGVQYETLSVIKDGNSILRDMAFSLDNSYIYVMSERQVTRVPIESCEQYSTCGECLSSGDPHCGWCVLHNICSQRDRCERANE-PYRFAATLNQCVKATVYPD----SIAVSEPSVPLLVKVTDVPDLSAG---ITCSF--GNLTEVEG-----RVNGNQILCISPAAKDVPIIPADQDWSGVELRLNSKETGQMLISTEVKFYNCSVHQLCLSCVTSSFRCHWCKYRNLCTHDP-SSCSFQEGRVNASEDCPQLVRSEEIL-IPAGEVKPITLKARNLPQPQSGQRGYECVLHIQGVSHRVTALRFNSSSVQCQNSSYLYEGMRISELPVDFSVVWN-GNFI---IDNPENIKVHLYKCGAQRDSCGVCLKAERKFQCGWCSMEGRCTLRQHCPMTNPYTSRWLHLASTNVKCTNPRITEVTPVAGPPEGGTRVTIRGVNLGLSFSDMVNNVQVAGVQ----CTPQENGYIIAEQIVCEMDAAPVDSKAGPVHLCVGECKPELQTRSSQLYSFVMPSVTGLSPSRGPESGGTKVTIMGENLGAGSSVTVLFGNQT----CEFYERTMTEIVC-------------YSAPSLTGVGSVQISVSVDRAQVRDILAFEYIDDPTVQRIEPEWSIASGHTPLVVTGTNLDVIQEPRIRIKYGGRESVNVCKVLNTTTMSCFAPS 1057          

HSP 2 Score: 105.145 bits (261), Expect = 8.090e-22
Identity = 122/486 (25.10%), Postives = 226/486 (46.50%), Query Frame = 2
Query: 4277 HPLIVNKQIQVIENT---VEYSRKL-SKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNICVAMKNES---LPASNTASVSHLESNSASLK-TNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSK------IKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            HP++  ++++V  N    VE + KL ++L  +++F+L F   LE  +    + + ++ S +   L   L   T +LK L+ +  DK  +  N  +  + R   +  K+L+NWF  L++  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+VL+CD I+Q K KI + +YK  PYS           K    ++   +  +A + L++    T        L TL  Y + D   + +  K  S   +P + + S + +    ++ + T    ++    PM +  PD+   + +  L  + HE+  QK        +   Y T++ A K               L+  ++   + LF  +    ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K +    CL  V++  MD CS ++++
Sbjct: 1288 HPVL--RELEVSGNGQLCVEKALKLFAQLINNKVFLLTFIRTLEMQRSFSMRDRGNVASLIMTALQGRLEYATDVLKHLLSDLIDKNLESKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLILNCVNPENENSPEIPVKVLNCDTITQVKEKILDAVYKNMPYSQRP--------KAVDMDLEWRQGRMARVVLQDEDITTKIENDWKRLNTLMHYQVSDRCVVALVPKQTSSYNIPPTTSISRTSISRYDSTFRYTGSPDSLRSRAPMIT--PDLESGVKVWHLVKN-HEHGDQKEGDRGSKMVSEIYLTRLLATKG-------------TLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADKHGIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KSSITDACLSVVAQTFMDSCSTSEHR 1744          
BLAST of plexin A vs. Ensembl Zebrafish
Match: plxnb2b (plexin b2b [Source:ZFIN;Acc:ZDB-GENE-080902-1])

HSP 1 Score: 201.06 bits (510), Expect = 5.143e-51
Identity = 236/1087 (21.71%), Postives = 444/1087 (40.85%), Query Frame = 2
Query:  269 AIRKTGPVNHSVMCTEP-NQCQTSLCPKELISRDQCRIKLTDVFVKLWTF--ADSYLVVCYDVFQGFCEIIDLYN-----QFSSSYKNKAYSIVTNDRKFHSTVLYHDQRLFFANEVYH----PSNYREIDFNTMSILSFPNMTYFKPDYPFQANFGKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVN-----ENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFE-----DTNYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTA------MWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDS-HLVEGIYHIYNCAHS------RTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNY----FNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDF---EVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSV 3400
            A  +TGP   +  CT P + CQ               +K T+   KL     A+  L+VC  +++G C +++L N      +S S   + Y+  T D   + +V+     L   N+ +        Y  +D  +  ++S    T    +Y     F  ++     T+  + FV  + ++D R      N+++FL ++   + + KN  F   + R+C  D+ Y S+ ++ ++C ++N+  Y +V +  +++   ++A    +   +  +K E D           K++ V  +  E       C YP+  I +    +   C   +G ++     E+PY   S D  C++       + +CG       +      E ++  + V  R  +   + +  ++    T+A +G N G + K  L       +    + T    N    N+  ++ ++ +Y   + KI++  ++ C+   +C+ C+ +  P+CGWC+  G+C  + +C+ A      +W P Q+         + +I  H       KS  V   V   P  +L ++D+ ++C F S N+           + +  +SC  P    IPP   N++FV + +++ +N S  +    Y  YNCA +        C  CV++ + C W V  ++C   S  +   N   Q     CP  E  +  L   VG+   I     N   Y    F   T+ +  E  D +T  G   + +  + +F                V + + +  TG  + ++ +   +++C    E C  C +    Y+C +C     CV + +C + +S        +CP P I +I P    L     + +KG NLG  ++D+KN      N     C+++ + Y  S    C+I   + R    V  +     K     + +F +  P   S+ PN GP  GGT++ + G  LN  S+ ++    G  P  C + E+  + I+C+L+++    V    +  K    P+   +  +I A         F+F  NP V           GG+   + G   + + K S+
Sbjct:   63 ARAETGPKKDAKGCTPPVSTCQD--------------LKDTNNTNKLLLVHSANGSLIVCGSLYRGICSLLNLTNVKEQIYYSDSKGERTYAASTED---YVSVVGVMATLEIDNKPFSVFLVGKGYGSMD--SSKLIS----TRIVQNYRDWVVFESIIE--ASTVQAVPFVPKY-LHDFRFAFKNDNFVYFLFSRTLGRTDNKNFTF---ISRLCENDNHYYSYTELQLSCGLNNR--YNKVQAAYLSDPGKELAQVMTDSGEYGTVK-EWD-----------KVLFVVASSEEGATESALCMYPLKNINQKLLAIVTACYTDNGKIDDRLVVESPYT-SSKDGPCVKHDKDIVNRYKCGADFLPSPLASRQ--EFALKANPVFIRQNL--LTAVAVAVENDHTIAFLGHNAGEVIKVHLSSSPEPYNPGPGYKTSGYVNK---NLFFDKTQAHLYITTEKKIVKVPVQACHLKQDCQSCVAQKDPYCGWCVLEGRCSRRSECSRAEEKHGWLWSPNQQ--------CVKIISFHPPNLSCLKSQQVEINVRSLP--VLRDSDR-IRCSFGSYNSTA--------RMVDGRISCHLPEQPFIPPTPPNQDFVAVPVQIYVNVSVKVASSEYKFYNCAAAIQKAQNTPCTSCVSSSWGCQWNVAAHTCTDLSDAETGTNIIKQRQNKSCPRFENPDPVL-IPVGYKTRISFEGINLDPYKGRDFTIGTELMRGEE-DVNTESGPFYSFSGYMFSFDKAH---------ETSVLFHVRDKHTGK-KIDSSLNVTLYNCSLGREDCSLCKNADPKYQCVWCRQTSACVYEQLCASRESV-------ECPDPQITDITPRFGPLKGGIAVTIKGSNLGIQKDDIKNITVAGVN-----CRHLRERYSVSTSVICEIGPASLRKSGVVEIEVGRGRKGVSSKTVQFTYRDPVPLSVFPNRGPKAGGTVLTITGQDLNTASKEDLLILVGDVP--CRV-ESFGDQITCKLSNYLGDTVPSAHLDVKVQYGPQ---IPTSIKA--------AFQFSNNPSVSDHQPRSSFICGGRRVVVHGSGFDLVQKASI 1041          

HSP 2 Score: 108.227 bits (269), Expect = 8.818e-23
Identity = 134/519 (25.82%), Postives = 229/519 (44.12%), Query Frame = 2
Query: 4337 KLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMFRQSD-LLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIF-----DYESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLEC-LKCVSRILMDICSENQNKDVWLTQ-------LFSDVIKLYSPKVLNYYEGIKGTGSFNYNEY------YGSSRIDGINISLAIVILYQ 5815
            + S L   + F++ F   LE   +  ++ K    S L++ L   L  YT I++ L+    +    ++  + + R+S+ ++ ++LSNW  I +Y +L++  AG  L  L+  I + I  GPV+ +  K++Y LN+  LL   +E+  L L+V  +    D    V VL+CD ISQ K KI E++YK  PYS     +S  L +       +    L   + KE     + TL  Y+++D   + ++    +  + +    SH E N+                    L +  K   + R +D L E            K+K  + KD    K    IY   L S ++G ++   DD F        +VP  V   F   +         D+  +   K+NSL LRFW+ ++ N  F+FDV +   T V++  L  +++  MD C++ ++K   L++       L++  I  Y   V  YY+GI+   S +  E             D +N  +A+  LY+
Sbjct: 1327 QFSNLLNSKTFLINFIRTLEGRPDFNARAKVYFASLLTVALHGKLEYYTDIMRTLLLGLMEDYVHSKNPKLLLRRSETVVERMLSNWMSICLYQYLKD-TAGEPLYKLFRAIKHQIEKGPVDVQVKKAKYTLNDTGLLGDDVEYSILTLQVLVQGEGPDI-TPVNVLNCDTISQVKEKILEQVYKNLPYSQRPKVDSVTL-EWRPGSTGQILSDLDVTSQKEGRWRRINTLAHYNVRDNATVILSSVQHTQQSYDQNHDSHEERNA--------------------LLEDDKVFHLVRPADELDE-----------IKSKRGSIKDKSMTKAITEIYLTRLLS-VKGTLQQFVDDFFHSVLCSGAAVPPAVKYFFDFLDEQALRHENVDEETIHIWKTNSLPLRFWVNILKNPHFIFDVHV---TEVVDASLSVIAQTFMDACTKTEHK---LSRDSPSNKLLYAKEISTYKRNVDEYYKGIRQMVSVSDQEMNTHLAEVSREHTDKLNTQVALHQLYR 1804          
BLAST of plexin A vs. Ensembl Xenopus
Match: plxna1 (plexin A1 [Source:NCBI gene;Acc:100037845])

HSP 1 Score: 243.432 bits (620), Expect = 7.727e-64
Identity = 323/1436 (22.49%), Postives = 600/1436 (41.78%), Query Frame = 2
Query: 1526 NNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSEN----DKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNS----TAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETP--IEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKF--QKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPK--KASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYE-NCFV-NNSDIDCISPTTSNITQF------QKCSLLFAMEK--GSVCVYNTSITIFSTPV---LRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQ--AAIQDEIHKNWN-----TAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNIC-VAMKNESLPASNTASVSH-LESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            N I  ++V++ ++  IYA+ + ++ R  + +C     C+ CL    P CGWC+ +  C  KD+C  A  L  +     + C  + V P +           +   VS+ P+ + + N       + C F      E         I +  + C  P  K++ PI     F+ L LK            +  YNC+  ++C  CVN  F C WC   + C  ++   C       N   DCP +  S + +   VG    I L  KN     + + ++ C+     S    TA+   S S +   T    +    + +  ++ V W       G    + P  I+  ++ C  L E C  C+   + ++CG+C  + KC  +  C   ++ W+++     +C  P I ++ P        +++ + G NLG    D++  + +   H  F   Y+  S + S Q +    N N        F   F             F  P    + P+ GP  GGT I + GS+LN GS  +V  + G  P + +    +E                IR K    P   KA +Q++I+  ++  ++V + +  +P V+KI     +++GG    +TG NL  + +P +  R +   +  E NC V N++ + C++P+  N  +       +   + F M+     + V  TS   +  PV   L  + N    P++ L I  + L+          +     + ++ + +G   C  ++     + C              +   L G++ +TV+G  ++  G + + + S++ +  I+ +     +L+++II+  +  K++ R     +  +++  + + +  R   E  +  A +Q +IH+  N       P   Y  Y +  LFP                                HP++  K+++V  N  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  +K  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+VL+CD I+Q K K+ + +YK  PYS           K    ++   +  +A I L++    T        L TL  Y + DG ++  V  +N +   SN+++ +  L    + L+T  S + +    PM +  PD+     +  L  + H++  Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct:  452 NAILRDLVLSPDRQYIYAMTEKQVTRVPVESCEQYETCDACLGSRDPHCGWCVLHNMCSRKDKCERADEL-HRFTSDQRQCVQLTVHPRN-----------ISVTVSEVPMVLQAWNVPDLSAGVNCSFEDFTEMEGR-------ILDGKIYCTSPSTKDVIPITRGHGFLKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHVCTHNA-ADCSFQEGRVNMSEDCPQILPSTQ-IYIPVGVVKPITLTAKNLPQPQSGQRNYECIFHIPGSVTRVTALRFNSTSIQCQNTSYNYEGNDISDLPVNLSVVW------NGHFVIDNPQNIQAHLYKCSALRESCGLCLKSDRRFECGWCVSEKKCTLRQNCPAYENPWMHASTVNSRCTDPKITKLFPETGPKQGGTLLTITGENLGLRFEDIRFGVRV--GHVMFCVSYLATSLLCSTQSE---HNHN-------RFYGVF-------------FQVPSFNRVTPSRGPLSGGTWISIEGSYLNSGS--DVSVDIGGRPCMFSWRTAKE----------------IRCKTPQGPSTGKAEIQIHINRATLYNSEVHYNYTEDPTVQKIEPEWSIASGGTPLIVTGLNLATIKEPKI--RAKYGDAERENNCTVYNDTTMVCLAPSVENPLRSPPENGDRPDEIGFIMDNVLALLIVNTTSFLYYPDPVFEPLTASGNLELKPSSPLIIKGRNLIP---------AAPGNFRLNYTVLIGDTPCA-LTVSETQLLC--------------ESPNLTGQHKVTVTGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLIIIIVLIAYKRKSRDADRTL--KRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAMRVLFPGIE----------------------------DHPVL--KEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPENENAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRP--------KAGDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQNSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMIT--PDLESGTKLWHLVKN-HDHLDQREGDRGS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQITDYDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KNSITDACLSVVAQTFMDSCSTSEHK 1729          
BLAST of plexin A vs. Ensembl Xenopus
Match: plxna1 (plexin A1 [Source:NCBI gene;Acc:100037845])

HSP 1 Score: 241.121 bits (614), Expect = 3.638e-63
Identity = 321/1428 (22.48%), Postives = 590/1428 (41.32%), Query Frame = 2
Query: 1526 NNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNS-TAIGSLS-ASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKF--QKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPK--KASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYE-NCFV-NNSDIDCISPTTSNITQF------QKCSLLFAMEK--GSVCVYNTSITIFSTPV---LRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQ--AAIQDEIHKNWN-----TAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNIC-VAMKNESLPASNTASVSH-LESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            N I  ++V++ ++  IYA+ + ++ R  + +C     C+ CL    P CGWC+ +  C  KD+C  A  L  +     + C  + V P        N S T++ Q    P      N  F    FT    R          I +  + C  P  K++ PI     F+ L LK            +  YNC+  ++C  CVN  F C WC   + C  ++   C       N   DCP +  S + +   VG    I L  KN     + + ++ C+     S T + +L   S  + C        Q  S++ ++   W    +LT            ++ C  L E C  C+   + ++CG+C  + KC  +  C   ++ W+++     +C  P I ++ P        +++ + G NLG    D++  + +   H  F   Y+  S +  K+ +C              F   F             F  P    + P+ GP  GGT I + GS+LN GS  +V  + G                             IR K    P   KA +Q++I+  ++  ++V + +  +P V+KI     +++GG    +TG NL  + +P +  R +   +  E NC V N++ + C++P+  N  +       +   + F M+     + V  TS   +  PV   L  + N    P++ L I  + L+          +     + ++ + +G   C  ++     + C              +   L G++ +TV+G  ++  G + + + S++ +  I+ +     +L+++II+  +  K++ R     +  +++  + + +  R   E  +  A +Q +IH+  N       P   Y  Y +  LFP                                HP++  K+++V  N  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  +K  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+VL+CD I+Q K K+ + +YK  PYS           K    ++   +  +A I L++    T        L TL  Y + DG ++  V  +N +   SN+++ +  L    + L+T  S + +    PM +  PD+     +  L  + H++  Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct:  464 NAILRDLVLSPDRQYIYAMTEKQVTRVPVESCEQYETCDACLGSRDPHCGWCVLHNMCSRKDKCERADEL-HRFTSDQRQCVQLTVHPR-------NISVTMVLQAWNVPDLSAGVNCSFED--FTEMEGR----------ILDGKIYCTSPSTKDVIPITRGHGFLKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHVCTHNA-ADCSFQEGRVNMSEDCPQILPSTQ-IYIPVGVVKPITLTAKNLPQPQSGQRNYECIFHIPGSVTRVTALRFNSTSIQC--------QNTSVRFAL---WAFHYILT-----------HLYKCSALRESCGLCLKSDRRFECGWCVSEKKCTLRQNCPAYENPWMHASTVNSRCTDPKITKLFPETGPKQGGTLLTITGENLGLRFEDIRFGVRV--GHVMFCVSYLATSLLCCKK-QCNFYKATQSEHNHNRFYGVF-------------FQVPSFNRVTPSRGPLSGGTWISIEGSYLNSGS--DVSVDIGGQ---------------------------IRCKTPQGPSTGKAEIQIHINRATLYNSEVHYNYTEDPTVQKIEPEWSIASGGTPLIVTGLNLATIKEPKI--RAKYGDAERENNCTVYNDTTMVCLAPSVENPLRSPPENGDRPDEIGFIMDNVLALLIVNTTSFLYYPDPVFEPLTASGNLELKPSSPLIIKGRNLIP---------AAPGNFRLNYTVLIGDTPCA-LTVSETQLLC--------------ESPNLTGQHKVTVTGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLIIIIVLIAYKRKSRDADRTL--KRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAMRVLFPGIE----------------------------DHPVL--KEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPENENAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRP--------KAGDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQNSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMIT--PDLESGTKLWHLVKN-HDHLDQREGDRGS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQITDYDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KNSITDACLSVVAQTFMDSCSTSEHK 1714          
BLAST of plexin A vs. Ensembl Xenopus
Match: plxna1 (plexin A1 [Source:NCBI gene;Acc:100037845])

HSP 1 Score: 233.032 bits (593), Expect = 1.118e-60
Identity = 319/1432 (22.28%), Postives = 594/1432 (41.48%), Query Frame = 2
Query: 1526 NNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNS----TAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETP--IEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKF--QKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPK--KASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYE-NCFV-NNSDIDCISPTTSNITQF------QKCSLLFAMEK--GSVCVYNTSITIFSTPV---LRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQ--AAIQDEIHKNWN-----TAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNIC-VAMKNESLPASNTASVSH-LESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            N I  ++V++ ++  IYA+ + ++ R  + +C     C+ CL    P CGWC+ +  C  KD+C  A  L  +     + C  + V P +  +  S     ++ Q    P      N  F    FT    R          I +  + C  P  K+  P+  +  F+ L LK            +  YNC+  ++C  CVN  F C WC   + C  ++   C       N   DCP +  S + +   VG    I L  KN     + + ++ C+     S    TA+   S S +   T    +    + +  ++ V W       G    + P  I+  ++ C  L E C  C+   + ++CG+C  + KC  +  C   ++ W+++     +C  P I ++          +++ + G NLG    D++  + +   H  F   Y+  S +     +  I                          K F F  P    + P+ GP  GGT I + GS+LN GS  +V  + G  P + +    +E                IR K    P   KA +Q++I+  ++  ++V + +  +P V+KI     +++GG    +TG NL  + +P +  R +   +  E NC V N++ + C++P+  N  +       +   + F M+     + V  TS   +  PV   L  + N    P++ L I  + L+          +     + ++ + +G   C  ++     + C              +   L G++ +TV+G  ++  G + + + S++ +  I+ +     +L+++II+  +  K++ R     +  +++  + + +  R   E  +  A +Q +IH+  N       P   Y  Y +  LFP                                HP++  K+++V  N  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  +K  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+VL+CD I+Q K K+ + +YK  PYS           K    ++   +  +A I L++    T        L TL  Y + DG ++  V  +N +   SN+++ +  L    + L+T  S + +    PM +  PD+     +  L  + H++  Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct:  465 NAILRDLVLSPDRQYIYAMTEKQVTRVPVESCEQYETCDACLGSRDPHCGWCVLHNMCSRKDKCERADEL-HRFTSDQRQCVQLTVHPRNISVTVSE----MVLQAWNVPDLSAGVNCSFED--FTEMEGR----------ILDGKIYCTSPSTKD--PLGRDWGFLKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHVCTHNA-ADCSFQEGRVNMSEDCPQILPSTQ-IYIPVGVVKPITLTAKNLPQPQSGQRNYECIFHIPGSVTRVTALRFNSTSIQCQNTSYNYEGNDISDLPVNLSVVW------NGHFVIDNPQNIQAHLYKCSALRESCGLCLKSDRRFECGWCVSEKKCTLRQNCPAYENPWMHASTVNSRCTDPKITKV--KTGPKQGGTLLTITGENLGLRFEDIRFGVRV--GHVMFCVSYLATSLLCCVPHRWAIS------------------------PKSFTFVVPSFNRVTPSRGPLSGGTWISIEGSYLNSGS--DVSVDIGGRPCMFSWRTAKE----------------IRCKTPQGPSTGKAEIQIHINRATLYNSEVHYNYTEDPTVQKIEPEWSIASGGTPLIVTGLNLATIKEPKI--RAKYGDAERENNCTVYNDTTMVCLAPSVENPLRSPPENGDRPDEIGFIMDNVLALLIVNTTSFLYYPDPVFEPLTASGNLELKPSSPLIIKGRNLIP---------AAPGNFRLNYTVLIGDTPCA-LTVSETQLLC--------------ESPNLTGQHKVTVTGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLIIIIVLIAYKRKSRDADRTL--KRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAMRVLFPGIE----------------------------DHPVL--KEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPENENAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRP--------KAGDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQNSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMIT--PDLESGTKLWHLVKN-HDHLDQREGDRGS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQITDYDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KNSITDACLSVVAQTFMDSCSTSEHK 1735          
BLAST of plexin A vs. Ensembl Xenopus
Match: plxna1 (plexin A1 [Source:NCBI gene;Acc:100037845])

HSP 1 Score: 229.95 bits (585), Expect = 9.134e-60
Identity = 316/1436 (22.01%), Postives = 596/1436 (41.50%), Query Frame = 2
Query: 1526 NNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSEN----DKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNS----TAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETP--IEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKF--QKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPK--KASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYE-NCFV-NNSDIDCISPTTSNITQF------QKCSLLFAMEK--GSVCVYNTSITIFSTPV---LRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQ--AAIQDEIHKNWN-----TAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNIC-VAMKNESLPASNTASVSH-LESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            N I  ++V++ ++  IYA+ + ++ R  + +C     C+ CL    P CGWC+ +  C  KD+C  A  L  +     + C  + V P +           +   VS+ P+ + + N       + C F      E         I +  + C  P  K++ PI      +   L  +++        +  YNC+  ++C  CVN  F C WC   + C  ++   C       N   DCP +  S + +   VG    I L  KN     + + ++ C+     S    TA+   S S +   T    +    + +  ++ V W       G    + P  I+  ++ C  L E C  C+   + ++CG+C  + KC  +  C   ++ W+++     +C  P I ++          +++ + G NLG    D++  + +   H  F   Y+  S +     +  I                          K F F  P    + P+ GP  GGT I + GS+LN GS  +V  + G  P + +    +E                IR K    P   KA +Q++I+  ++  ++V + +  +P V+KI     +++GG    +TG NL  + +P +  R +   +  E NC V N++ + C++P+  N  +       +   + F M+     + V  TS   +  PV   L  + N    P++ L I  + L+          +     + ++ + +G   C  ++     + C              +   L G++ +TV+G  ++  G + + + S++ +  I+ +     +L+++II+  +  K++ R     +  +++  + + +  R   E  +  A +Q +IH+  N       P   Y  Y +  LFP                                HP++  K+++V  N  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  +K  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+VL+CD I+Q K K+ + +YK  PYS           K    ++   +  +A I L++    T        L TL  Y + DG ++  V  +N +   SN+++ +  L    + L+T  S + +    PM +  PD+     +  L  + H++  Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct:  465 NAILRDLVLSPDRQYIYAMTEKQVTRVPVESCEQYETCDACLGSRDPHCGWCVLHNMCSRKDKCERADEL-HRFTSDQRQCVQLTVHPRN-----------ISVTVSEVPMVLQAWNVPDLSAGVNCSFEDFTEMEGR-------ILDGKIYCTSPSTKDVIPITRGHGNIMPFLYCIVD--------FVFYNCSVHQSCLSCVNGSFPCHWCKYRHVCTHNA-ADCSFQEGRVNMSEDCPQILPSTQ-IYIPVGVVKPITLTAKNLPQPQSGQRNYECIFHIPGSVTRVTALRFNSTSIQCQNTSYNYEGNDISDLPVNLSVVW------NGHFVIDNPQNIQAHLYKCSALRESCGLCLKSDRRFECGWCVSEKKCTLRQNCPAYENPWMHASTVNSRCTDPKITKV--KTGPKQGGTLLTITGENLGLRFEDIRFGVRV--GHVMFCVSYLATSLLCCVPHRWAIS------------------------PKSFTFVVPSFNRVTPSRGPLSGGTWISIEGSYLNSGS--DVSVDIGGRPCMFSWRTAKE----------------IRCKTPQGPSTGKAEIQIHINRATLYNSEVHYNYTEDPTVQKIEPEWSIASGGTPLIVTGLNLATIKEPKI--RAKYGDAERENNCTVYNDTTMVCLAPSVENPLRSPPENGDRPDEIGFIMDNVLALLIVNTTSFLYYPDPVFEPLTASGNLELKPSSPLIIKGRNLIP---------AAPGNFRLNYTVLIGDTPCA-LTVSETQLLC--------------ESPNLTGQHKVTVTGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLIIIIVLIAYKRKSRDADRTL--KRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAMRVLFPGIE----------------------------DHPVL--KEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPENENAPEIPVKVLNCDTITQVKEKLLDAVYKGVPYSQRP--------KAGDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQNSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMIT--PDLESGTKLWHLVKN-HDHLDQREGDRGS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQITDYDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KNSITDACLSVVAQTFMDSCSTSEHK 1731          
BLAST of plexin A vs. Ensembl Xenopus
Match: plxna2 (plexin A2 [Source:NCBI gene;Acc:100144723])

HSP 1 Score: 223.402 bits (568), Expect = 9.985e-58
Identity = 251/1157 (21.69%), Postives = 466/1157 (40.28%), Query Frame = 2
Query:  122 CALTSEIFVYKYENLDKIMLHNNKSHKSILVSGKNYILQFSENNLKEPLAIRKTGPVNHSVMCTEPNQCQTSLCPKELISRDQCRIKLTDVFVKLWTFADSYLVVCYDVFQGFCEII---DLYNQFSSSYKNKAYSIVTNDRKFHSTVLYH----DQRLFFANEVYHPSNYREIDFNTMSILSFPN--MTYFKPDYPFQANF-GKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKH----EPKNGLFQV-RLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYEL---------FEDTNYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSH--LVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCL----ETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWIN--SKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVS--KEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQE-NYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQF-TDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPT 3481
            CA  S  F  ++ +     L  +++  ++ V   N I + S N     L    TGP   +  C  P   Q    P+ L + +  ++ + D       +A++ L+ C  ++QG C+++   DL+     S+K + Y    N+      V+ H    D +LF    V    +Y    F T+S    P    +    DY   ++F   L+    +T+  +     F++Y         NY++FL  QPE          N LF   R+VR+C  D  + S++ + + C   N   Y  + +  +      +A       R  +I T+ D     +LF  F        Y    +    C +PI  I  L       C  G G +  N       D +C +              NF    I    G ++++    +        + +   +Y  +++  +G   G + K            +E  N       L  +++F+    +NK  +Y +++ ++ R  + +C   ++CE+CL    P CGWC+ +  C  KD+C  A   PF+    +K C  ++V P+   L  S  S  +  +VS  P     +    + C F  +  +E   V++        + C+ P  K+IP +   +++  ++L+++  ++    V   +  YNC+  + C  CVN  F C WC   N C       C       N   DCP L  S E L   VG    I L  +N     + +  + C+           A+   S+S +   +  + + +  + +     V W  GN    +I+    I+  ++ C  L E C  C+     Y+CG+C  + +C   H C +  ++W++  S+  KC  P I EI+  +      + + ++G NLG   +++   + +        C  +E+ YI ++Q  C++   +    +        + K +++    +++ F SP V  + P+ GP  GGT+I + G  L  GS            I+   L NQ   Y    LN+      ++     S      + +++  +  Q  +++QFE+  +P V +I     +++G     + G NL+ + +P +  +     S+     VN + + C++P 
Sbjct:   37 CASLSNTFNTEHRDWTFSHLTVHQTTGAVYVGAVNRIYKLSGNLTL--LVSHNTGPGEDNKSCYPPQNVQPCSEPRTL-TNNVNKLLIID-------YAENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNETGTMYGVIVHTEGQDGKLFIGTAVDGKQDY----FPTLSSRKLPRDPESSTMLDYELYSDFVSSLIKIPSDTLALVSHFDIFYVYGFSSG----NYVYFLTVQPETPEGISSNSANDLFYTSRIVRLCKNDPKFHSYVSLPIGC-TKNGVEYRLLQAAYLTKPGATLA-------RSLKITTQDD-----VLFAIFS--KGQKQYHHPPDDSTLCVFPIKTINSLIKERLQSCYQGEGHLELN--WLLGKDVQCTKAPVPID-------DNFCGLDINQPLGGSTMVEGVTLYTESRDRMTSLASYVYNNYSVVFVGTKSGRIKKIRADGPPDGGIPYEVVNVTRDEIPLLRDMAFS---TDNK-YLYVMSERQVSRVEVEHCEQYSSCEECLSSGDPHCGWCVLHNTCSRKDKCERAHE-PFRFADNMKQCVKVDVQPNS--LPVSEHSLLLTLKVSNVP-----DLSAGVTCAF-GDLKQEEGQVQS-----GSRIDCVSPAAKDIPTMLAAQDWFGVELQLISKETGKTFVSTNFKFYNCSAHQHCLSCVNGDFRCHWCKYRNLCTHDPT-SCSFQEGRVNVSEDCPQLVPSEEIL-IPVGEVRPITLKARNLPQPQSGQRGYECVLNIQGVVHRMPALRFNSSSVQCQNSSYIYEGMDVSDLPVDFSVVWN-GNF---TIDNPQLIKVHLYKCAALRESCGLCLKADHKYECGWCNGEGRCTLHHHCMSPQNQWLDWSSRNVKCINPRIHEILTVSGPPEGGTRVTIRGANLGLNFSEIAQNVVVAGVQ----CTPVEEEYIIAEQIVCEMGQASPTSSSGPVLLCIEECKPEFMARSLQQYTFVSPTVAHLSPSRGPESGGTMITITGHNLAAGS------------IVSVTLGNQTCEYYGRSLNE------IVCVTAPSTHGLGPVHVSVSVDRAQLESNLQFEYIDDPKVLRIEPEWSIASGHTSLTVIGTNLDIIQQPRIRVKSNGKESVNVCKVVNATCLTCLAPA 1105          

HSP 2 Score: 112.079 bits (279), Expect = 7.936e-24
Identity = 150/587 (25.55%), Postives = 266/587 (45.32%), Query Frame = 2
Query: 4277 HPLIVNKQIQV-IENTVEYSRKL-SKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMF--RQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALK-EVVGYTLKTLKDYDIKDGDNICVAMKNES---LPASNTASVSHLESNSASLK-TNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSK------IKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQN---KDVWLTQ-LFSDVIKLYSPKVLNYYEGIKGTGSF---NYNEYYG-SSRIDG--INISLAIVILYQNYINSVHKELVEVIQISNYPKDKQNEWITILEEVKNLYVAESF 5944
            HP++   ++Q   + +VE + KL ++L  +++F+L F   LE  +    + + ++ S +   L   L   T +LK L+ +  +K   N+    +   R   +  K+L+NWF  L++  L+   AG  L +L+  I   +  GP++  T +++Y+L+E+ L+ ++IE+K L L   +   EN  E+ V+VL+CD I+Q K KI + +YK  PYS         L +  Q  +         I  K E     L TL  Y + D   + +  K  S   +PAS + S + +    ++ + T    ++    PM +  PD+   + +  L  + HE+  QK        +   Y T++ A K               L+  ++   + LF  +    ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K +    CL  V++  MD CS +++   KD    + L++  I  Y   V  YY  I    +    + N Y    SR+     NI  A+  +Y +Y++    EL+  ++     +D+Q     +  +V+ L  A SF
Sbjct: 1336 HPVLQELEVQGNRQQSVEKALKLFAQLINNKVFLLTFIRTLELQRSFSMRDRGNVASLIMTALQGKLEYATDVLKQLLSDLIEKNLENKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKEC-AGEPLFMLHCAIKQQMEKGPIDSITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDL-EWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTSISRYDSTFRYTGSPDSLRSRAPMIT--PDLESGVKVWHLVKN-HEHGDQKEGDRGSKMVSEIYLTRLLATKG-------------TLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADRHGIYDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPNYKNWVERYYADIAKLPAISDQDMNAYLAEQSRMHAAEFNIMSALNEIY-SYVSKYSVELITALE-----QDEQGRRHRLAYKVEQLIGAMSF 1896          
BLAST of plexin A vs. Ensembl Mouse
Match: Plxna2 (plexin A2 [Source:MGI Symbol;Acc:MGI:107684])

HSP 1 Score: 254.218 bits (648), Expect = 3.132e-67
Identity = 364/1695 (21.47%), Postives = 696/1695 (41.06%), Query Frame = 2
Query:  854 LFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEI-MELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYEL---------FEDTNYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSH--LVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNST----AIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWIN--SKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQN-INDRIETPVAF-----QFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCIS--------PTTSNITQFQKCSLLFAMEKGSVCVYNTSITIFSTPVLRINPN-KISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIA-ELNQA--AIQDEIHK-----NWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFE----DELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMF--RQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALK-EVVGYTLKTLKDYDIKDGDNICVAMKNES---LPASNTASVSHLESNSASLK-TNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSK------IKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQN--------------KDV-----WLTQLFSDVIKL 5686
             +  R+VR+C  D  + S++ +   C       Y  + +  +A   + +A  +        I ++ D     +LF  F        Y    +    CA+PI  I +++ + +++ C  G G++  N       D +C +              NF    I    G ++ +    +        + +   +Y  +++  +G   G L K            +E  +       +  +++F++    N+  +Y +++ ++ R  + +C   T C +CL    P CGWC  +  C  +D+C  A W   +   ++  C  + V P+   +  S+ S  +   V+  P   LSE    + C F +     +  V+    +    + CI P  K++P I  ++++  L+L++   ++    V   +  YNC+  + C  CVN+ F C WC   N C       C       N   DCP L V  E +   VG    I L  +N     + +  + C+ +   +     A+   S+S +   +      +  +++     V W  GN +   I+    ++  ++ C    E C  C+     ++CG+C+ + +C     C +  S W++  S   KC  P I EI+  +      + + + G NLG   +++ + + +        C  I   YI ++Q  C++ + +      PV       + +F TK      +++ F +P V S+ P  GP  GGT++ + G +L  GS   V     T    C       N I C           +    S+      + +++D   +  + +QFE+  +P V++I     +++G     ITG NL+ + +P V  +     S+     VN + + C++        P    + +  +   LF   + S+ +YN +  I+       NP  ++  PT +L       + +  + N     S   + ++ + +G   CT ++     + C   E   +   HK  + +          G + F  G +S+ + S++ +  I+ +     +L++++I+  +  K   R  +EN  T K ++   + L+  +A E  +A   +Q +I++     + +  P   Y  Y +  LFP                                HP++  ++++V  N  ++  K  KLF     +++F+L F   LE  +    + + ++ S +   L   L   T +LK L+ +  DK   N+    +   R   +  K+L+NWF  L++  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++IE+K L L   +   EN  E+ V+VL+CD I+Q K KI + +YK  PYS         L +  Q  +         I  K E     L TL  Y + D   + +  K  S   +PAS + S + +    +S + T    ++   +PM +  PD+   + +  L  + H++  QK        +   Y T++ A K               L+  ++   + LF  +    ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K +    CL  V++  MD CS +++              KD+     W+ + ++D+ KL
Sbjct:  275 FYTSRIVRLCKDDPKFHSYVSLPFGC-TRAGVEYRLLQAAYLAKPGEALAQAFN-------ISSDED-----VLFAIFS--KGQKQYHHPPDDSALCAFPIRAINLQIKERLQS-CYHGEGNLELN--WLLGKDVQCTKAPVPID-------DNFCGLDINQPLGGSTPVEGLTLYTTSRDRLTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVFKDGSPILRDMAFSI----NQLYLYVMSERQVTRVPVESCEQYTTCGECLSSGDPHCGWCALHNMCSRRDKCQRA-WEANRFAASISQCMSLEVHPNS--ISVSDHSRLLSLVVNDAP--NLSEG---IACAFGN-----LTEVEGQ--VSGSQVICISPGPKDVPVIPLDQDWFGLELQLRSKETGKIFVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPT-TCSFQEGRINVSEDCPQL-VPTEEILIPVGEVKPITLKARNLPQPQSGQRGYECVLSIQGAVHRVPALRFNSSSVQCQNSSYQYDGMDISNLAVDFAVVWN-GNFI---IDNPQDLKVHLYKCAAQRESCGLCLKADHKFECGWCSGERRCTLHQHCPSTSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAG----VPCTPIPGEYIIAEQIVCEMGHAVIGTTSGPVRLCIGECKPEFMTKSH----QQYTFVNPSVLSLSPIRGPESGGTMVTITGHYLGAGSSVAVYLGNQT----CEFYGRSMNEIVC-----------VSPPSSNGLGPVPVSVSVDRARVD-SSLQFEYIDDPRVQRIEPEWSITSGHTPLTITGFNLDVIQEPRVRVKFNGKESVNVCTVVNTTTLTCLAPSLTSDYRPGLDTVERPDEFGFLFNNVQ-SLLIYNDTKFIYYP-----NPTFELLSPTGILDQKPGSPIILKGK-NLCPPASGGAKLNYTVMIGETPCT-VTVSETQLLC---EPPNLTGQHKVMVHV----------GGMVFSPGSVSVISDSLLTLPAIISIAAGGSLLLIIVIIVLIAYK---RKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRSGIPYLDYRTYAMRVLFPGIE----------------------------DHPVL--RELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDL-EWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTSISRYDSSFRYTGSPDSLRSRVPMIT--PDLESGVKVWHLVKN-HDHGDQKEGDRGSKMVSEIYLTRLLATKG-------------TLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADRHSIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKNWVERYYADIAKL 1821          
BLAST of plexin A vs. Ensembl Mouse
Match: Plxna1 (plexin A1 [Source:MGI Symbol;Acc:MGI:107685])

HSP 1 Score: 175.637 bits (444), Expect = 2.739e-43
Identity = 157/677 (23.19%), Postives = 286/677 (42.25%), Query Frame = 2
Query: 1526 NNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSEN----DKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAE---NKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTA-IGSLS-ASNRLVC-----TFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDD-SKWINSKF--QKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKD---KYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFV-NNSDIDCISPTTSN 3490
            N I  ++V++ N+  +YA+ + ++ +  + +C   T+CE CL    P CGWC+ +  C  +D C  A   P +    +  C  + V P +           V   +S+ PL + + N       + C F   +  E  ++     IH HS     P  + + PI +   ++  V L LK            +  YNC+  ++C  CVN  F C WC   + C +++   C       N   DCP +  S   +   VG    I L  +N     + +  + CL     S A + +L   S+ L C     +++   V   + +  ++ V W  GN +   I+    I+  ++ C  L + C  C+     ++CG+C  + +C  +H C  D  + W+++     +C  P I+++ P        + + + G NLG    DV+  + +     +  C  +E  YIS++Q  C+I + +         +   +      + L  K F F +P  Y + P+ GP  GGT I + GS LN GS  +V  + G  P  C+        I C                   P  A + +NI+   +   +V++ +  +P + +I     +++GG +  +TG NL  + +P +  +    +    +C V N++ + C +P+  N
Sbjct:  482 NPILRDLVLSPNRQYLYAMTEKQVTQVPVESCVQYTSCELCLGSRDPHCGWCVLHSICSRQDACERAEE-PQRFASDLLQCVQLTVQPRN-----------VSVTMSQVPLVLQAWNVPDLSAGVNCSF--EDFTETESILEDGRIHCHS-----PSAREVAPITQGQGDQRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLACVNGSFPCHWCKYRHVCTNNA-ADCAFLEGRVNMSEDCPQILPSTH-IYVPVGVVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNSSYSYEGNDV---SDLPVNLSVVWN-GNFV---IDNPQNIQAHLYKCPALRQSCGLCLKADPRFECGWCVAERRCSLRHHCPADSPASWMHAHHGSSRCTDPKILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGVHVG----KVLCSPVESEYISAEQIVCEIGDASTLRAHDALVEVCVRDCSLHYRALSPKRFTFVTPTFYRVSPSRGPLSGGTWIGIEGSHLNAGS--DVAVSIGGRP--CSFSWRNSREIRCLTPP------------GHTPGSAPIVININRAQLSNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGG-IERENSCMVYNDTTMVCRAPSIDN 1109          

HSP 2 Score: 102.834 bits (255), Expect = 3.809e-21
Identity = 124/487 (25.46%), Postives = 225/487 (46.20%), Query Frame = 2
Query: 4277 HPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNICVAMKNESL-----PASNTASVSHLESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            HP++  K+++V  N  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  +K  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+ L+CD ++Q K K+ + +YK  PYS           K    ++   +  +A I L++    T        L TL  Y + DG ++ +  K  S       ++ T S+S  ES    L+T  S + +    PM +  PD+     +  L  + H++  Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct: 1337 HPVL--KEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPEHENAPEVPVKGLNCDTVTQVKEKLLDAVYKGVPYSQRP--------KAGDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSLSRYES---MLRTASSPDSLRSRTPMIT--PDLESGTKLWHLVKN-HDHLDQREGDRGS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQIHDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDI--HKNSITDACLSVVAQTFMDSCSTSEHK 1788          
BLAST of plexin A vs. Ensembl Mouse
Match: Plxna1 (plexin A1 [Source:MGI Symbol;Acc:MGI:107685])

HSP 1 Score: 175.637 bits (444), Expect = 2.739e-43
Identity = 157/677 (23.19%), Postives = 286/677 (42.25%), Query Frame = 2
Query: 1526 NNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSEN----DKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAE---NKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTA-IGSLS-ASNRLVC-----TFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDD-SKWINSKF--QKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKD---KYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFV-NNSDIDCISPTTSN 3490
            N I  ++V++ N+  +YA+ + ++ +  + +C   T+CE CL    P CGWC+ +  C  +D C  A   P +    +  C  + V P +           V   +S+ PL + + N       + C F   +  E  ++     IH HS     P  + + PI +   ++  V L LK            +  YNC+  ++C  CVN  F C WC   + C +++   C       N   DCP +  S   +   VG    I L  +N     + +  + CL     S A + +L   S+ L C     +++   V   + +  ++ V W  GN +   I+    I+  ++ C  L + C  C+     ++CG+C  + +C  +H C  D  + W+++     +C  P I+++ P        + + + G NLG    DV+  + +     +  C  +E  YIS++Q  C+I + +         +   +      + L  K F F +P  Y + P+ GP  GGT I + GS LN GS  +V  + G  P  C+        I C                   P  A + +NI+   +   +V++ +  +P + +I     +++GG +  +TG NL  + +P +  +    +    +C V N++ + C +P+  N
Sbjct:  482 NPILRDLVLSPNRQYLYAMTEKQVTQVPVESCVQYTSCELCLGSRDPHCGWCVLHSICSRQDACERAEE-PQRFASDLLQCVQLTVQPRN-----------VSVTMSQVPLVLQAWNVPDLSAGVNCSF--EDFTETESILEDGRIHCHS-----PSAREVAPITQGQGDQRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLACVNGSFPCHWCKYRHVCTNNA-ADCAFLEGRVNMSEDCPQILPSTH-IYVPVGVVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNSSYSYEGNDV---SDLPVNLSVVWN-GNFV---IDNPQNIQAHLYKCPALRQSCGLCLKADPRFECGWCVAERRCSLRHHCPADSPASWMHAHHGSSRCTDPKILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGVHVG----KVLCSPVESEYISAEQIVCEIGDASTLRAHDALVEVCVRDCSLHYRALSPKRFTFVTPTFYRVSPSRGPLSGGTWIGIEGSHLNAGS--DVAVSIGGRP--CSFSWRNSREIRCLTPP------------GHTPGSAPIVININRAQLSNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGG-IERENSCMVYNDTTMVCRAPSIDN 1109          

HSP 2 Score: 102.834 bits (255), Expect = 3.809e-21
Identity = 124/487 (25.46%), Postives = 225/487 (46.20%), Query Frame = 2
Query: 4277 HPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNICVAMKNESL-----PASNTASVSHLESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            HP++  K+++V  N  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  +K  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+ L+CD ++Q K K+ + +YK  PYS           K    ++   +  +A I L++    T        L TL  Y + DG ++ +  K  S       ++ T S+S  ES    L+T  S + +    PM +  PD+     +  L  + H++  Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct: 1337 HPVL--KEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPEHENAPEVPVKGLNCDTVTQVKEKLLDAVYKGVPYSQRP--------KAGDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSLSRYES---MLRTASSPDSLRSRTPMIT--PDLESGTKLWHLVKN-HDHLDQREGDRGS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQIHDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDI--HKNSITDACLSVVAQTFMDSCSTSEHK 1788          
BLAST of plexin A vs. Ensembl Mouse
Match: Plxnb2 (plexin B2 [Source:MGI Symbol;Acc:MGI:2154239])

HSP 1 Score: 166.392 bits (420), Expect = 1.949e-40
Identity = 184/918 (20.04%), Postives = 365/918 (39.76%), Query Frame = 2
Query:  743 EFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVT-CAYPIAEIMELYDVVRNLCLVGSGSVNENP-YNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFED---TNYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCT----TAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSH--LVEGIYHIYNCAHSRT------CAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQKA--SIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSK---EFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLS 3427
            +FV +F      +D F   Y+FF+ N  ++KH  KN   +  L R+C  D  Y S++++ + C   +        + + A+V+   A                     + L+  F     + + R T       C +P+ ++ E  +  RN C  G+        Y     + +C      ++    CG ++   + +G   G   ++   V+ R G+   + +  +     T+A +G +DG + K  L  D     Y     ++   I  ++ ++ N S +YA+   K+ R  ++ C +   C  C     P+CGWC+  G+C  K +C+    T  WL + R ++  A  + +  P +       +      ++S +PL  L+E+D+ L C F  ++    A V+    I N   S               ++ VD+ +++L+      L    Y  Y+C  + +      C  C +N++ C W +    C  +S    ++     + + +CP   ++ + L   +     +    KN      S   +V  E  +    + ++  S+    +F+  K+      ++   + V     N+       ++ ++  +++C      C  C+     Y+C +C  +++CV + +C N  S+        CP P I  I P    L    ++ + G NLG   +DVK       N     C +  + Y  S +  C I+      E P     +     K   S    +F +  P+  S+EP  GP  GGT + +NG+ L+ GS+ +V+                 N + C +  F  + + +  ++ + P + +L++    + +    + F +  NP ++     +   +GG+   +TG   + + K ++    E   S
Sbjct:  217 QFVAAF------EDDF---YVFFVFNH-QDKHPAKN---RTLLARMCKDDPSYYSYVEMDLQCQDPSDPQDSAFGTCLAASVATSGAG--------------------RALYAVF-----SRDGRSTGGPGAGLCVFPLDKVREKIEANRNACYTGAREAGRTIFYKPFHGEIQCGGHLIGASESFPCGSEHL-PYPLGSRDG---LVATAVLHRGGLN-LTAVTVTAENDHTVAFLGTSDGRILKVYLAPDGTSAEYGSIPVDINKKIKQDLALSGNLSSLYAMTQDKVFRLPVQECLSYVTCAQCRDSQDPYCGWCVIEGRCTRKSECSRAEETGHWL-WSREKSCVA--ITDAFPQNMSRRAQGE-----VRLSVSPLPTLTEDDELL-CLF-GDSPPHPARVEDDTVICNSPSSIPS--------TPPGQDHVDVSIQLLLKSGSVFLTSHQYPFYDCREAMSLVENLPCISCASNRWTCQWDLQYYECREASPNP-EEGIIRAHMEDNCPQF-LAPDPLVIPMNHETEVTFQGKNLETVKVSSL-YVGSELLNFEETV-TMHESDTF--SFRTPKLSHDGNETLPLHLYVKSFGKNI-------DSKLQVTLYNCSFGRSDCSLCLAADPAYRCVWCRGQNRCVYEALCSNVTSE--------CPPPVITRIQPETGPLGGGILVTIHGSNLGVKADDVKKITVAGQN-----CAFEPRGYSVSTRIVCAIEAS----EMPFTGGIEVDVNGKLGHSPPHVQFTYQQPQPLSVEPRQGPQAGGTTLTINGTHLDTGSKEDVRVTL--------------NDVPCEVTKFGAQLQCVTGQQLA-PGQVTLEIYYGGSRVPSPGISFTYCENPMIRAFEPLRSFVSGGRSINVTGQGFSLIQKFAMVVIAEPLRS 1028          

HSP 2 Score: 114.005 bits (284), Expect = 1.518e-24
Identity = 132/538 (24.54%), Postives = 247/538 (45.91%), Query Frame = 2
Query: 4337 KLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMFRQSD-LLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIAL---KEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMT--SFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDY-----ESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNKDVWLTQ-------LFSDVIKLYSPKVLNYYEGIK---GTGSFNYNEYYGS---SRIDGINISLAIVILYQNYINSVHKELVEVIQ 5860
            + S L   + F++ F   LE+ +E  ++ K    S L++ L   L  YT I++ L     ++  + +  + M R+S+ ++ ++LSNW  I +Y +L++ +AG  L  L+  I + +  GPV+    K++Y LN+  LL   +E+  L + V  +    D+ + V+VL+CD ISQ K KI +++Y+  P S W   +S  L    +     + ++L+ + L   +E     + TL  Y+++DG  + ++             VS    +S            +D+P    + L + ++   + R +D + E            K+K  + K+    K    IY   L S ++G ++   D+ F        +VP  V   F   +        +D+  +   K+NSL LRFW+ ++ N  F+FDV +  H  V   L  +++  MD C+  ++K   L++       L++  I  Y   V +YY+GI+        + N +      +  D +N  +A+  LYQ Y    + E++  ++
Sbjct: 1322 QFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKD-SAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGIDA-IPVKVLNCDTISQVKEKIIDQVYRTQPCSCWPKPDSVVL----EWRPGSTAQILSDLDLTSQREGRWKRINTLMHYNVRDGATLILS----------KVGVSQQPEDS-----------QQDLPGERHALLEEENRVWHLVRPTDEVDEG-----------KSKRGSMKEKERTKAITEIYLTRLLS-VKGTLQQFVDNFFQSVLAPGHAVPPAVKYFFDFLDEQAEKHDIRDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHV--HEVVDASLSVIAQTFMDACTRTEHK---LSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQ-YTQKYYDEIINALE 1814          
BLAST of plexin A vs. Ensembl Mouse
Match: Plxnb2 (plexin B2 [Source:MGI Symbol;Acc:MGI:2154239])

HSP 1 Score: 166.392 bits (420), Expect = 1.949e-40
Identity = 184/918 (20.04%), Postives = 365/918 (39.76%), Query Frame = 2
Query:  743 EFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVT-CAYPIAEIMELYDVVRNLCLVGSGSVNENP-YNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFED---TNYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCT----TAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSH--LVEGIYHIYNCAHSRT------CAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQKA--SIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSK---EFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLS 3427
            +FV +F      +D F   Y+FF+ N  ++KH  KN   +  L R+C  D  Y S++++ + C   +        + + A+V+   A                     + L+  F     + + R T       C +P+ ++ E  +  RN C  G+        Y     + +C      ++    CG ++   + +G   G   ++   V+ R G+   + +  +     T+A +G +DG + K  L  D     Y     ++   I  ++ ++ N S +YA+   K+ R  ++ C +   C  C     P+CGWC+  G+C  K +C+    T  WL + R ++  A  + +  P +       +      ++S +PL  L+E+D+ L C F  ++    A V+    I N   S               ++ VD+ +++L+      L    Y  Y+C  + +      C  C +N++ C W +    C  +S    ++     + + +CP   ++ + L   +     +    KN      S   +V  E  +    + ++  S+    +F+  K+      ++   + V     N+       ++ ++  +++C      C  C+     Y+C +C  +++CV + +C N  S+        CP P I  I P    L    ++ + G NLG   +DVK       N     C +  + Y  S +  C I+      E P     +     K   S    +F +  P+  S+EP  GP  GGT + +NG+ L+ GS+ +V+                 N + C +  F  + + +  ++ + P + +L++    + +    + F +  NP ++     +   +GG+   +TG   + + K ++    E   S
Sbjct:  217 QFVAAF------EDDF---YVFFVFNH-QDKHPAKN---RTLLARMCKDDPSYYSYVEMDLQCQDPSDPQDSAFGTCLAASVATSGAG--------------------RALYAVF-----SRDGRSTGGPGAGLCVFPLDKVREKIEANRNACYTGAREAGRTIFYKPFHGEIQCGGHLIGASESFPCGSEHL-PYPLGSRDG---LVATAVLHRGGLN-LTAVTVTAENDHTVAFLGTSDGRILKVYLAPDGTSAEYGSIPVDINKKIKQDLALSGNLSSLYAMTQDKVFRLPVQECLSYVTCAQCRDSQDPYCGWCVIEGRCTRKSECSRAEETGHWL-WSREKSCVA--ITDAFPQNMSRRAQGE-----VRLSVSPLPTLTEDDELL-CLF-GDSPPHPARVEDDTVICNSPSSIPS--------TPPGQDHVDVSIQLLLKSGSVFLTSHQYPFYDCREAMSLVENLPCISCASNRWTCQWDLQYYECREASPNP-EEGIIRAHMEDNCPQF-LAPDPLVIPMNHETEVTFQGKNLETVKVSSL-YVGSELLNFEETV-TMHESDTF--SFRTPKLSHDGNETLPLHLYVKSFGKNI-------DSKLQVTLYNCSFGRSDCSLCLAADPAYRCVWCRGQNRCVYEALCSNVTSE--------CPPPVITRIQPETGPLGGGILVTIHGSNLGVKADDVKKITVAGQN-----CAFEPRGYSVSTRIVCAIEAS----EMPFTGGIEVDVNGKLGHSPPHVQFTYQQPQPLSVEPRQGPQAGGTTLTINGTHLDTGSKEDVRVTL--------------NDVPCEVTKFGAQLQCVTGQQLA-PGQVTLEIYYGGSRVPSPGISFTYCENPMIRAFEPLRSFVSGGRSINVTGQGFSLIQKFAMVVIAEPLRS 1028          

HSP 2 Score: 114.005 bits (284), Expect = 1.518e-24
Identity = 132/538 (24.54%), Postives = 247/538 (45.91%), Query Frame = 2
Query: 4337 KLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMFRQSD-LLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIAL---KEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMT--SFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDY-----ESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNKDVWLTQ-------LFSDVIKLYSPKVLNYYEGIK---GTGSFNYNEYYGS---SRIDGINISLAIVILYQNYINSVHKELVEVIQ 5860
            + S L   + F++ F   LE+ +E  ++ K    S L++ L   L  YT I++ L     ++  + +  + M R+S+ ++ ++LSNW  I +Y +L++ +AG  L  L+  I + +  GPV+    K++Y LN+  LL   +E+  L + V  +    D+ + V+VL+CD ISQ K KI +++Y+  P S W   +S  L    +     + ++L+ + L   +E     + TL  Y+++DG  + ++             VS    +S            +D+P    + L + ++   + R +D + E            K+K  + K+    K    IY   L S ++G ++   D+ F        +VP  V   F   +        +D+  +   K+NSL LRFW+ ++ N  F+FDV +  H  V   L  +++  MD C+  ++K   L++       L++  I  Y   V +YY+GI+        + N +      +  D +N  +A+  LYQ Y    + E++  ++
Sbjct: 1322 QFSNLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKD-SAGEPLYKLFKAIKHQVEKGPVDAVQKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGIDA-IPVKVLNCDTISQVKEKIIDQVYRTQPCSCWPKPDSVVL----EWRPGSTAQILSDLDLTSQREGRWKRINTLMHYNVRDGATLILS----------KVGVSQQPEDS-----------QQDLPGERHALLEEENRVWHLVRPTDEVDEG-----------KSKRGSMKEKERTKAITEIYLTRLLS-VKGTLQQFVDNFFQSVLAPGHAVPPAVKYFFDFLDEQAEKHDIRDEDTIHIWKTNSLPLRFWVNILKNPHFIFDVHV--HEVVDASLSVIAQTFMDACTRTEHK---LSRDSPSNKLLYAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQ-YTQKYYDEIINALE 1814          
BLAST of plexin A vs. UniProt/SwissProt
Match: sp|Q9UIW2|PLXA1_HUMAN (Plexin-A1 OS=Homo sapiens OX=9606 GN=PLXNA1 PE=1 SV=3)

HSP 1 Score: 259.225 bits (661), Expect = 6.035e-68
Identity = 325/1437 (22.62%), Postives = 605/1437 (42.10%), Query Frame = 2
Query: 1541 NMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSEN----DKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAE---NKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTA-IGSLS-ASNRLVC-----TFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGND-DSKWINSKF--QKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFK---TKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFV-NNSDIDCISPTTSNITQF------QKCSLLFAME--KGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTV-SGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQ--AAIQDEIHKNWN-----TAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNICVAMKNESL-----PASNTASVSHLESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            ++V++ N   +YA+ + ++ R  + +C   T+CE CL    P CGWC+ +  C  +D C  A   P +    +  C  + V P +           V   +S+ PL + + N       + C F      E         + +  + C  P  + + PI     ++  V L LK            +  YNC+  ++C  CVN  F C WC   + C + ++  C       N   DCP +  S + +   VG    I L  +N     + +  + CL     S A + +L   S+ L C     +++   V   + +  ++ V W  GN +   I+    I+  ++ C  L E C  C+     ++CG+C  + +C  +H C  D  + W++++    +C  P I+++ P        + + + G NLG    DV+  + +     +  C  +E  YIS++Q  C+I + +         +   +      + L  K F F +P  Y + P+ GP  GGT I + GS LN GS  +V  + G  P  C+        I C                  +P  A + +NI+   +   +V++ +  +P + +I     +++GG +  +TG NL  + +P +  +    +     C V N++ + C +P+ +N  +       +   L F M+  +  + + +TS   +  PVL      +S PT LL +     + +    N         + ++ + +G   CT ++     + C              +   L G++ +TV +G  +F  G + + + S++ +  I+ +     +L++VI+   +  K++ R     +  +++  + + +  R   E  +  A +Q +IH+  N       P   Y  Y +  LFP                                HP++  K+++V  N  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  +K  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+ LDCD ++QAK K+ +  YK  PYS           K    ++   +  +A I L++    T        L TL  Y + DG ++ +  K  S       ++ T S+S  ES    L+T  S + +    PM +  PD+     +  L  + H++  Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct:  489 DLVLSPNHQYLYAMTEKQVTRVPVESCVQYTSCELCLGSRDPHCGWCVLHSICSRRDACERADE-PQRFAADLLQCVQLTVQPRN-----------VSVTMSQVPLVLQAWNVPDLSAGVNCSFEDFTESE-------SVLEDGRIHCRSPSAREVAPITRGQGDQRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHVC-THNVADCAFLEGRVNVSEDCPQILPSTQ-IYVPVGVVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNSSYSYEGNDV---SDLPVNLSVVWN-GNFV---IDNPQNIQAHLYKCPALRESCGLCLKADPRFECGWCVAERRCSLRHHCAADTPASWMHARHGSSRCTDPKILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGVRVG----KVLCSPVESEYISAEQIVCEIGDASSVRAHDALVEVCVRDCSPHYRALSPKRFTFVTPTFYRVSPSRGPLSGGTWIGIEGSHLNAGS--DVAVSVGGRP--CSFSWRNSREIRCLTPP------------GQSPGSAPIIININRAQLTNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGG-IERENGCLVYNDTTMVCRAPSVANPVRSPPELGERPDELGFVMDNVRSLLVLNSTSFLYYPDPVL----EPLS-PTGLLELKPSSPLILKGR-NLLPPAPGNSRLNYTVLIGSTPCT-LTVSETQLLC--------------EAPNLTGQHKVTVRAGGFEFSPGTLQVYSDSLLTLPAIVGIGGGGGLLLLVIVAVLIAYKRKSRDADRTL--KRLQLQMDNLESRVALECKEAFAELQTDIHELTNDLDGAGIPFLDYRTYAMRVLFPGIE----------------------------DHPVL--KEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPENENAPEVPVKGLDCDTVTQAKEKLLDAAYKGVPYSQRP--------KAADMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSLSRYES---MLRTASSPDSLRSRTPMIT--PDLESGTKLWHLVKN-HDHLDQREGDRGS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQIHDADVRHTWKSNCLPLRFWVNVIKNPQFVFDI--HKNSITDACLSVVAQTFMDSCSTSEHK 1790          
BLAST of plexin A vs. UniProt/SwissProt
Match: sp|P70207|PLXA2_MOUSE (Plexin-A2 OS=Mus musculus OX=10090 GN=Plxna2 PE=1 SV=2)

HSP 1 Score: 254.218 bits (648), Expect = 2.191e-66
Identity = 364/1695 (21.47%), Postives = 696/1695 (41.06%), Query Frame = 2
Query:  854 LFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEI-MELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYEL---------FEDTNYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSH--LVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNST----AIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWIN--SKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQN-INDRIETPVAF-----QFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCIS--------PTTSNITQFQKCSLLFAMEKGSVCVYNTSITIFSTPVLRINPN-KISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIA-ELNQA--AIQDEIHK-----NWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFE----DELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMF--RQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALK-EVVGYTLKTLKDYDIKDGDNICVAMKNES---LPASNTASVSHLESNSASLK-TNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSK------IKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQN--------------KDV-----WLTQLFSDVIKL 5686
             +  R+VR+C  D  + S++ +   C       Y  + +  +A   + +A  +        I ++ D     +LF  F        Y    +    CA+PI  I +++ + +++ C  G G++  N       D +C +              NF    I    G ++ +    +        + +   +Y  +++  +G   G L K            +E  +       +  +++F++    N+  +Y +++ ++ R  + +C   T C +CL    P CGWC  +  C  +D+C  A W   +   ++  C  + V P+   +  S+ S  +   V+  P   LSE    + C F +     +  V+    +    + CI P  K++P I  ++++  L+L++   ++    V   +  YNC+  + C  CVN+ F C WC   N C       C       N   DCP L V  E +   VG    I L  +N     + +  + C+ +   +     A+   S+S +   +      +  +++     V W  GN +   I+    ++  ++ C    E C  C+     ++CG+C+ + +C     C +  S W++  S   KC  P I EI+  +      + + + G NLG   +++ + + +        C  I   YI ++Q  C++ + +      PV       + +F TK      +++ F +P V S+ P  GP  GGT++ + G +L  GS   V     T    C       N I C           +    S+      + +++D   +  + +QFE+  +P V++I     +++G     ITG NL+ + +P V  +     S+     VN + + C++        P    + +  +   LF   + S+ +YN +  I+       NP  ++  PT +L       + +  + N     S   + ++ + +G   CT ++     + C   E   +   HK  + +          G + F  G +S+ + S++ +  I+ +     +L++++I+  +  K   R  +EN  T K ++   + L+  +A E  +A   +Q +I++     + +  P   Y  Y +  LFP                                HP++  ++++V  N  ++  K  KLF     +++F+L F   LE  +    + + ++ S +   L   L   T +LK L+ +  DK   N+    +   R   +  K+L+NWF  L++  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++IE+K L L   +   EN  E+ V+VL+CD I+Q K KI + +YK  PYS         L +  Q  +         I  K E     L TL  Y + D   + +  K  S   +PAS + S + +    +S + T    ++   +PM +  PD+   + +  L  + H++  QK        +   Y T++ A K               L+  ++   + LF  +    ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K +    CL  V++  MD CS +++              KD+     W+ + ++D+ KL
Sbjct:  275 FYTSRIVRLCKDDPKFHSYVSLPFGC-TRAGVEYRLLQAAYLAKPGEALAQAFN-------ISSDED-----VLFAIFS--KGQKQYHHPPDDSALCAFPIRAINLQIKERLQS-CYHGEGNLELN--WLLGKDVQCTKAPVPID-------DNFCGLDINQPLGGSTPVEGLTLYTTSRDRLTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVFKDGSPILRDMAFSI----NQLYLYVMSERQVTRVPVESCEQYTTCGECLSSGDPHCGWCALHNMCSRRDKCQRA-WEANRFAASISQCMSLEVHPNS--ISVSDHSRLLSLVVNDAP--NLSEG---IACAFGN-----LTEVEGQ--VSGSQVICISPGPKDVPVIPLDQDWFGLELQLRSKETGKIFVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPT-TCSFQEGRINVSEDCPQL-VPTEEILIPVGEVKPITLKARNLPQPQSGQRGYECVLSIQGAVHRVPALRFNSSSVQCQNSSYQYDGMDISNLAVDFAVVWN-GNFI---IDNPQDLKVHLYKCAAQRESCGLCLKADHKFECGWCSGERRCTLHQHCPSTSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAG----VPCTPIPGEYIIAEQIVCEMGHAVIGTTSGPVRLCIGECKPEFMTKSH----QQYTFVNPSVLSLSPIRGPESGGTMVTITGHYLGAGSSVAVYLGNQT----CEFYGRSMNEIVC-----------VSPPSSNGLGPVPVSVSVDRARVD-SSLQFEYIDDPRVQRIEPEWSITSGHTPLTITGFNLDVIQEPRVRVKFNGKESVNVCTVVNTTTLTCLAPSLTSDYRPGLDTVERPDEFGFLFNNVQ-SLLIYNDTKFIYYP-----NPTFELLSPTGILDQKPGSPIILKGK-NLCPPASGGAKLNYTVMIGETPCT-VTVSETQLLC---EPPNLTGQHKVMVHV----------GGMVFSPGSVSVISDSLLTLPAIISIAAGGSLLLIIVIIVLIAYK---RKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRSGIPYLDYRTYAMRVLFPGIE----------------------------DHPVL--RELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDL-EWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTSISRYDSSFRYTGSPDSLRSRVPMIT--PDLESGVKVWHLVKN-HDHGDQKEGDRGSKMVSEIYLTRLLATKG-------------TLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADRHSIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKNWVERYYADIAKL 1821          
BLAST of plexin A vs. UniProt/SwissProt
Match: sp|O75051|PLXA2_HUMAN (Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 SV=4)

HSP 1 Score: 199.134 bits (505), Expect = 1.540e-49
Identity = 220/1063 (20.70%), Postives = 429/1063 (40.36%), Query Frame = 2
Query:  413 FADSYLVVCYDVFQGFCEII---DLYNQFSSSYKNKAY-SIVTNDRKFHSTVLY---HDQRLFFANEVYHPSNYREIDFNTMSILSFPN--MTYFKPDYPFQANF-GKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKH-----EPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEI-MELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYEL---------FEDTNYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSH--LVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNS----TAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWIN--SKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQN-INDRIETPVAF-----QFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPT 3481
            ++++ L+ C  ++QG C+++   DL+     S+K + Y S V      +  ++     D +LF    V    +Y    F T+S    P    +    DY   ++F   L+    +T+  +     F+IY      F    ++FL  QPE           +  +  R+VR+C  D  + S++ +   C       Y  + +  +A   D +A  +        I ++ D     +LF  F        Y    +    CA+PI  I +++ + +++ C  G G++  N       D +C +              NF    I    G ++ +    +        + +   +Y  +++  +G   G L K            +E  + L     +  +++F++    ++  +Y +++ ++ R  + +C   T C +CL    P CGWC  +  C  +D+C  A W P +   ++  C  + V PS   +  S  S  +   VS  P     +    + C F +     +  V+    +    + CI P  K++P I  ++++  L+L++   ++    V   +  YNC+  + C  CVN+ F C WC   N C       C       N   DCP L V  E +   VG    I L  +N     + +  + C+     +     A+   S+S +   +      +  +++     V W  GN +   I+    ++  ++ C    E C  C+   + ++CG+C+ + +C     C +  S W++  S   KC  P I EI+  +      + + + G NLG   +++ + + +        C  +   YI ++Q  C++ + +      PV       + +F TK      +++ F +P V S+ P  GP  GGT++ + G +L  GS   V     T    C       + I C           +    S+      + +++D   +  +++QFE+  +P V++I     +++G     ITG NL+ + +P +  +     S+     VN + + C++P+
Sbjct:  121 YSENRLLACGSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKTGTMYGVIVRSEGEDGKLFIGTAVDGKQDY----FPTLSSRKLPRDPESSAMLDYELHSDFVSSLIKIPSDTLALVSHFDIFYIYGFASGGF----VYFLTVQPETPEGVAINSAGDLFYTSRIVRLCKDDPKFHSYVSLPFGC-TRAGVEYRLLQAAYLAKPGDSLAQAFN-------ITSQDD-----VLFAIFS--KGQKQYHHPPDDSALCAFPIRAINLQIKERLQS-CYQGEGNLELN--WLLGKDVQCTKAPVPID-------DNFCGLDINQPLGGSTPVEGLTLYTTSRDRMTSVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPILRDMAFSI----DQRYLYVMSERQVTRVPVESCEQYTTCGECLSSGDPHCGWCALHNMCSRRDKCQQA-WEPNRFAASISQCVSLAVHPSS--ISVSEHSRLLSLVVSDAP-----DLSAGIACAFGN-----LTEVEGQ--VSGSQVICISPGPKDVPVIPLDQDWFGLELQLRSKETGKIFVSTEFKFYNCSAHQLCLSCVNSAFRCHWCKYRNLCTHDPT-TCSFQEGRINISEDCPQL-VPTEEILIPVGEVKPITLKARNLPQPQSGQRGYECVLNIQGAIHRVPALRFNSSSVQCQNSSYQYDGMDISNLAVDFAVVWN-GNFI---IDNPQDLKVHLYKCAAQRESCGLCLKADRKFECGWCSGERRCTLHQHCTSPSSPWLDWSSHNVKCSNPQITEILTVSGPPEGGTRVTIHGVNLGLDFSEIAHHVQVAG----VPCTPLPGEYIIAEQIVCEMGHALVGTTSGPVRLCIGECKPEFMTKSH----QQYTFVNPSVLSLNPIRGPESGGTMVTITGHYLGAGSSVAVYLGNQT----CEFYGRSMSEIVC-----------VSPPSSNGLGPVPVSVSVDRAHVD-SNLQFEYIDDPRVQRIEPEWSIASGHTPLTITGFNLDVIQEPRIRVKFNGKESVNVCKVVNTTTLTCLAPS 1101          

HSP 2 Score: 110.923 bits (276), Expect = 9.838e-23
Identity = 131/512 (25.59%), Postives = 231/512 (45.12%), Query Frame = 2
Query: 4277 HPLIVNKQIQVIENTVEYSRKLSKLFE----DELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMF--RQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALK-EVVGYTLKTLKDYDIKDGDNICVAMKNES---LPASNTASVSHLESNSASLK-TNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSK------IKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQN--------------KDV-----WLTQLFSDVIKL 5686
            HP++  ++++V  N  ++  K  KLF     +++F+L F   LE  +    + + ++ S +   L   L   T +LK L+ +  DK   N+    +   R   +  K+L+NWF  L++  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++IE+K L L   +   EN  E+ V+VL+CD I+Q K KI + +YK  PYS         L +  Q  +         I  K E     L TL  Y + D   + +  K  S   +PAS + S + +    +S + T    ++    PM +  PD+   + +  L  + H++  QK        +   Y T++ A K               L+  ++   + LF  +    ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K +    CL  V++  MD CS +++              KD+     W+ + ++D+ KL
Sbjct: 1332 HPVL--RELEVQGNGQQHVEKALKLFAQLINNKVFLLTFIRTLELQRSFSMRDRGNVASLIMTGLQGRLEYATDVLKQLLSDLIDKNLENKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNVPYSQRPRAVDMDL-EWRQGRIARVVLQDEDITTKIEGDWKRLNTLMHYQVSDRSVVALVPKQTSSYNIPASASISRTSISRYDSSFRYTGSPDSLRSRAPMIT--PDLESGVKVWHLVKN-HDHGDQKEGDRGSKMVSEIYLTRLLATKG-------------TLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADRHSIHDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDI--HKGSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYADIAKL 1821          
BLAST of plexin A vs. UniProt/SwissProt
Match: sp|Q9V4A7|PLXB_DROME (Plexin-B OS=Drosophila melanogaster OX=7227 GN=PlexB PE=1 SV=2)

HSP 1 Score: 180.259 bits (456), Expect = 8.985e-44
Identity = 259/1167 (22.19%), Postives = 452/1167 (38.73%), Query Frame = 2
Query:  197 HKSILVSGKNYILQFSENNLKEPLAIRKTGPVNHSVMCTEPNQCQTSLCPKELISRDQCRIKLTDVFVKLWTFA---DSYLVVCYDVFQGFCEIIDLYNQFSSSYKNKAYSIVTNDRKFHSTVLYHDQR--------LFFANEVYHPSNYREIDFNTMSILSFPNMTYFKPDYPFQANFGKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCD-IDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKS---TDKRCMEDGFTSTGKGECGGKNFNKFIIGDHY-GENSIIGHRVIS-RNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDT--NYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRV-SPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSE------------NDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSH--LVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSA---SNRLVCTFQM--MKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEH-----CDDCVHLPQIYKCGFCTVKDKCVQKHICGNDD---SKWINSKFQ-KCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITL-----ENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSI--------QFTDVQFEFFP-----------NPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSD-IDCISP 3478
            H  +     N IL+ +EN     LA   TGP++ S       QC    CP+++         L + F K+   +   D  L+ C  + QG CEI  L  +F ++ +  A  +  ND    +       R        L+      +  +YR  D   +S     ++ Y   ++  Q +   +  +  +  F ++++  F+  +         Y +F++ Q +  H      +  RL RIC  D +Y S+ +I + C   +N   Y  V    V   S  +A            K  +  D H +L   F      +N  E+ ++   C Y I +I +++  + N+ L  +G+  +    + S    D RC   G          G  +N   +G    G + I  H +    N          +  ++ +LA +G N G++ K  L   +   Y     +  N I  N +++  K  +Y ++  KI +  + +C   TNC  CL    PFCGWC    +C V+  C           R   A   +++      +E+ +  P       K P+S LS             N K+ +C F ++   +         I  + L C  P     P I  N + + + L V  ++++   V   +  ++C+H   C  C+ + + C+WC+ DN C+  SL +C+      +    CP L+ +   +   V  PI I L  +N     ++   F+C  T     A   L A   SN++V   +      +     +  + V+W   + +  +I T       ++ C  L  H     C  CV     YKC +C+  + CV    C  D    S    S  + +CPLP I  I P +  +   ++I ++G NLG  E DV+  I +     E  ++Q   K   ++  S  +    I+  ND   T  + QF FK              +  +  + P  GP  GGT + + G FLNIGS      +     I  ++ +   + +SC  ++    + +       +    +L+  I   SI         F   Q    P           +P + +I   +   +GG++  + G  LN + KP +    +       +C V NS+ ++C SP
Sbjct:   96 HNVLFAGATNKILKLNEN--LRVLAEAVTGPLHDS------PQCHAGGCPEDI------ETSLVNNFNKILVVSYAHDGILIACGSIRQGACEIYSL-PRFPATPQFFAVPLAANDENASTYAFVGPARYAWKEEDILYVGTTFTNVGDYRH-DVPAISSRRLDDLNY--AEFSIQQSIINIDVKYRDH-FLVDYIYGFNSSE---------YAYFIIVQ-KKSHLADEAGYVTRLARICITDPNYDSYTEITVQCTATENNVDYNIVRDAKVTPASHKLAQ-----------KMGIKKDDH-VLVTVFSPSREISNQPESKSAM--CIYSIKDIEDMF--IENIHLCFNGTTKDRNLGYISGTINDGRCPIVGSL--------GNIYNFCSVGLKISGVSPITAHALFHFDNVSVTSVTATSTTDQQHSLAFLGTNMGVIKKVLLSGQSPGEYEEIVVDAGNRILPNTMMSPKKDFLYVLSQRKITKLRIEHCSVYTNCSACLESRDPFCGWCSLEKRCTVRSTC----------QRDTSASRWLSLGSGQQCIEFESIIP------EKIPISELSHLHLIIRTLPEPFNAKY-RCVFGNSTPIDAE-------ILENGLGCATPPLDERPLIPTNTDHILVPLSVRSSETNKDFVSRNFAFFDCSHHGNCQECLQSSWGCNWCIFDNKCVHKSL-QCRNIENAVSTVGHCPHLKKNRPEILLPVRVPIEIRLEIENLPKPKSAHAGFLC--TIHIEAAQMLLPAHVESNKIVVCEKTPYFYEINTHEYQAKVVVTWNFQHYVDTAIVT-------LYKCDVLGSHREHPDCSLCVTRDPKYKCAWCS--NSCVYNETCIADKNSISSGSKSAIENECPLPRIDIIKPLSGPVEGGTLITIEGSNLGIREEDVRGKIFIGSVPCELENYQISVKIECRTGASLYEMSAPIKVANDAGFTESSVQFHFK--------------NVLLTGLYPTIGPRSGGTQLSLIGKFLNIGSTMRAFLDEYECHI--DVTQASSSQVSCTTSEATQPEPIRSLHLVIDGANRTLECQISTPSITNTNPTRSNFGSYQLRSLPRQPCSIFNYTQDPRIMQIKPLRSFKSGGRVLTVHGIYLNSIQKPELEVFYDNERVNKTSCVVINSNQMECPSP 1157          

HSP 2 Score: 95.5153 bits (236), Expect = 4.518e-18
Identity = 210/937 (22.41%), Postives = 393/937 (41.94%), Query Frame = 2
Query: 2990 PRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFK----RSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPTTSNITQFQKCSLLFAMEKGSVCVYNTSI---TIFSTPVLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRC-----NIIEVNQIDIYHKYQISLLM---GKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEAN--EVLKRGIAELNQAAIQDEIHKNWNTA-PIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKL---SKLFEDELFVLMFFSFLEDHQEVES--KKSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMFRQSD-LLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYS----------NWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGY-TLKTLKDYDIKDGDNICVAMK---NESLPASNTASVSHLES----NSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDY-----ESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            PR+  I+P      GG ++ V+G +LN   + E++  Y    +      N+ + +    N  E     + +K    + +N +K   +L++  +S Q T+ +++   N + +K  +  F           GD           FR  T      N FVNN ++D  +    + TQ     L F M+   + V N +     I ST V   +P  +  P + +++ K   + I  E+ +     A  + D  + +G   C   S   N + C       +  ++  +     + L++   G+N+  V GY++++     + + ++++ I  + +++ + ++V++I  +K    +R   E + I  + I  E+N     K+  AEL Q  + D      +T  P   ++ YI+   FP                                HP++ + + +       Y   +    +L  ++ F+LMF   LE  +   S   + ++ S + ++LM  +   T ILK L+    DK   ++  + M R+++ ++ K+L+N+  I MYD+L+   AG +L +L+  I + I  G V+  T+ ++Y+L+E  LL  ++    + L +  +    D ++   V D D ISQ KLKI + I+K +P+S           W       L   ++D           +  K V G+  L TL  Y +K+   + +  +   N  +P S   + +   +    N++      + +I   +        +   IP H ++    +NS             ++   D  +     +  T++L +K  G I+   DD F       E +P  V  LF   +   +     D  IV A KSN L LRFW+  I N DF+FDV   K   V  CL  +++  MD CS ++++
Sbjct: 1097 PRIMQIKPLRSFKSGGRVLTVHGIYLNSIQKPELEVFYDNERV------NKTSCVVINSNQMECPSPPVNYKFETFKKTN-RKMDTELHLQNSSFQ-TETRYK---NEYDRKKRRADF-----------GD----------TFRLYTNAGSSANYFVNN-NMDVTTFVKVHETQLN-LQLSFVMDNVQL-VRNLNKYFHDIRSTIVYLADPKYLPFPNDGVKLYKGDSLVIEGELLNL----AADEYDVNVTIGTSQCNITSLALNQLLCIPPEQQPLPTDENGVDQSTDLPLVVVKVGRNLRFVIGYLKYDLNKPYVFSHALLVGILTVALLVVVFVIVLIIFRRKSTQAER---EYKRIQIQMITLESNVRSECKQAFAEL-QTDMTDLTADLESTGIPTLDHVNYIMKVFFPGVS----------------------------DHPILNSPKFREGSPQTNYDAAMVQFEQLIGNKYFLLMFIETLEAQRSSFSIRDRVNVASLIMVVLMNKMEYATEILKSLLLRLIDKSLASKHPQLMLRRTESVVEKMLTNYLAICMYDYLKEY-AGSNLFLLFKAIKHQIEKGLVDAITNDARYSLSEERLLHEQVTHSVVILHILQDDL--DEKVQCRVNDWDTISQVKLKILDAIFKNTPFSMRPSVNEVDLEWRHGRGGHLTLQDED-----------LTTKTVNGWKRLNTLAHYGVKESAVMSLIARQNDNYHIPYSKNQNSAPYHNFYFINNSQSHIIINNDIESGLQQPRVYHLVKPNIPDHYMNI---KNSVLSGGSPAFQSHVVNNCNDRVNKTIPEVYLTRLLATK--GTIQKFVDDFFSIILTVNEELPPAVKWLFDLLDEAARRHDIADTDIVHAWKSNCLPLRFWVNFIKNPDFIFDVN--KTYSVDSCLSVIAQTFMDACSTSEHR 1941          
BLAST of plexin A vs. UniProt/SwissProt
Match: sp|P70206|PLXA1_MOUSE (Plexin-A1 OS=Mus musculus OX=10090 GN=Plxna1 PE=1 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.916e-42
Identity = 157/677 (23.19%), Postives = 286/677 (42.25%), Query Frame = 2
Query: 1526 NNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSEN----DKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAE---NKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTA-IGSLS-ASNRLVC-----TFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDD-SKWINSKF--QKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKD---KYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFV-NNSDIDCISPTTSN 3490
            N I  ++V++ N+  +YA+ + ++ +  + +C   T+CE CL    P CGWC+ +  C  +D C  A   P +    +  C  + V P +           V   +S+ PL + + N       + C F   +  E  ++     IH HS     P  + + PI +   ++  V L LK            +  YNC+  ++C  CVN  F C WC   + C +++   C       N   DCP +  S   +   VG    I L  +N     + +  + CL     S A + +L   S+ L C     +++   V   + +  ++ V W  GN +   I+    I+  ++ C  L + C  C+     ++CG+C  + +C  +H C  D  + W+++     +C  P I+++ P        + + + G NLG    DV+  + +     +  C  +E  YIS++Q  C+I + +         +   +      + L  K F F +P  Y + P+ GP  GGT I + GS LN GS  +V  + G  P  C+        I C                   P  A + +NI+   +   +V++ +  +P + +I     +++GG +  +TG NL  + +P +  +    +    +C V N++ + C +P+  N
Sbjct:  482 NPILRDLVLSPNRQYLYAMTEKQVTQVPVESCVQYTSCELCLGSRDPHCGWCVLHSICSRQDACERAEE-PQRFASDLLQCVQLTVQPRN-----------VSVTMSQVPLVLQAWNVPDLSAGVNCSF--EDFTETESILEDGRIHCHS-----PSAREVAPITQGQGDQRVVKLYLKSKETGKKFASVDFVFYNCSVHQSCLACVNGSFPCHWCKYRHVCTNNA-ADCAFLEGRVNMSEDCPQILPSTH-IYVPVGVVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSSLQCQNSSYSYEGNDV---SDLPVNLSVVWN-GNFV---IDNPQNIQAHLYKCPALRQSCGLCLKADPRFECGWCVAERRCSLRHHCPADSPASWMHAHHGSSRCTDPKILKLSPETGPRQGGTRLTITGENLGLRFEDVRLGVHVG----KVLCSPVESEYISAEQIVCEIGDASTLRAHDALVEVCVRDCSLHYRALSPKRFTFVTPTFYRVSPSRGPLSGGTWIGIEGSHLNAGS--DVAVSIGGRP--CSFSWRNSREIRCLTPP------------GHTPGSAPIVININRAQLSNPEVKYNYTEDPTILRIDPEWSINSGGTLLTVTGTNLATVREPRIRAKYGG-IERENSCMVYNDTTMVCRAPSIDN 1109          

HSP 2 Score: 102.834 bits (255), Expect = 2.665e-20
Identity = 124/487 (25.46%), Postives = 225/487 (46.20%), Query Frame = 2
Query: 4277 HPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNICVAMKNESL-----PASNTASVSHLESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            HP++  K+++V  N  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  +K  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+ L+CD ++Q K K+ + +YK  PYS           K    ++   +  +A I L++    T        L TL  Y + DG ++ +  K  S       ++ T S+S  ES    L+T  S + +    PM +  PD+     +  L  + H++  Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct: 1337 HPVL--KEMEVQANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLNCVNPEHENAPEVPVKGLNCDTVTQVKEKLLDAVYKGVPYSQRP--------KAGDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQTSAYNISNSSTFTKSLSRYES---MLRTASSPDSLRSRTPMIT--PDLESGTKLWHLVKN-HDHLDQREGDRGS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQIHDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDI--HKNSITDACLSVVAQTFMDSCSTSEHK 1788          
BLAST of plexin A vs. TrEMBL
Match: A0A0K0LJ46 (Plexin A (Fragment) OS=Schmidtea mediterranea OX=79327 GN=plxnA PE=2 SV=1)

HSP 1 Score: 1893.63 bits (4904), Expect = 0.000e+0
Identity = 989/992 (99.70%), Postives = 990/992 (99.80%), Query Frame = 2
Query: 1733 PFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPTTSNITQFQKCSLLFAMEKGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESKKSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETS 4708
            PFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPTTSNITQFQKCSLLFAMEKGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLL+GKNVLTVSGYIQFEKGDISLDNMSVIII  IMVVIIFIIILVVVIIVKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYNESKNINESIINLNYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESKKSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDLLILYLNILNIINNGPVNWETS
Sbjct:    1 PFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPTTSNITQFQKCSLLFAMEKGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLIGKNVLTVSGYIQFEKGDISLDNMSVIIITTIMVVIIFIIILVVVIIVKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYNESKNINESIINLNYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESKKSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDLLILYLNILNIINNGPVNWETS 992          
BLAST of plexin A vs. TrEMBL
Match: A0A016RRU9 (Sema domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0392.g578 PE=4 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 3.535e-80
Identity = 458/1966 (23.30%), Postives = 780/1966 (39.67%), Query Frame = 2
Query:  206 ILVSGKNYILQFSENNLKEPLAIRKTGPVNHSVMCTEPNQCQTSLCPKELISRDQCRI--KLTDVFVKLWTFAD--SYLVVCYDVFQGFCEIIDLYNQFSSSYKNKAYSIVTNDRKFHSTVLY-----HDQRLFFANEVYHPSNYREIDFNTMSILSFPNMTYFKPDYPFQANFGKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYR--ETFNSFVTCAYPIAE---------IMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFE-DTNYLFSTENLFNN---ISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGT-NCEDCL-RVSPFCGWCISNGKCVVKDQC------TTAMWLPFQRNRTVKACPLI-NVIPSH---SILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLIND--SHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSL--GKCKKNFEI----------QNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEF-----------------------QVFDCLKLSEHCDDCVHLPQI-YKCGFCTVKDKCVQKHIC-GNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDR-IETPVAFQFKFKTKDKYLVSK-EFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFE-----VKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPS-VAFRCETFLSIYENCFVNNSDID-CISPTTSNITQFQKCSLLFAMEKGSVCVYNTSITIFSTP-VLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXX-----XXXXXKKVQSKQR-LRHEKENIFT--EKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIE-NTVEYS-RKLSKLFEDELFVLMFFSFLEDHQEVESKKSDIVSFLSLILMKDLPNY-TRILKILIKNDYDK---KKLNEEERSMFRQSDLLS-KLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXX-XXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCL---IKLNQDEVPE---SERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMT---SFLPDISKRIPIHRLSDSLH-ENSSQKSKIKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDYES----VPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNKDVWLTQ-------LFSDVIKLYSPKVLNYYEGI 5722
            + V+G NY+     ++L   +    TGP++ S      +QC+           D C      T+   K     D  S L+ C  +FQG C + +L+N  S         ++ ND    + V        +  L+          +R+ D   ++ L          ++       K +  G E     +F  S+ I D         Y +F   Q     E  +   Q RLVR+C+ D  + S+ ++ + C I +   Y  +    VA    ++A            K+   S+  ++L+  F    +T+  R   T  S V C YPI +         IME Y            ++ + P+ FKS+D    +    S    ECG ++ NK I G       I    +++ +  + ++ I  +     T+A IG +DG L K  + + DT  +++TE +  N   I  ++  +EN    Y +  SK+++    NC  G   C  CL +  PFCGWC+ N  C  +D C      T++ WL FQ NR    CP I  V+P     +  +Y N S           L  + +    L+C F   + + + +  A    H+ +L C  P    +P I  N++     L ++     + +    +  Y+C    +C+ C  ++F C WC+  N C++  L   KC+K   +          +     CP +   +  L    G   +I +  +N    F   T+F C         +GS+      V TF         +I C        G  L G      P+EF                       +V+ C  L+ +C  C+ L    Y+CG+C + ++CV+   C       W+NS  Q C  P+I E  P    +  ++ + + G NLG    DV  A+ + N H    C  I   Y  + +  C+      +  + P+  + +    +   VSK +F++  P V +++PN GP  GGT + + G+ L+ GS  EV  ++G   + C +L  + + + CR+   +        K +R     +P +   QL             +EF  NP V  I   K ++ GG    + G+    L +P  V       +     C V +  +  C+SP   +     +    FA +       +  + ++  P V +    +   P +         +TIN    D ++V A  + D KI VG + C   +     + C            K  +   +   V+   G I F  G +S D+ S+   I ++++   I +LV      ++  +K  S QR +++ K  + T   K+  E  E        LNQ     ++       P   Y  Y    LFP                           N+P  HP++ + ++   +   +E   R+  KL  ++ F L     +E ++    K    V  L ++++++   Y T +LK L++   D+   KK   + + +FR+S+ ++ ++L+ WF  LM+D+L+N  AG  L  LY  I   +  GP +  T +++Y+L+E  LL       +               ++ V VLDCD I+Q K K  +  Y+  PYS+  S     L     +N   V +   S   + P   K      L TL  Y++ +   + +A +  SL   N + +S   S  ++L    S  +S+    T   S   D   +   H +  S H    +Q+  +   Y T++                  ++K  ++  I +L + IF   S    +P  +  +F   +         D  +V A KSN+L LRFW+ LI N  F+FD+   K T V  CL  V++ LMD CS    +D  LT+       LF+  +  Y   V +YY  I
Sbjct:   10 LYVAGVNYLYDLHSSDLSVRVEA-VTGPMDDS------DQCKGG-------RNDSCTAIRHKTNSHAKALAVYDKSSQLIECTSLFQGRCRLRNLHN-ISDVQIESPEPMIANDAGSSAVVFVGMGPSREPVLYVGTTFVKGPLFRD-DIPAVTSLRLSRGDGEAKEFELA---DKGLATGTEISLERKFRSSYRI-DYVGGFESGRYAYFATRQGATIGE--DAPIQSRLVRVCTGDAHFYSYTEVPLEC-IKHDINYNLIQDVYVATAGYNLA------------KSLGISEGDEVLYGVFVADDMTSFQRNFPTRRSAV-CVYPIQKHVEKKFEENIMECYR---------GKNLKQLPW-FKSSDG--CKGTHLSWKDVECG-QDVNKNIGGG----KPISAEPLLTVDDAR-FTAIAINTTRGATVAFIGTDDGRLLKTIIHDSDTAEVYATEEISPNHEPILADLDFSENGQYAYVLTPSKVVKMRTSNCGEGAATCVTCLAKRDPFCGWCVKNSICTEEDTCEKVLPKTSSGWLDFQNNR----CPNIKGVVPDKIQITTADYLNVS-----------LENMGDIKGRLQCSFRFADGKVVNSEPARQDPHDGTLRCATPPINRLPMIPPNESHHLATLSIVAEGRITPIASTNFSFYDCNRYTSCSTCAKSEFPCDWCLESNECVAGKLTEDKCRKQHIVNGLNREGHSRRKGPQKCPHIVAPHTKLYVAAGERRNITVKVQNLDPIF--MTEFRC------QFRVGSVEHEKPAVKTFD-------DNIICDEMQFDHYGLGLAGGT---APVEFSVVWSSSESSKKHTLDNVGGVAVEVYKCEALASNCGRCLTLDATKYECGWCAIDNRCVRPMACLAKSPQDWLNST-QLCANPAIEEFSPKKGPVGGKTKLRITGSNLGRRYQDVSGAVIVANVH----CAVIPAEYQPATEIVCETGKAAIKNSKGPIVVRLRADDANYAAVSKYDFEYVEPGVSAVKPNRGPKSGGTDVTLYGTDLDAGS--EVHVSFGE--VKCEVLSRKPDQLICRMGAMDSDMGVSSSKPLRLDFDGSPGRVPYQLT------------YEFVSNPRVSTIVPAKSIAAGGVQIDVKGEGFALLQRPRMVLINDRGVIQAGPVCEVEDDGLMVCLSPGLPSGDTGGRLHHNFAFDFDGTITESRQMEVYPNPKVDQFAETRFYRPGD-------NYLTIN---GDDLNVGAMER-DIKITVGGVDCQLTALARKVLTCK-------PPTEKPNLEGGLQPEVVVKIGNISFNAGQLSYDSPSLTSGIVMVILGCIIAMLVCFVCLAIMYRRKTNSHQRQMKYLKTQMDTIEMKVATECKEAFAELQTSLNQYTA--DLPLGTPIVPFLDYKDYCARVLFP---------------------------NNPHNHPVLRDLEVDSQKAGAIEAGLREFHKLLMNKTFFLTMVRTMESNKYFLGKDRVYVGSLIMVVLQEKMGYCTEMLKQLLRELIDRTVEKKF--QPKILFRRSESVAERMLAAWFTFLMHDYLRNF-AGKRLYDLYWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELTIFIAADSMTYTQPDMPVRVLDCDTITQVKEKCLDAKYRTVPYSDRPSANDLDLEWRTGINGRMVLQDIDSTSRVEPGGWKR-----LNTLGHYNVPNNSVLMLATRQNSL--YNLSLLSE-RSEKSTLSLKNSPTLSRPWVGTNSSSNSKDAEGQKLYHLVKPSEHGPTENQEKMVTEIYLTRL-----------------LMMKGTLQKFINDLLEAIFSTSSRSAPLPAAIKYMFDFMDEQALEHGITDAEVVHAWKSNALPLRFWVNLIKNPHFVFDIQ--KPTKVEGCLSVVAQTLMDACS---TQDHQLTKDSPSSKLLFAKDMYQYRDWVDSYYSDI 1787          
BLAST of plexin A vs. TrEMBL
Match: A0A016RT13 (Sema domain-containing protein OS=Ancylostoma ceylanicum OX=53326 GN=Acey_s0392.g578 PE=4 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 4.764e-80
Identity = 458/1966 (23.30%), Postives = 780/1966 (39.67%), Query Frame = 2
Query:  206 ILVSGKNYILQFSENNLKEPLAIRKTGPVNHSVMCTEPNQCQTSLCPKELISRDQCRI--KLTDVFVKLWTFAD--SYLVVCYDVFQGFCEIIDLYNQFSSSYKNKAYSIVTNDRKFHSTVLY-----HDQRLFFANEVYHPSNYREIDFNTMSILSFPNMTYFKPDYPFQANFGKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYR--ETFNSFVTCAYPIAE---------IMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFE-DTNYLFSTENLFNN---ISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGT-NCEDCL-RVSPFCGWCISNGKCVVKDQC------TTAMWLPFQRNRTVKACPLI-NVIPSH---SILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLIND--SHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSL--GKCKKNFEI----------QNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEF-----------------------QVFDCLKLSEHCDDCVHLPQI-YKCGFCTVKDKCVQKHIC-GNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDR-IETPVAFQFKFKTKDKYLVSK-EFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFE-----VKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPS-VAFRCETFLSIYENCFVNNSDID-CISPTTSNITQFQKCSLLFAMEKGSVCVYNTSITIFSTP-VLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXX-----XXXXXKKVQSKQR-LRHEKENIFT--EKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIE-NTVEYS-RKLSKLFEDELFVLMFFSFLEDHQEVESKKSDIVSFLSLILMKDLPNY-TRILKILIKNDYDK---KKLNEEERSMFRQSDLLS-KLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXX-XXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCL---IKLNQDEVPE---SERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMT---SFLPDISKRIPIHRLSDSLH-ENSSQKSKIKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDYES----VPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNKDVWLTQ-------LFSDVIKLYSPKVLNYYEGI 5722
            + V+G NY+     ++L   +    TGP++ S      +QC+           D C      T+   K     D  S L+ C  +FQG C + +L+N  S         ++ ND    + V        +  L+          +R+ D   ++ L          ++       K +  G E     +F  S+ I D         Y +F   Q     E  +   Q RLVR+C+ D  + S+ ++ + C I +   Y  +    VA    ++A            K+   S+  ++L+  F    +T+  R   T  S V C YPI +         IME Y            ++ + P+ FKS+D    +    S    ECG ++ NK I G       I    +++ +  + ++ I  +     T+A IG +DG L K  + + DT  +++TE +  N   I  ++  +EN    Y +  SK+++    NC  G   C  CL +  PFCGWC+ N  C  +D C      T++ WL FQ NR    CP I  V+P     +  +Y N S           L  + +    L+C F   + + + +  A    H+ +L C  P    +P I  N++     L ++     + +    +  Y+C    +C+ C  ++F C WC+  N C++  L   KC+K   +          +     CP +   +  L    G   +I +  +N    F   T+F C         +GS+      V TF         +I C        G  L G      P+EF                       +V+ C  L+ +C  C+ L    Y+CG+C + ++CV+   C       W+NS  Q C  P+I E  P    +  ++ + + G NLG    DV  A+ + N H    C  I   Y  + +  C+      +  + P+  + +    +   VSK +F++  P V +++PN GP  GGT + + G+ L+ GS  EV  ++G   + C +L  + + + CR+   +        K +R     +P +   QL             +EF  NP V  I   K ++ GG    + G+    L +P  V       +     C V +  +  C+SP   +     +    FA +       +  + ++  P V +    +   P +         +TIN    D ++V A  + D KI VG + C   +     + C            K  +   +   V+   G I F  G +S D+ S+   I ++++   I +LV      ++  +K  S QR +++ K  + T   K+  E  E        LNQ     ++       P   Y  Y    LFP                           N+P  HP++ + ++   +   +E   R+  KL  ++ F L     +E ++    K    V  L ++++++   Y T +LK L++   D+   KK   + + +FR+S+ ++ ++L+ WF  LM+D+L+N  AG  L  LY  I   +  GP +  T +++Y+L+E  LL       +               ++ V VLDCD I+Q K K  +  Y+  PYS+  S     L     +N   V +   S   + P   K      L TL  Y++ +   + +A +  SL   N + +S   S  ++L    S  +S+    T   S   D   +   H +  S H    +Q+  +   Y T++                  ++K  ++  I +L + IF   S    +P  +  +F   +         D  +V A KSN+L LRFW+ LI N  F+FD+   K T V  CL  V++ LMD CS    +D  LT+       LF+  +  Y   V +YY  I
Sbjct:   15 LYVAGVNYLYDLHSSDLSVRVEA-VTGPMDDS------DQCKGG-------RNDSCTAIRHKTNSHAKALAVYDKSSQLIECTSLFQGRCRLRNLHN-ISDVQIESPEPMIANDAGSSAVVFVGMGPSREPVLYVGTTFVKGPLFRD-DIPAVTSLRLSRGDGEAKEFELA---DKGLATGTEISLERKFRSSYRI-DYVGGFESGRYAYFATRQGATIGE--DAPIQSRLVRVCTGDAHFYSYTEVPLEC-IKHDINYNLIQDVYVATAGYNLA------------KSLGISEGDEVLYGVFVADDMTSFQRNFPTRRSAV-CVYPIQKHVEKKFEENIMECYR---------GKNLKQLPW-FKSSDG--CKGTHLSWKDVECG-QDVNKNIGGG----KPISAEPLLTVDDAR-FTAIAINTTRGATVAFIGTDDGRLLKTIIHDSDTAEVYATEEISPNHEPILADLDFSENGQYAYVLTPSKVVKMRTSNCGEGAATCVTCLAKRDPFCGWCVKNSICTEEDTCEKVLPKTSSGWLDFQNNR----CPNIKGVVPDKIQITTADYLNVS-----------LENMGDIKGRLQCSFRFADGKVVNSEPARQDPHDGTLRCATPPINRLPMIPPNESHHLATLSIVAEGRITPIASTNFSFYDCNRYTSCSTCAKSEFPCDWCLESNECVAGKLTEDKCRKQHIVNGLNREGHSRRKGPQKCPHIVAPHTKLYVAAGERRNITVKVQNLDPIF--MTEFRC------QFRVGSVEHEKPAVKTFD-------DNIICDEMQFDHYGLGLAGGT---APVEFSVVWSSSESSKKHTLDNVGGVAVEVYKCEALASNCGRCLTLDATKYECGWCAIDNRCVRPMACLAKSPQDWLNST-QLCANPAIEEFSPKKGPVGGKTKLRITGSNLGRRYQDVSGAVIVANVH----CAVIPAEYQPATEIVCETGKAAIKNSKGPIVVRLRADDANYAAVSKYDFEYVEPGVSAVKPNRGPKSGGTDVTLYGTDLDAGS--EVHVSFGE--VKCEVLSRKPDQLICRMGAMDSDMGVSSSKPLRLDFDGSPGRVPYQLT------------YEFVSNPRVSTIVPAKSIAAGGVQIDVKGEGFALLQRPRMVLINDRGVIQAGPVCEVEDDGLMVCLSPGLPSGDTGGRLHHNFAFDFDGTITESRQMEVYPNPKVDQFAETRFYRPGD-------NYLTIN---GDDLNVGAMER-DIKITVGGVDCQLTALARKVLTCK-------PPTEKPNLEGGLQPEVVVKIGNISFNAGQLSYDSPSLTSGIVMVILGCIIAMLVCFVCLAIMYRRKTNSHQRQMKYLKTQMDTIEMKVATECKEAFAELQTSLNQYTA--DLPLGTPIVPFLDYKDYCARVLFP---------------------------NNPHNHPVLRDLEVDSQKAGAIEAGLREFHKLLMNKTFFLTMVRTMESNKYFLGKDRVYVGSLIMVVLQEKMGYCTEMLKQLLRELIDRTVEKKF--QPKILFRRSESVAERMLAAWFTFLMHDYLRNF-AGKRLYDLYWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELTIFIAADSMTYTQPDMPVRVLDCDTITQVKEKCLDAKYRTVPYSDRPSANDLDLEWRTGINGRMVLQDIDSTSRVEPGGWKR-----LNTLGHYNVPNNSVLMLATRQNSL--YNLSLLSE-RSEKSTLSLKNSPTLSRPWVGTNSSSNSKDAEGQKLYHLVKPSEHGPTENQEKMVTEIYLTRL-----------------LMMKGTLQKFINDLLEAIFSTSSRSAPLPAAIKYMFDFMDEQALEHGITDAEVVHAWKSNALPLRFWVNLIKNPHFVFDIQ--KPTKVEGCLSVVAQTLMDACS---TQDHQLTKDSPSSKLLFAKDMYQYRDWVDSYYSDI 1792          
BLAST of plexin A vs. TrEMBL
Match: A0A183UAV3 (Sema domain-containing protein OS=Toxocara canis OX=6265 GN=TCNE_LOCUS5623 PE=4 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 1.693e-78
Identity = 439/1890 (23.23%), Postives = 780/1890 (41.27%), Query Frame = 2
Query:  422 SYLVVCYDVFQGFCEIIDLYN-QFSSSYKNKAYSIVTNDRKFHSTVLYHDQR-----------LFFANEVYHPSNYREIDFNTMSILSFPNMTYFKPDYPFQANFGKLVYQGGETIFPLEFVGSFHI-----YDSRKDAFFKNYIFFLVNQPENKHEPKNGLFQV--RLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDT-NYLFSTENLFNN--ISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAM------WLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFT-----SNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVL--INDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSL--GKCKKNF---EIQNNQPD-------CPTLEVSNETLSFHV--GFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKV------LQKASIKCSMKVSWILGNLLTGS-IETETPIEFQVFDCLKLSEHCDDCVHLP-QIYKCGFCTVKDKCVQKHIC---GNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQ--NINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDI-DCISP-------TTSNITQFQKCSLLFAMEKGSVCVYNTS-------ITIFSTPVLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYH-KYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQA--AIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQV-IENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK---KKLNEEERSMFRQSDLLS-KLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXX-XXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSS-------FESYCLIKLNQDEVPESERLLAPIALKEVVGY-TLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDG-HHLKPACLIY-TQVL--KSKIEGQIKNLFDDIFDYE----SVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNKDVWLTQ-------LFSDVIKLYSPKVLNYYEGIKGTGSFN 5743
            S L+ C  +FQG C   +LYN       +    ++V NDR F STV++               L+ A+      +Y + D   ++ LS    T F  D   Q      V  G E     +F G + I     + S +      + +F   QP+  + P    F +  +LVR+C+ D  + S+ ++ + C   N+ TY  +    ++    D+A         S +   ++ D   IL+  F   +  +    T +S + C YP+A +  ++  + N+ +   G  ++N   FKS + RC +  F  +G+    GK+ N +I GD     ++    V++    + ++ +  +     T+A IG +DG L K  +   T  +++ T  +     +  ++ ++     +Y +  S + +  +R+C    +CE CL +  P+CGWC+ N  CV + +CT ++      WL F+  +    CP+I  +            P  +   S + L+I   N   L  + T      N +  +  +          + C  P    +P I      +  +L +   I+   L    +  Y+C+   +C  CV++ F C WC+  + C++ +    +C+       +  N P        CP + V++E L F+V  G    I +  KN  ++    TDF C    ++S     L+     V   ++MK           +   +  V W       G  ++    I   ++ C  L+  C  C+ L  + ++CG+C+ + +C +   C   G DD  W+N + Q CP P I +  P    L+  + + + G NLG    DV  A+T  N      C   +  Y+++ +  C+ +   ++     P+  + + + K   + ++ F +  P V  IEP  G   GGT + + G  ++ GS   V  N G+  I C ILE   + + CR               S N    S  L +D ++  + + +F++   P + ++   + +++GG +  + G     L +P +    E        C ++  D+  C +P         ++ T      L +  E   V   N S       + +F  PV+    +  S  +          +TIN +  D    +A  + D  + VG   C   +     + C   +++    Y  + ++ + +G     V G + +   D  +    +I I+  ++ +I   IL++V   +K  S  R      N   +  +K A E  K   AEL  +  A+  ++       P   Y  Y    LFPN +                        N P    L V+ Q  + IE  +   R  +KL  +  F+L F   +E+++    K +  + S L ++LM+ +   T ILK L+K   D+   KK   + + +FR+S+ ++ ++L+ W+  LM+ +L+   AG  L  LY  I   +  GP +  T +++Y+L+E  LL       + +       +    SE  V VLDCD I+Q K K  +  Y+ +P+S+  S         S C   + QD            +  E  G+  + TL  Y + D   + +  +  SL              + SL + +S   +  +   S  P +++    +  S S    S+ +S  K  +  K S      H  K    IY T++L  K  ++  IK+L + IF       S   C+  +F   ++  +     DD +V A KSNSL LRFW+ LI N  F+FD+   K T V  CL  V++ LMD CS    +D  LT+       LF+  + +Y   V NYY  I+   S +
Sbjct:  138 SKLIECSSLFQGRCRWRNLYNIDQKDVIRESQRNVVANDR-FSSTVIFVGAGPPNDDGIPKDVLYVASTYAQNGSYWD-DVPAVASLSLAQETLF--DVSVQG-----VGTGTEIKMERQFRGQYKIEYIGGFQSGR------FAYFATRQPKG-YIPGGNTFPIISKLVRVCTEDAHFWSYTEVPLECSRGNE-TYNLMTDVYLSKPGYDLA---------SSLGISVEED---ILYGVFVEGVGVDKSIPTSHSAL-CVYPMAAVERIF--LDNIEICFRGENDKNLPWFKSAE-RCQQTKF--SGQEVLCGKDVNSYIGGDI----AVEARPVLTTKDAR-FTAVATNTTRANTVAFIGTHDGRLLKGVIENRTAGFIYRTVEIGGGKPVLQDLELDGTGDHVYVLTPSSVSKVKVRHCGGAGDCESCLAQRDPYCGWCVLNNGCVPEGECTKSIPSTPHDWLTFRTGK----CPIIRSV-----------EPDKMQITSASYLNIELGNLPNLGGQMTCIFDFGNASGPVTMIAEQSGSSESRVRCPTPSLTRLPKIPAESQSLSARLAIAGGIDGPPLAFTNFTFYDCSRFMSCGSCVSSAFPCDWCIESDQCVAGTTTENRCRAQHIVNGLARNGPSRRKGPSHCPHM-VADE-LEFYVASGKTRQISVRAKNVLDFM---TDFKCQFKIEHSVH-ERLARKQGDVIICEVMKFDYYGPGTGNGTAIANFSVIWSTEGQQGGHLLDNNQGIRVVIYKCELLASSCGLCLALSDKKFECGWCSSERQCTRLEKCPADGPDD--WLN-RTQLCPYPVITDFNPKKGPLAGRTQLTIDGVNLGRSYQDVAGAVTAAN----VRCDVDQDLYVTASRIVCRTRPSPVHKTARNPIVVKLRDEHKYTAISNESFTYVDPLVTRIEPLKGTKYGGTDVTIWGENMDAGSLVNVTINVGSNRITCEILERTNDRLVCRSGP------------SINDSDGSFSLTVDGSTQIYDNFRFKYEKAPTISQVRFERSIASGGILVDVYGSGFKLLQRPHMVVMDEDRAIKGPKCIIDRDDLMQCYTPDLMMPHDRRNHPTIEHPLMLDYGFEMDGVRPGNISQLSGFNRLEVFPDPVIERFADGRSYRSG-------DYLTINGKYLD----AAASERDVLVTVGGETCNLTALANRALTCLPPDLSSDQFYGIRPRVIVKIGGMNYDV-GELSYNSKDSDISPQVLIAILIAVLAVICAFILLLVFYRRKSTSHMREMKHLRNQIDQIEMKVATEC-KEAFAELQTSMNALAADLPLGVPFIPFLSYKQYTARVLFPNNYH-----------------------NHPVLRDLEVDSQRALSIETGL---RSFNKLLMNRHFLLSFVRAMENNKYFLGKDRVTVGSLLMVVLMEKMEYCTEILKQLLKELIDRTVEKKF--QPKILFRRSESVAERMLAAWYTFLMHRYLRE-RAGQKLYELYWAIKQQVEKGPQDAITLEARYSLSEEKLLRSSFDFRELIVFIAADNYTAGVSEYPVRVLDCDTITQVKEKCLDAKYRTTPFSDRPSANELDLELRSACPRIILQD--------FDSTSRVEAGGWKRVNTLAHYKVLDNATLALLPRQASL-------------YNLSLLSERSERSTFSLSKQS--PTLARPFGTNSSSQSKGLLSNMESNYKLYHLVKPSEHGPSDHQDKMVTEIYLTRLLTMKGTLQKFIKDLLEVIFSTSDHNGSFAPCIKYMFDFMDDQAREHGIEDDEVVHAWKSNSLPLRFWVNLIKNPHFVFDIQ--KPTKVEGCLSVVAQTLMDACS---TQDHQLTKDSPSSKLLFAKDMYVYREWVNNYYCEIRSMPSIS 1877          
BLAST of plexin A vs. TrEMBL
Match: A8XIW2 (Protein CBR-PLX-1 OS=Caenorhabditis briggsae OX=6238 GN=plx-1 PE=4 SV=2)

HSP 1 Score: 301.597 bits (771), Expect = 2.104e-78
Identity = 415/1772 (23.42%), Postives = 717/1772 (40.46%), Query Frame = 2
Query:  725 ETIFPLEFVGSFHIYDSRKDAFFK------------NYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYR--ETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTG-KGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFED--TNYLFSTENLFNN--ISFNMVVNENKSVIYAVADSKIIRHNLRNCYN-GTNCEDCLRV-SPFCGWCISNGKCVVKDQC------TTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGI--YHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSL--GKCKKNF-------------EIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNST--AIGSLSASNRLVCTFQMMK-----VLQKASIKCSMKVSWI-LG-----NLLTGSIETETPIEFQVFDCLKLSEHCDDCVHL-PQIYKCGFCTVKDKCVQKHICGNDD--SKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKE-FKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFT-DVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYEN--CFVNNSDIDCISPTTSNI---TQFQKCSLLFAMEKGSVCVYNTSITIFSTPVLR-INPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXX-----XXXXKKVQSKQR-LRHEKENIFT--EKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESKKSDIVSFLSLILMKDLPNY-TRILKILIKNDYDK---KKLNEEERSMFRQSDLLS-KLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCL-------IKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKS----KIKCCYKTKISAFKDGHHLKPACLIYTQVL--KSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNKDVWLTQ-------LFSDVIKLYSPKVLNYYEGI 5722
            E +FP  + G+    D R   ++K            +Y +F+  Q +  H+  +   Q RL R+C+ D +Y S+ ++ + C      T   V   +V +V    A +   K+    +    D   + I +   K     N+YR  +       C + + E+   +      C  G+  + +N   F S D  C    FT+   +G   GK+ N  I GD     S      ++ +  Q  + I  +     T+A +G   G L+K  L E   +   ++TE L +N  I  +M  + +   IY +  SK+I+     C    + C+ CL    PFCGWC+SN  C  ++ C      T+  WL FQ ++    CP I  +    I   +     V  +  + P        + ++C F       + +    +   + SL C  P    +P IA N+  +  KL V+ + S L      +  Y+C    +C+ C  ++F C WC+  N C++  L   KC+K                I+     CP +      +S   G   +I +  +N    F    DF C       T   I   ++ + + C   + +     +L   S      V W  LG       +   ++    +   V+ C  L+ +C  C+ L  + Y CG+C+  DKC + H C N +    W+NS  Q CP P I +  P   ++   + + + G NLG +  DV+ A+ + N   +   +Y+  S I     K  I+  N+R    VA   +  +   + V+ E F +  P V S++P  GP  GGT + + G  L+ GS   VKF      I C +LE    ++ CR+   E   +              L +  D         + FEF  +P V+ I+ NK + +GG    + G     L +P + F        Y      +++  + C +PT       TQ +K +  +A +     +Y + I I   P    +N  +   P +    +                  A  + D  + VG   C   +     + C            K Q +  +   ++   G   F  G++S D+  +   + + ++I  I ++ +     V+  +K  + QR +++ K  + T   K+  E  E        LNQ     ++     TAP  +Y  Y    LFPN                               HP++ N ++   +  V   R+  KL  ++ F+L     +E ++    K    V  L ++++++   Y T +LK L++   +K   KK   + + +FR+S+ ++ ++L+ WF  L++DHL+  +AG  L  L+  I   +  GP +  T +++Y+L+E  LL    E+K+L + V         ++ V VLDCD I+Q K K  +  Y+   +++        L        K+   ++  S R+      +      L TL  Y++ +   + +  K+ SL   N  + S   + + S+ ++KS    K   + S  P      P    +D  H +SS  +    K+    K       D        +  T++L  K  +   I +L ++IF   +VP C+  +F   +   +     D  +V A KSN+L LRFW+ LI N  FLFD+   K T +  CL  V++ LMD CS    +D  LT+       LF+  +  Y   V +YY  I
Sbjct:  211 EIVFPGLYGGTHVSLDYRSRGYYKYQIDYINGFESGDYAYFVTRQRKTIHD--DSPIQSRLARVCTGDKNYHSYTEVPLEC------TRNGVDFNLVQDVYVTRAGYELAKSLDISVS---DPVLYGIFWEGDK-----NSYRSADATGKSAICIFTMKEVELAFKQNIMKCYKGTSGLKKNLPWFSSNDD-CR---FTTLPWEGIKCGKDVNSKIGGDTPIATSAT---YVTDDSAQLLTSIAINTTRSSTVAFVGTQGGKLHKL-LIESKRSAERYATELLTDNEPILADMEFSGDGKHIYILTPSKVIKMPTSRCETLSSQCDTCLSSRDPFCGWCVSNNHCTQEESCEREVPHTSRGWLDFQNSK----CPRIRSVKPDQIQINTADYLNVTIENLQAP------KGRRMQCLFQFPTGDSVVSDPMPF---DGSLKCATPPMNRLPRIATNEYHLAAKLVVVSDGSKLPLATTNFSFYDCNRYTSCSTCSASQFPCDWCLESNECVAGKLTEDKCRKQHIVNGLNVSLRDGSSIRKGPSKCPHIVAPVSKMSVATGERRNISVKVENVDPSFMG--DFKCEFRYGTVTHEKIAMRTSEDTITCDEMLFEPYGTSLLGSGSTPYGFNVIWTALGAPQVKKSINRFLDNVDQLSIDVYSCENLAPNCGKCLTLDSEKYDCGWCSHLDKCTRPHQCPNRNLAENWLNSS-QLCPNPQIEDFKPRKGSIFGGTRVTITGINLGRHVADVEKAVQIANVPCEVV-EYVPSSKIVCLTGKSTIKGSNER--GVVAVTLRHDSLKFFAVTSEKFSYVEPVVSSMKPVKGPRSGGTDVVLTGIDLDTGSEIMVKFGQ----IECKVLERTSEWLKCRMGPSEEGGQF------------PLHIAFDGQLQNLPIAIYFEFTSDPSVQSIAPNKTIPSGGITVDVYGQGFTLLQRPRMVFVGLGNDKSYGPLCSIIDDQLMKCATPTVPGAARDTQVEKIT-DYAFDFDGAELYRSKIKIMPPPSFEMLNEPRFVRPGDDFLTLNG-----------NNLNLAASERDIDVKVGGESCPLTALANKILTCQ-------PPVKKPQGAGKLNPEIVVTVGNASFSVGEVSYDSPGLSSSLLLAILIFIIAMIGLIICLIVLYRRKSNTHQRQMKYLKTQMDTIEMKVATECKEAFAELQTSLNQYTA--DLPLGTPTAPFLEYKDYCARVLFPNGGK---------------------------NHPVLKNLEVDTHKAEVTGLREFHKLLMNKTFLLTMVRTMESNKYFVGKDRVYVGSLLMVVLQEKMGYCTEMLKQLLRELIEKTVEKKF--QPKILFRRSESIAERMLAAWFTFLLHDHLKTFDAGKKLYELFWGIKQQMEKGPQDALTLEARYSLSEEKLLRATFEYKELTVFVNSTDSVYQQDIPVRVLDCDTITQVKEKCLDSKYRGYRFADRPGPSEMELEWKTGLNGKMTLQDIDSSSRIEGGNWKR------LNTLAHYNVPNNAILTLTSKSNSL--YNLVNFSTCSNKTTSILSDKSSLSMKTAGVGS--PKPWGGAPPSVTAD--HASSSNDTDNGYKLYHLVKPTEHGPTDSQEKMVTEIYLTRLLMMKGTLAKFITSLLENIFSAANVPPCIKYMFDFMDEQAREHGIIDPEVVHAWKSNALPLRFWVNLIKNPHFLFDI--QKPTKIEGCLSVVAQTLMDACS---TQDHQLTKDSPSSKLLFAKDMYQYRDLVDSYYTEI 1856          
BLAST of plexin A vs. Ensembl Cavefish
Match: plxna1a (plexin-A1-like [Source:NCBI gene;Acc:103026658])

HSP 1 Score: 274.633 bits (701), Expect = 1.240e-73
Identity = 366/1674 (21.86%), Postives = 688/1674 (41.10%), Query Frame = 2
Query:  854 LFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCM------EDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDTNYLFSTENLFNNISF--------NMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENK---NFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQK------ASIKCSMKVSWILGNLLTGSIETETP--IEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQ--KCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNIND-RIETPVAFQFKFKTKD-----KYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFV-NNSDIDCISPTTSNITQFQKCSLLFAMEKG-------SVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSK--QRLRHEKENIFTEKII--KEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNICVAMKNESL-----PASNTASVSHLESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
             F  ++VR+C  D  + S+++  + C  D       V   +V +     A   R  ++ +R  +   S+  ++LF  F       N  +       C + + +I E        C  G G ++  P+   + +  C+      ED F         G++FN+ +     G  + I    +  +   G + +    Y   T+A  G   G + K  +    N ++    L+ N++         +M+ + N   IY + ++++ R  + +C   T+C +CL    P CGWC+ +  C  +D+C  +   P +    V  C  ++V P++  +  S     ++ Q    P   LS     + C F      E   V  H F       C+ P  + I PI  +K   + + + LK            +  YNC+  ++C  CVN  F C WC   + C   +   C       N   +CP +  + + +   VG    I L+ +N     + + ++ C+        + S++A      + Q  K +        + +   + V W       G    + P  I+  ++ C  L + C  C+     + CG+C  + KC  +  C   +S W++      +C  P I ++ P        + + + G NLG    D++N + L     +  C  +E+ YIS+++  C+I +    R++     Q +   +D     + L  + F F +P    ++P+ GP  GGT I + G+ LN GS   V  N G  P              CR      K+ +       NP    + ++IDA  ++  +V+F +  +P V  I  +  +++GG    ++G NL  + +P +  +  T  S + NC V NNS + C++P+ ++  +    S     E G       ++ V N S + F  PV       +S PT +L +     + +    N   +     + ++ + +G  +C  ++     + C        ++  ++++++  G    +      +  G ++L  +  I     +++++ I +LV      +   +  +RL+ + +N+ +   +  KEA   L+  I EL Q      I       P   Y  Y +  LFP                                HP++  K+++V  +  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  D+  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  +   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   E+  E+ V+ L+CD I+Q K K+ + +YK SPYS           K    ++   +  +A I L++    T        L TL  Y + DG  I +  K  S       ++ T S+S  ES    L+T  S + +    PM +  PD+     +  L  + H++S Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct:  285 FFTSKIVRLCVDDPKFYSYVEFPIGCTKDG------VEYRLVQD-----AYLTRPGSKLAR--SLGISEREEVLFTVFA--QGQKNRAKPPKESALCLFTMRKIKEKIKERIQSCYRGEGKLSL-PW-LLNKELACINSPLQIEDNFC--------GQDFNQPL-----GGTTTIEGIPLFLDKDDGLTSVAAYDYRGHTVAFAGTRSGRIKKIVV----NSVYQPAQLYENVAVSEGNPILRDMLFSPNYLYIYTLTENEVSRVPVESCEQYTSCNECLGSGDPHCGWCVLHNTCSRRDRCERSEE-PLRFASHVGQCVKLSVQPNNVSVTMSEVQ--LVLQAQNVP--SLSAG---VNCSFEDYTETEGHIVGGHIF-------CLTPTTRQIAPITRSKGDRHVMKVYLKSKETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHMCTHDA-NDCSFQEGRVNTSEECPQIMPTTQ-IHIPVGVIKPITLLAQNLPQPQSGQRNYECIFNIQGR--VHSVTALRFNSTSIQCQKTMYDYDGNDISDLPVELSVVW------NGDFVIDNPYNIKAHLYKCYALRDSCGMCLKADPRFDCGWCVQEKKCSLRQECAPAESTWMHPSISNSRCTHPKITKLFPETGPRQGGTRLTITGENLGLQFTDIQNGVRLG----KVPCIPVEEEYISAERIVCQINDATGYRVQEA---QVEVCVRDCLPDYRALSPRGFTFVTPFFTRVQPSQGPLSGGTRITIEGNHLNAGSL--VTVNIGRQP--------------CRFKKRSAKEIVCVTPAGGNPGSTPVMVDIDAAELRNPEVKFNYTEDPTVLHIEPDWSIASGGIPLTVSGTNLATIKEPKIRAKYGTAES-FHNCTVYNNSVMVCLAPSVAHSERGIAESGSRPDEIGFYMDDVDALIVVNESFSYFPDPVF----EPLS-PTGVLELKPASPLILKGR-NLFPAAPGNSRLNYTVLIGETLCV-LTLSETQLLC-----EWPNLTGQHKVTIQAGGFEYSPGTLQIYRDGLLTLPAIVGIGGGGGLLLLVIIFVLVAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTQELDGAGI-------PFLDYRTYAMRVLFPGIE----------------------------DHPVL--KEMEVQADMEKALALFGQLLAKQHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIDRNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAMKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVNPENESAPEVSVKCLNCDTITQVKEKLLDAVYKGSPYSQRP--------KAGDMDMEWRQSRMARIVLQDEDVTTKIDNDWKRLNTLSHYQVTDGSVIALVPKQNSAYNICNSSTFTKSLSRYES---MLRTASSPDSLRSRTPMIT--PDLESGTKLWHLVKN-HDHSDQREGDRSS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQITDADVRHTWKSNCLPLRFWVNVIKNPQFVFDI--HKNSITDACLSVVAQTFMDSCSTSEHK 1793          
BLAST of plexin A vs. Ensembl Cavefish
Match: ENSAMXT00000016691.2 (plexin A1 [Source:NCBI gene;Acc:103028361])

HSP 1 Score: 259.61 bits (662), Expect = 5.398e-69
Identity = 320/1432 (22.35%), Postives = 602/1432 (42.04%), Query Frame = 2
Query: 1541 NMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAE---NKNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQK------ASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKF--QKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNIND-RIETPVAFQFKFKTKD-----KYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPTTSNITQFQKCS--------LLFAMEKG-SVCVYNTSITIFSTPVLR-INPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVS-GYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQ--AAIQDEIHK-----NWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNIC-VAMKNESLPASNTASVSH-LESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            +++ + N+  IY + + ++ R  + +C    +C +CL    P CGWC+    C  KD+C  A   P +    V  C  ++V P++  +  S     ++ Q    P     +    + C F      E         I    + C+ P  K + PI     +K  V L LK            +  YNC   ++C  CVN  F C WC   + C  ++   C       N   DCP +  S + +   VG    I L  +N     + + ++ C+      T   S++A      + Q  K          + +   + V W  GN +   I+    I+  ++ C  L E C  C+     ++CG+C  + KC  +  C   +  W+++     +C  P I+++ P        + + + G NLG    D++N + +     +  C  IE+ YIS++Q  C++ +    R++     Q +   +D     + +  K F F SP    + P+ GP  GGT I ++G  LN GS   VK   G  P  C+        I C                 S P    + ++I+A  ++  +V+F +  +P + +I  +  +++GG    + G NL+ + +P +  +     S+     VNN+ + C++P+ +     +  S        + F M+   ++ V N S T +  PV   + P  + L      I+K + +      N ++        ++ + +G   C             ++ V++  +  ++    L G++ +TV  G  ++  G + + + S++ +  I+ +     +L++VII+  +  K++ R     +  +++  + + +  R   E  +  A +Q +IH+     +    P   Y  Y +  LFP                                HP++  K+++V  N  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  DK  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  +   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+ L+CD I+Q K K+ + +YK SPYS           K    ++   +  +A I L++    T        L +L  Y + DG  I  V  +N +   SN+++ +  L    + L+T  S + +    PM +  PD+     +  L  + H++S Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct:  483 DLLFSPNQQFIYTLTEKQVKRVPVESCDQYKSCSECLGSRDPHCGWCVLLNVCSRKDRCERADE-PQRFASRVDQCVELSVQPNNISVTMSEVQ--LVLQARNVP-----DLSAGVNCSFEDYTETEAR-------IQGSRIYCLSPTAKELIPITRHQGDKRVVKLYLKSKETGKKFASVDFVFYNCTVHKSCLTCVNGSFPCHWCKYRHMCTQNA-NDCSFQEGRVNMSEDCPQILPSTQ-IYIPVGVTKPITLAARNLPQPQSGQRNYECIFHIQGETH--SVTALRFNSSSIQCQKTTYNYDGNDISDLPVDLSVVWN-GNFV---IDNPYNIKAHLYKCYALRESCGMCLKADPRFECGWCVQEKKCSLRQECAAPEHTWMHATAGNSRCTHPRIIKLTPETGPRQGGTKLTITGENLGLQFRDIQNGVRIG----KVACHPIEEDYISAEQIVCRLTDATGYRVQ---EAQVEVCVRDCQPEYRAISPKAFTFVSPYFTRVVPSHGPVSGGTRITIHGIHLNAGSAVSVKI--GLNP--CHFERRSAREIVCMTP--------AGLSTGSIP----VMVDINAAELRNPEVKFNYTSDPTITRIEPDWSIASGGTPLTVIGTNLDTVKEPKMRAKYGEIKSVNNCTVVNNTVMVCLAPSVAGTDTERSLSEVGSSPDEIGFVMDNVLTLLVVNESFTYYPDPVFEPLAPTMLELKPGSPLILKGRNLIPPAAGNTRL--------NYTVLIGDEPC-------------VLTVSETQLLCEW--PNLTGQHKVTVRVGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLVIIIVLIAYKRKSRDADRTL--KRLQLQMDNLESRVALECKEAFAELQTDIHELTQELDGAGIPFLDYRTYAMRVLFPGIE----------------------------DHPVL--KEMEVPANVEKALTLFGQLLNKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMSALQGEMEYATGVLKQLLSDLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAMKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVNPENENAPEVTVKCLNCDTITQVKEKLLDAVYKGSPYSQRP--------KAGDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNSLAHYQVTDGSVIALVPKQNSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMIT--PDLESGTKLWHLVKN-HDHSDQREGDRGS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQITDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDI--HKNSITDACLSVVAQTFMDSCSTSEHK 1783          
BLAST of plexin A vs. Ensembl Cavefish
Match: ENSAMXT00000046590.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:18585232:18670788:1 gene:ENSAMXG00000034599.1 transcript:ENSAMXT00000046590.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 237.269 bits (604), Expect = 3.981e-62
Identity = 353/1692 (20.86%), Postives = 675/1692 (39.89%), Query Frame = 2
Query:  797 NYIFFLVNQPENKH---EPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEI-MELYDVVRNLCLVGSGSVNENPYNFKSTDKRC------MEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDTNYLFSTENLF---NNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGIYHIYNCAHSR---------TCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCL----ETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQ--KCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQN--INDRIETPVAFQF---KFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTD-VQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPTTSNITQFQKCSLLFAMEKGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKLVT-INLEVNDQI-SVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSK-----QRLRHEKENIFTEKII--KEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFP--NTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGP-VNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSN----------WSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMK-----NESLPASNTASVSHLESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSK------IKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            ++++FL  QPE       P    +  R+VR+C  D+ + S++ + + C +     Y  + +  +A     +A            K    S+   +LF  F        Y+   +    C + I +I   + + +R+ C  G G  N   +     D +C      ++D F         G + N+ + G       + GH V +    +  S+  + IY  + +A +G   G + K  +      ++ T  +    ++I  +M  + N   +Y V+ +++ +  +  C   + C +CL    P CGWC+ + KC+ +D+C  +  L F+    ++ C  +   P    +  S  S  ++ +VS  P     +    + C F +     +A V+ H  ++ + + C+ P  + IP I  ++++  ++LKV      L   +Y I    + +          C  CV++ F C WC   N+C       C       N    CP LE   E +    G    I L  +N     + +  + C+          TA+   S S +   +  + + L+ + +   + + W   N +   I+    I+ Q++ C    E C  C+   + + CG+C  + +C  +  C +   +W+       KC  P I E+ P        +++ ++G NLG   ++++  + +        C    + YI+++Q  C++ +  ++ R   P   Q    + + + + L S+ + F +P V  + P  GP  GGT + + G  L+ GS   ++F   T    C       + I C             F   S   + S+ + ++ +  + +  + F++  +P V++I     +++G     +TG NL+ + +P V  +     S+     VN + I C +P+        + S+  A E G V     ++  F++      PN    P +L  +++QK  + I L+  + +   S   + ++ + VG   C +++   + + C   E   +   HK  I +     +L   G +Q +    SL  +  I  I     ++FII+++V+I  ++   +     +RL+ + +N+ +   +  KEA   L+  I EL     +  I       P   Y  Y +  LFP  + HP L                    C              Q +E  +   ++ ++L  ++ F+L F   LE  +    + +  + S +   L   L   T +LK L+ +   K  +  N  +  + R   +  K+L+NWF  L++  L+ +N   +L +     L++      VN +        NENS                       +E+ V+VL+CD I+Q K KI + +YK  PYS           W    +  ++  ++D   + E               L TL  Y + D   + +  K     N S  AS   S S  ++   S       ++    PM +  PD+   + +  L  + HE+  QK        +   Y T++ A K               L+  ++   + LF  +    ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K +    CL  V++  MD CS ++++
Sbjct:  261 DFVYFLTVQPETSDAGGSPAELFYTSRIVRLCKGDNKFHSYVSLPIGC-VRKGVEYRLLQAAYLAKAGSVLA------------KALNVSEQDDVLFAVFS--KGQKQYQRPSDDSALCLFTIRDINARIKERLRS-CYQGEG--NLELHWLLGKDVQCTKAPVPIDDHFC--------GLDINQPLGGSEL----VTGHTVYTETSERLTSVSAY-IYNGYCIAFLGTRAGNIRKVRVDGSVGAVYETVRVMKDGSSILPDMAFSLNHHHLYTVSQTQVTQVPVEYCEQYSRCVECLSSGDPHCGWCVLHNKCMRRDRCERSDEL-FRFADEIERCVKVTAHPDS--IAMSEHSVPLLLEVSNVP-----DLSAGISCLFGN-----LAEVEGH--VNENRVMCLSPTAREIPVIPADQDWSGVELKVF----QLFFSVYFIVTGVNIKFTGISITFKVCLSCVSSAFRCHWCKYRNTCTHDPT-SCSFQEGHVNASEFCPQLERGGEIV-IPAGEIRPITLRARNLPQPQSGQRGYECVLHIQGVSHRVTALRFNSTSVQCQNSSYVYEGLKLSELAVDLSIVWN-SNFI---IDNPERIKVQLYKCSAQRESCGMCLKADRRFGCGWCAGESRCTLRKHCPSLAGRWLEPSGHNSKCTHPRITEVTPLTGPPEGGTLVTIRGVNLGMTLSELQGRVEVAG----VPCSAQSEGYITAEQVVCEMDSTAVSSR---PGPVQLCVGECRPELRTLSSQLYTFVTPSVLGLTPARGPVSGGTKVTIVGDHLDSGSSVHIRFGNET----CEFYRRSFSEIVC-------------FSAPSVGGEGSVDVRVNVDQAELSSTLTFQYIEDPTVQRIEPEWSITSGHTTLTVTGTNLDVVQEPRVRVKYAGHESVNVCKVVNTTTISCFAPSLMADLAPGQDSVKHADEFGFVFNNVQALLTFNSTSFIYYPNPSFEPLSLTGVLEQKPGSPIILKGRNLVPPASGGSRLNYSVLVGDTPC-HVTISEHQLLC---EPPALSGQHKITIQV---GGLLVSPGSVQIQSD--SLLTLPAIFSIAAGGGLLFIIVILVLIAYRRKSHENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRAGI-------PHLDYRTYTMRVLFPGMDDHPVLRELEVA-------------GCGQ------------QRVEKAL---KQFAQLVNNKTFLLTFIRTLELQRSFSMRDRGYLASLIMTALQARLEFATDLLKQLLSDLILKNMESKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKALNIKQNLSLFCFLSLSLSQTLSCVNPD--------NENS-----------------------AEIPVKVLNCDTITQVKEKILDAVYKNIPYSQRPRAVDMDLEWRQGRTARVVLQDEDITTKIENDWK----------RLNTLVHYQVSDRCVVALVPKQTSSYNISTSASFPRSFSRYDTVLRSASAGSPESMRSRAPMIT--PDLESGVKVWHLVKN-HEHGDQKEAERGSKMVSEIYLTRLLATKG-------------TLQKFVDDLFETLFSTVHRGSALPLAIKYMFDFLDEQADKHGIHDPDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KSSITDACLSVVAQTFMDSCSTSEHR 1769          
BLAST of plexin A vs. Ensembl Cavefish
Match: plxna1a (plexin-A1-like [Source:NCBI gene;Acc:103026658])

HSP 1 Score: 206.838 bits (525), Expect = 3.041e-53
Identity = 250/1093 (22.87%), Postives = 469/1093 (42.91%), Query Frame = 2
Query: 2519 IEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQ--KCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNIND-RIETPVAFQFKFKTKD-----KYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFV-NNSDIDCISPTTSNITQFQKCSLLFAMEKG-------SVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSK--QRLRHEKENIFTEKII--KEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNICVAMKNESL-----PASNTASVSHLESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            I+  ++ C  L + C  C+     + CG+C  + KC  +  C   +S W++      +C  P I ++ P        + + + G NLG    D++N + L     +  C  +E+ YIS+++  C+I +    R++     Q +   +D     + L  + F F +P    ++P+ GP  GGT I + G+ LN GS   V  N G  P              CR      K+ +       NP    + ++IDA  ++  +V+F +  +P V  I  +  +++GG    ++G NL  + +P +  +  T  S + NC V NNS + C++P+ ++  +    S     E G       ++ V N S + F  PV       +S PT +L +     + +    N   +     + ++ + +G  +C  ++     + C        ++  ++++++  G    +      +  G ++L  +  I     +++++ I +LV      +   +  +RL+ + +N+ +   +  KEA   L+  I EL Q      I       P   Y  Y +  LFP                                HP++  K+++V  +  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  D+  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  +   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   E+  E+ V+ L+CD I+Q K K+ + +YK SPYS           K    ++   +  +A I L++    T        L TL  Y + DG  I +  K  S       ++ T S+S  ES    L+T  S + +    PM +  PD+     +  L  + H++S Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct:  159 IKAHLYKCYALRDSCGMCLKADPRFDCGWCVQEKKCSLRQECAPAESTWMHPSISNSRCTHPKITKLFPETGPRQGGTRLTITGENLGLQFTDIQNGVRLG----KVPCIPVEEEYISAERIVCQINDATGYRVQEA---QVEVCVRDCLPDYRALSPRGFTFVTPFFTRVQPSQGPLSGGTRITIEGNHLNAGSL--VTVNIGRQP--------------CRFKKRSAKEIVCVTPAGGNPGSTPVMVDIDAAELRNPEVKFNYTEDPTVLHIEPDWSIASGGIPLTVSGTNLATIKEPKIRAKYGTAES-FHNCTVYNNSVMVCLAPSVAHSERGIAESGSRPDEIGFYMDDVDALIVVNESFSYFPDPVF----EPLS-PTGVLELKPASPLILKGR-NLFPAAPGNSRLNYTVLIGETLCV-LTLSETQLLC-----EWPNLTGQHKVTIQAGGFEYSPGTLQIYRDGLLTLPAIVGIGGGGGLLLLVIIFVLVAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIHELTQELDGAGI-------PFLDYRTYAMRVLFPGIE----------------------------DHPVL--KEMEVQADMEKALALFGQLLAKQHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIDRNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAMKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLTLHCVNPENESAPEVSVKCLNCDTITQVKEKLLDAVYKGSPYSQRP--------KAGDMDMEWRQSRMARIVLQDEDVTTKIDNDWKRLNTLSHYQVTDGSVIALVPKQNSAYNICNSSTFTKSLSRYES---MLRTASSPDSLRSRTPMIT--PDLESGTKLWHLVKN-HDHSDQREGDRSS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHQITDADVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KNSITDACLSVVAQTFMDSCSTSEHK 1145          
BLAST of plexin A vs. Ensembl Cavefish
Match: plxna4 (plexin A4 [Source:NCBI gene;Acc:325938])

HSP 1 Score: 187.193 bits (474), Expect = 6.575e-47
Identity = 228/1078 (21.15%), Postives = 427/1078 (39.61%), Query Frame = 2
Query:  404 LWTFADSYLVVCYDVFQGFCEII---DLYNQFSSSYKNKAYSIVTNDRK--FHSTVLYHDQ---RLFFANEVYHPSNYREIDFNTMSILSFPNMTYFKPDYPFQANFGKLVYQGGETIFPLEFVGSFHIYDSRK-------DAFF------KNYIFFLVNQPENKHEPKNG--------LFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSII-GHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDTNYLFSTENL----FNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKN---FVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETL-SFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNS----TAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWI--NSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNIN-----DRIETPVA-FQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPTT 3484
            L  + ++ L+ C  ++QG C+++   DL+      +K + Y    N+    F   V Y D    +LF A  V     Y            FP ++  K     + + G   Y     +F  EFV S     S         D ++       N+++FL  QPE    P  G        ++  +LVR+C  D  + S++++ + C +     Y  + +  ++     +A           +K   D D    +F   +        +ET      C + + EI E        C  G G+++      K  D  C     T          NF    +    G + ++ G  + S +  +  S+I + +Y+  +LA +G   G L K  +    +     E +       I  +M  + ++  +Y ++++++ R  +  C   ++C +CL    P CGWC+ +  C  K++C  +   P +    +K C  ++V PS+  +  S  S T++ +    P     E    + C F      ++A +     +  + ++C  P  K +P I  ++     V L LK            +  YNC+  ++C  CV + + C WC   ++C       C       + Q +CP L  ++  L   +V  PI+  L  KN     + +  + C+ T         A+   S+S +   T      ++ +S+   + V W  G+    SI+  T  +  ++ C    E C  C+    ++ C +C  + +C  K  C +  S W+  N    KC  P I +I P        +++ ++G NLG   ++++ ++ +     +  C  + + YI ++Q  C++           ++  V   Q +F  K     SK + F  P++ +++PN GP  GGTI+ + GS L+ GS   + F        C        +I+C                +      ++ + +D   IQ  D++FE+  +P + K+     + +G     +TG NL+ +  P +  +       Y N    N+    +SPTT
Sbjct:  122 LMDYRENRLLACGSLYQGICKLLRLDDLFKLGEPFHKKEHYLSGVNESGSVFGVIVSYGDSSPDKLFVATAVDGRPEY------------FPTISSRKLARNSEED-GMFAY-----VFHDEFVASMIKIPSDTFTVVPDFDIYYVYGFGSGNFVYFLTLQPEMGGGPAAGSSSAGREQVYTSKLVRLCKDDTAFNSYVEVPLGC-VKGGVEYRLLQAAYLSKAGSILAQ---------TLKVGPDDDVLYAVFSKGQ----KRRPKETSQESALCVFSLKEINERIKDRLQSCYKGEGTLDLA--WLKVKDIPCSSALLTID-------DNFCGLDMNAPLGVSEMVRGIPLFSESNDKMTSVIAY-VYKNHSLAFVGTKGGRLKKIRVDGTPHGALQYETVQVVESGPILRDMAFSADQHFLYVMSETQLTRVPVEACEQYSSCNECLGSGDPHCGWCVLHSMCTRKEKCERSSE-PRRFASNIKQCVRLSVHPSN--ISVSQYSVTLVLEAHNVP-----ELSAGVNCTF-----EDLAEMDG--LVEGNRITCSSPAEKEVPRIVVDQGDHQIVQLYLKSKETGLAFANTSFVFYNCSVHKSCLSCVGSPYQCHWCKYRHTCTHDPR-SC-------SFQRECPQLLPADRILVPVNVVKPIT--LRAKNLPQPQSGQRGYECVLTIQGVEQRVPALRFNSSSVQCQNTSYSYDGMEMSSLPVDLTVIWN-GDF---SIDNPTQNKVHLYKCDARRESCGLCLKADPLFGCVWCKAEKRCTLKQHCPHPQSMWLEHNGINSKCTHPRITKITPMRGPREGGTLVTIRGENLGLEFHEIQGSVKVA----EVECTPVAEGYIPAEQIVCEMGKAEKSQYAGNVQVCVGECQPEFMAK----TSKYYYFVVPKLMALKPNRGPVSGGTIVNITGSNLDAGSNVSIMFKDQK----CTYHRRGGQWITCH-----------SHTSTQGYGNVTVSVFVDKAHIQ-KDLRFEYVEDPTIIKLEPEWSIFSGNTPVTVTGTNLDIIQNPQIRAK-------YNNQETTNA-CQVLSPTT 1096          

HSP 2 Score: 106.686 bits (265), Expect = 2.235e-22
Identity = 134/524 (25.57%), Postives = 235/524 (44.85%), Query Frame = 2
Query: 4277 HPLIVNKQIQVI-ENTVEYSRKL-SKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSN----------WSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSAS-----LK-TNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQN--------------KDV-----WLTQLFSDVIKL 5686
            HP++ + ++    +  VE   KL  +L  +++F+L F   LE  +    + + ++ S +  +L   L   T +LK L+ +  DK  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L  L+  I   +  GP++  T +++Y+L+E+ L+ ++I++K L +   H   E   E+ V+VL+CD I+Q K KI + IYK  PYS+          W       +I  ++D   + E               L  L  Y +   DN  VA+  + + A N+ + S +   SAS     +K T    ++    PM +  PD+   + +  L  + HE+  QK   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K +    CL  V++  MD CS +++              KD+     W+ + +SD+ K+
Sbjct: 1334 HPVLRDLEVPGYRQEQVEKGLKLFGQLINNKVFLLSFIRTLESQRGFSMRDRGNVASLIMTVLQSKLEYATDVLKHLLSDLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFSLFCAIKQQMEKGPIDSITGEARYSLSEDKLIRQQIDYKTLVVNCIHPENEKSPEIQVKVLNCDTINQVKEKILDAIYKNVPYSHRQKASDMDLEWRQGRGVRIILQDEDMTTKIESDWK----------RLNMLSHYQVP--DNAVVALVPKQVTAYNSVNNSTVSRASASKYENMIKYTGSPDSLRSRTPMIT--PDLESGVKVWHLVKN-HEHGDQKEGDRGS--------------KMVSEIYLTRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHSIHDPHVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYAKDIPSYKSWVERYYSDINKM 1823          
BLAST of plexin A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009284.1 (pep scaffold:Pmarinus_7.0:GL476385:264710:288126:-1 gene:ENSPMAG00000008378.1 transcript:ENSPMAT00000009284.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.0998 bits (183), Expect = 1.384e-13
Identity = 58/196 (29.59%), Postives = 105/196 (53.57%), Query Frame = 2
Query: 4340 LSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMFRQSDLLS-KLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFES 4921
            LS L   +LF+      LE   +  ++ +  + S L++ L   L  YT ILK L+  D   + + +  + M R+++ ++ K+L+NW  + +Y  L++  AG  L +L+  I   +  GPV+    K++Y+LN+  LL   ++++ L +    E    +  ++V VLDCD I Q K KI +++Y+  PYS   S ++
Sbjct:  382 LSNLLNSKLFLTTMIHTLEGQPKFSARDRGCVASLLTVALQDKLEYYTDILKTLL-GDLVGQYVAKNPKLMLRRTETVAEKMLTNWMSVCLYKFLKD-TAGEPLFMLFRAIKQQVEKGPVDGVLRKAKYSLNDTRLLGEDVDYQSLVINATVENSGEEGPVIVRVLDCDSIGQVKDKILDQVYRNVPYSQRPSVDT 575          
BLAST of plexin A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006110.1 (pep scaffold:Pmarinus_7.0:GL484765:748:3341:1 gene:ENSPMAG00000005524.1 transcript:ENSPMAT00000006110.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 1.082e-7
Identity = 33/114 (28.95%), Postives = 58/114 (50.88%), Query Frame = 2
Query: 5342 TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFN-----NICKDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            T++L +K  G ++   DD+F+          ++PL +  +F   +     +   D ++    KSNSL LRFW+ +I N  F+FD+     T    CL  V++  MD CS ++++
Sbjct:   72 TRLLATK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADRHAIHDPAVRHTWKSNSLPLRFWVNVIKNPQFVFDIHKTSITDA--CLSVVAQTFMDSCSTSEHR 181          
BLAST of plexin A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007728.1 (pep scaffold:Pmarinus_7.0:GL483331:9686:16681:-1 gene:ENSPMAG00000006984.1 transcript:ENSPMAT00000007728.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 4.269e-6
Identity = 44/162 (27.16%), Postives = 72/162 (44.44%), Query Frame = 2
Query: 5282 KTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDY-----ESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK---DVWLTQ-LFSDVIKLYSPKVLNYYEGIK 5725
            ++K S+ +D    K    IY   L S ++G ++   DD F         VP  V   F   +   +     D   +   K+NSL LRFW+ ++ N +F+FDV +     V   L  +++  MD C+  + K   D  + + L++  I  Y   V  YY  I+
Sbjct:    1 RSKRSSMRDRDRTKVIPEIYLTRLLS-MKGILQKFVDDFFRVVLSTSRPVPPAVKYFFDFLDEAAERHGIEDPETIHIWKTNSLPLRFWVNILKNPNFVFDVQV--SDIVDASLSVIAQTFMDSCTTQEQKLGRDSPINKLLYAREISGYKKMVEKYYADIR 159          
BLAST of plexin A vs. Ensembl Nematostella
Match: EDO39009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBD7])

HSP 1 Score: 239.58 bits (610), Expect = 3.039e-63
Identity = 413/1983 (20.83%), Postives = 772/1983 (38.93%), Query Frame = 2
Query:   80 FLILSVINIFITEICALTSEIFVYKYENLDKIMLHNNKSHKSILVSGKNYILQFSENNLKEPLAIRKTGPVNHSVMC-TEPNQCQTSLCPKELISRDQCRIKLTDVFVKLWTFADSYLVVCYDVFQGFCEIIDLYNQFSSSYKNKAYSIVTNDRKFHSTVL--YHDQRLFFANEVYHPSNYREIDFNTMSILSFPNMTYFKPDYPFQANFGKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMED------GFTSTGKGECGGKNFNKF--IIGDHY---GENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYELFEDTNYLFSTEN---LFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQ-RNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKN--FVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQN-----NQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQKA--SIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSK--------QFKCK--------IQNINDRIETPVAFQFKFKTKDKYL---VSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFR---CETFLSIYENCF-VNNSDIDCISPTTSNITQFQKCSLLFAMEKGSVC----VYNTSITIFSTPVLRINPNKISLP-TNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRC------NIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISL--------DNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKE-----NIFTEKIIKEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMFRQSDLLS-KLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYTLKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLS-DSLHENSSQKSKIKCC-YKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQ--IKNLFDDIFDYE-SVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNKDVWLTQ----LFSDVIKLYSPKVLNYYEGIKGTGSFNYNE 5752
            + +L +++      C   SE FV  ++ +  I++ N  S  ++ + G N IL  +E +L E L    TGP++ +  C   P+ C  S  P+ + + ++ ++ L D       ++ + LV C  ++ G C++ DL N  S +  + + +  +N +     +     D+ L+FA               ++S LS      F      Q ++ K      +  F + ++  F   D      F  ++        +K++  + +++ +L  +C  D  ++++++I + C       Y    S  VA    ++A          R+     SD   +LF+ F     TNN   +  S    A               LC     ++++    F++  K C E        +   G G C  + +     I   +Y   G   ++    +  N     + +   ++E  T  ++G  +G L K  + + +  +    N   L  N+ + + ++++++ +YA  D K+I+H ++ C   + CE C  R  PFCGWC    KC VK +C  +   P +      K   +++  P       S +      + +   L  L+  + + +C     NN+    V+    I+++++ C  P    +P I        V+L L         V      Y+C   + C  C  + ++C WC     C S     C     +           CP L + N T          + L  ++     N+      L        +G+   S+  +     +     A  ++   ++V W   +L    +     ++  ++ C      C  C++    +KCG+C  + KC+ K  C  +   W++        P I    P     S  + + + G+  G   +D++N + ++N    + C      YI S+        +F  K        I+ + +   +P   +   +     L    S +F + +P +Y   P  GP  GGT + + G  LN G  R +    G  P I N     +  I C       K  + R +R +      +Q+  D         +F F  +P V  IS  K    GG    + G     +  P + +     +   S  E C  V+N+++ C SP   N+T+F   +++     GS      + +    + +   L I  N   LP  N  R +K+  + I  +  D +S     + D  + VG + C         + C       + EVN  ++Y            V+  +GY++F  G +            M+ I I       + +++++ ++   + + +Q  RH K+     +    K+ KE  E      AEL       +     +  P   +  Y L  LFP                                H +   K   +     +  RK S+L  ++ F+L+F   +E  +    K + ++ S L + L   +   T IL  L+ +   K       + + R+++ ++ KLL+NW    MY+HL+ + +G  L +++  I   +  GPV+  T +++Y+L+E+       +    +    +  FE+    +V VLDCD +SQAK K+ + +YK  P+S+    E+  L     D   +  R     ++ E     L TL  Y + DG N+ ++ +                   +S   ++ ++  + +P   F P      PI R S + L E       +K   Y T      D  H K    IY T++L +K   Q  +  LF+ +F+     P+ V  LF   ++  K     D  ++   K+NSL LRFWI ++ N +F+FD+   K   V  CL  ++++ MD CS ++++    +     L++  I  Y  +V  +Y+ I    S +  E
Sbjct:    6 WTLLLLVSFICNSSCTAISE-FV-SHDKITNIVVDN--STGNVFIGGTN-ILVKTEADL-EVLVNTTTGPIDDNENCLPAPSYCDPSKYPR-VPTDNRNKLLLID-------YSSTQLVTCGSIYHGVCQLRDL-NTLSVTELSSSITASSNVKPAVGFIAPGGRDEVLYFATSWRKAFGDLYSTAYSISSLSLDPADPFTLTNQLQGSYLKF----KDYTFDVRYIYGFSSGD------FSYFLMVQETLESHKNKKDSNIYETKLGHVCHRDKSFSTYVEIPLVCKGRTGAHYSVATSAFVAKPGLNLAR---------RLGITSQSD---VLFVTF-----TNNTGSSVASGEHSA---------------LCYFSLKAIDKG---FETNIKNCSEGQIPLGMPWARNGDGACKKEEYLSMCNIGTSNYPISGTGGVVALAGLEWNRKPVLTSVTAMVHEAHTAVVLGTYNGHLIKISVGDGSKLVIPYYNKGLLPGNVIWKLDLSKDRTAVYATTDFKVIKHPIQECSTFSTCESCSGRGDPFCGWCTLYNKCSVKSECADSSLSPLRFATEKSKCVSIVSTNPDKFPYGASTQ-----LEATVQNLPPLTAGNTY-QCYI---NNK----VQTTSTINSNTVKCSTPDSSGLPEITNPTGDVLVELALYSSETGQKFVVKKIPFYDCTKMKGCRPCAESVYDCDWCTYTGKCSSDGNNACPGEAILAKMKRTLGAAGCPKL-LGNTTHYVPNDVKKELVLKAQDLPALKNNFVYECVLSVEGKKLKVGATRDSDSQLSCHSGVYTYNAATQTVHMGLEVLWRGTDL----VYKPESLKVLLYKCDVAYTDCGTCLNADFNFKCGWCKSEGKCLVKQACSQN---WVHPASPCLIAPVIERFWPMAGPPSGGTELEIHGKEFGKSFSDIQNNVYVDN----YPCIPDPHKYIISQRKNRVAMFRFSVKLIIVCLTTIRIVCNTTRSPRQLRGPVRVTVSGLRGSSSADFTYQTPELYDYYPKKGPQSGGTPMNITGVKLNTG--RHIVVMVGRTPCIVNRTSVTDTSIPCV-----TKQAVGRSRREAVFSSGVVQVTFDGFRPLSPPGEFSFTADPFVDDISPKKTFPGGGLRMTVRGKYFESVQNPKMYYTIAGMDGARSEVEECVKVSNTEMICPSP---NVTEF---NVMPGSMNGSELIVGFIMDQVPGLENETTLAITENPFFLPFANGERELKEANLIIEGKNLDILS-----KDDVFVTVGGVPCNLTGLDDTQLVCLVPDKATLPEVNN-EVYE-----------VIVTAGYLKFNIGKVRYFKEKPPPKSYMTYIYIGVAAGGFVLLVVILCLVCAYRRKKRQEKRHVKDFEVRMDNLESKVAKECREAF----AELQTDMTDLKSDLTTSGMPFLDFRTYALNVLFPGVD----------------------------DHSVTHFKDANLSPVWEQGLRKFSQLIYNKEFLLIFVRTVESQKTFSMKDRCNLASLLMVTLQGKMDYATEILWQLLCDLIRKSVAQSHPKLLLRRTESVAEKLLTNWLAFCMYNHLK-VESGEPLFMMFKAIKRQVGKGPVDAVTGEARYSLSEDK---LLRQTIDYEEIRVNVTFEDQPPTMVTVLDCDSVSQAKSKMLDAVYKNVPFSSRVEAETLQLDWHLTDGSVKPLRDDDASSVVEGQWRKLNTLGHYKVTDGANLKLSPRQ--------------SYFYSSSNNSERQHHHRSLPRVVFSP--FNYTPISRGSREDLDEGGRIWHLVKLLDYPTDKD---DTQHSKMLAEIYLTRLLATKGTLQQFVDGLFNSMFNSNCRPPVPVKYLFDLLDSQAKELNLSDSEVLHTWKNNSLPLRFWINIVKNPNFIFDIE--KSGTVDSCLSVIAQLFMDACSISEHRLGIHSPSNKLLYAKEIPAYKQRVEQFYQNITALPSPSGEE 1816          
BLAST of plexin A vs. Ensembl Nematostella
Match: EDO29710 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2V4])

HSP 1 Score: 59.3066 bits (142), Expect = 1.666e-9
Identity = 24/75 (32.00%), Postives = 43/75 (57.33%), Query Frame = 2
Query: 1520 LFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQ 1741
            L  N+ + + ++++++ +YA  D K+I+H ++ C   + CE C  R  PFCGWC    KC V+ +C  +   P +
Sbjct:   19 LPGNVIWKLDLSKDRTAVYATTDFKVIKHPIQECSTFSTCESCSGRGDPFCGWCTLYNKCSVRSECADSSLSPLR 93          
BLAST of plexin A vs. Ensembl Medaka
Match: plxna2 (plexin-A2 [Source:NCBI gene;Acc:101158766])

HSP 1 Score: 261.536 bits (667), Expect = 1.479e-69
Identity = 364/1695 (21.47%), Postives = 701/1695 (41.36%), Query Frame = 2
Query:  797 NYIFFLVNQPE-------NKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRC------MEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYEL---------FEDTNYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNF--VDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCL----ETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDD---SKWIN--SKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQF-------KFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFTD-VQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPTTSNITQFQKCSLLFAMEKGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKLVT-INLEVNDQISVSAFH-QSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQ----SKQRLRHEKENIFTEKII--KEANEVLKRGIAELNQAAIQDEIHKNWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIEN---TVEYSRKL-SKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGY-------TLKTLKDYDIKDGDNICVAMKNES---LPASNTASVSHLESNSASLK-TNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSK------IKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNICK-----DDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            N+++FL  QPE       +     +  +  R+VR+C  D  + S++ + + C + N   Y  + +  +      +A         S +      D   +LF  F        +    +    C + I EI          C  G G++  N       D  C      ++D F         G + N+ + G       + GH + +    +  S++ + +Y  + +A +G   G L K  +         +E    +     +  +++F++    ++S +Y +++ ++ +  + +C     C +CL    P CGWC+ +  C  K +C  A   P++   ++  C    V P    +  S  S  ++ +VS  P     +    + C F +     +  V+    ++ + + C+ P  K++P I  ++++  VDL+L        L+      YNC+  + C  CVN+ F C WC   N C       C       N   DCP L  S E L   VG    I L  KN     + +  + C+          TA+   S+S +   +  + + ++ + +     V W  GN +   I+    I+  ++ C    + C  C+   + ++CG+C+ + +C  +H C   +   ++W+N  S+  KC  P I E+ P        + + + G NLG   +D+++ + +        C  +E  YI ++Q  C++         P   Q        +  T+  +L    + F +P V  + P+ GP  GGT + + G  L  GS   V+F   T    C         I C             +   S      +Q+++  +  +  + + FE+  +P V +I  +  +++G     +TG NL+ + +P +  +     SI     +N S + C +P+     Q    ++  A E G +     ++ +++   L   PN    P +   +++QK  + I L+  + +  +A   + ++ + +G   C+ ++   + + C        ++  +Y++ + +G   LTVS        D  L   +++ I     +++ I+ILV++   +K +    + +RL+ + +N+ +   +  KEA   L+  I EL     +  I       P   Y  Y++  LFP                                HP++  ++++V  N   +VE + KL  +L  +++F+L F   LE  +    + + ++ S +   L   L   T +LK L+ +  D+  +  N  +  + R   +  K+L+NWF  L++  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++IE+K L L   +   EN  E+ V+VL+CD I+Q K KI + +YK  PYS            ++ D      R+   +   E +          L TL  Y + D   + +  K  S   +P+S + S + +    +S + T    ++    PM +  PD+   + +  L  + HE+  QK        +   Y T++ A K               L+  ++   + LF  +    ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K +    CL  V++  MD CS ++++
Sbjct:  314 NFVYFLTVQPEIPENSMSSSGSNNDLFYTSRIVRLCKDDRKFHSYVSLPIGC-VKNGVEYRLLQAAYLGKPGRILA---------SSLGISAQDD---VLFTVFS--KGQKQFHRPPDDSALCVFTIREINARIKERLQSCYQGEGNLELN--WLLGKDVHCTKAPVPIDDSFC--------GLDINQPLGGSQL----VTGHTLFTETRDRMTSVVSY-VYNGYCVAFVGTKSGRLKKIRVDGPPHGGAQYETVPVIKDGSPVLRDMAFSL----DRSFLYVMSERQVTQVPIESCEQYETCGECLSSGDPHCGWCVLHNMCSQKSRCERADE-PYRFAASLNQCVKAAVYPDS--IAVSEPSVPLLVKVSDVP-----DLSAGITCSFGN-----LTEVEGQ--VNGNQILCVSPAAKDVPLIPTDQDWSGVDLRLNSKETGQMLISTEIKFYNCSVHQLCLSCVNSAFLCHWCKYRNLCTHDP-SSCSFQEGRVNTSEDCPQLVPSEEIL-IPVGEVKPITLKAKNLPQPQSGQRGYECVLHIQGVSHRVTALRFNSSSVQCQNSSYLYEGMKISELPVEFSVVWN-GNFI---IDNPENIKVHLYKCAAQRDSCGLCLKADRKFQCGWCSEEGRCTLRHHCPAINPYTTRWLNLSSRNVKCTNPRITEVTPVAGPPEGGTRVTIYGTNLGLSFSDMEDNVQVAGVQ----CTPVEDGYIIAEQIVCEMAAAPAS-SRPGPVQLCVGECKPELSTRSSHL----YSFVTPTVTGLSPSRGPESGGTKVTIMGENLGAGSTVNVQFGNQT----CEFFRRTTTEIVC-------------YSAPSLFGIGPVQISVRVDHARIRESLPFEYIEDPTVLRIEPDWSIASGNTPLMVTGTNLDVVQEPRIRVKYAGRESINVCKVLNTSTLSCFAPSLMVEYQPGLDTVKHADEFGFIFNNIQALLVYNNTNLLYYPNPYFEPLSNTGVLEQKPGSPIILKGRNLVPPAAGGVKLNYTVLIGETPCS-VTVSESQLLC-----EPPNLTGQYKVVVQVGG--LTVSPGAVHIMSDSLLTLPAIVSIAAGGGLLLIIVILVLIAYKRKSRENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRAGI-------PHLDYRTYVMRVLFPGIE----------------------------DHPVL--RELEVSGNGQQSVEKALKLFGQLINNKVFLLTFIRTLEMQRSFSMRDRGNVASLIMTALQGRLEYATDVLKHLLSDLIDRNLESKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIEYKTLILNCVNPDNENSPEIAVKVLNCDTITQVKEKILDAVYKNMPYSQRPR-------AVDMDLEWRQGRMARVVLQDEDITTKIENDWKRLNTLLHYQVSDRSVVALVPKQTSSYNIPSSASISRTSISRYDSSFRYTGSPDSLRSRAPMIT--PDLESGVKVWHLVKN-HEHGDQKEGDRGSKMVSEIYLTRLLATKG-------------TLQKFVDDLFETLFSTVHRGSTLPLAIKYMFDFLDEQADKHAIYDTDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KSSITDACLSVVAQTFMDSCSTSEHR 1856          
BLAST of plexin A vs. Ensembl Medaka
Match: PLXNA2 (plexin-A2 [Source:NCBI gene;Acc:101160644])

HSP 1 Score: 259.61 bits (662), Expect = 5.199e-69
Identity = 378/1784 (21.19%), Postives = 731/1784 (40.98%), Query Frame = 2
Query:  797 NYIFFLVNQPENKHEPKNGL----------FQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRC------MEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYKYEL---------FEDTNYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVS-PFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKNFVDLKLKVLINDSHLVEGIYHI--YNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNS----TAIGSLSASNRLVCTFQMMKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHIC---GNDDSKWIN--SKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNIND-RIETPVAFQF-KFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRSSNPKKASLQLNIDANSIQFT-DVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPTTSNITQFQKCSLLFAMEKGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKL-VTINLEVNDQI-SVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIA-ELNQAAIQ-----DEIHKNWNTA--PIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYS----------NWSSFESYCLIKLNQDEVPESERLLAPIALK-EVVGYTLKTLKDYDIKDGDNICVAMKNES---LPASNT--ASVSH------LESNSASLKTNKSRNISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSK------IKCCYKTKISAFKDGHHLKPACLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNIC-----KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQN---KDVWLTQ-LFSDVIKLYSPKVLNYYEGIKGTGSF---NYNEYYG-SSRIDG--INISLAIVILYQNYINSVHKELVEVIQ 5860
            ++++F+  QPE    P+NG+          +  R++R+C  D  + S++ + + C I     Y  + +  ++ V   +A            K+   S    +LF  F        Y +  +    C + I +I          C  G G  N   +     D +C      ++D F       CG        I    G + ++  R +        + +   IY   ++  +G   G + K  L         +E    +  T ++  +++F++    ++S +Y ++ +++++  + +C     C +CL    P CGWC+ +  C  +D+C   M   F+    +  C  + VI     +  S  S  ++ +V+  P     +    + C F           +A   +  + + C+ P GK +P I E +++  ++L++   ++  +     +  YNC+  + C  CVN+ F C WC   N C       C       N   DCP L  S E L    G    I L  +N     + +  + C+     +    TA+   S S +   +  M + ++ + +   + + W  GN +   I+    I+  ++ C    + C  C+   + ++CG+C+ + +C  K  C       S+W++  S+  KC  P I E+ P    +   +++ +KG NLG   ++++  + +        C   E+ YI+++Q  C++    D  +  PV     + K + + L ++ + F SP + ++ P  GP  GGT + + G  L+ GS   + F   T    C + +     I C             F   S      +Q+++  +  +    + FE+  +P V++I     +++G  +  +TG NL+ + +P V  +     S+     +N + I C +P+        + S+    E G V     ++  F+       PN    P +L  +++QK    I L+  + + S S   + ++ + +G   C+ ++     + C   E   +   HK          +L   G +    G++ + + S++ +  I  +     +L++V+I+  +  +   R   EN  T K ++   + L+  +A E  +A  +     +E+  + + A  P   Y  + +  LFP                           + P    L V    Q   N  +  ++ ++L  +++F+L F   LE  +    + +  + S +   L   L   T ILK L+ +  ++  +  N  +  + R   +  K+L+NWF  L++  L+   AG  L +L+  I   +  GP++  T +++Y+L+E+ L+ ++IE+K L L   +   EN  E+ V+VL+CD I+Q K KI + +YK  PYS           W    +  ++  ++D           I  K E     L TL  Y + +   + +  K  S   +P+S +   SVS         S   S  +  SR     +PM    PD+   + +  L  + H++  QK        +   Y T++ A K               L+  ++   + LF  +    ++PL +  +F   +         D  +    KSN L LRFW+ +I N  F+FD+   K +    CL  V++  MD CS +++   KD   T+ L++  I  Y   V  YY  I    +    + N Y    +R+     N+  A+  +Y  Y++   +E++E ++
Sbjct:  261 SFVYFMTVQPET---PENGMSGGGSPGDLFYTSRIIRLCKDDKKFHSYVSLPVGC-IHRGEEYRLLQAAYLSKVGRVLA------------KSLNISAQEDVLFAVFS--KGQKQYHDPSDHSALCIFTIQDINARIKERLQSCYQGEG--NLELHWLLGKDVQCTKAPVPIDDHF-------CG------LDINQPLGGSQLVSGRTVFTESRDRLTSVTSYIYNGHSVVFLGSRSGRIKKIRLDNALEGGVLYETVIVMKDTGSILRDMAFSL----DRSSLYVMSKNQVVQVPVESCEQYGTCAECLSSGDPHCGWCVLHNMCSRRDRCPR-MDESFRFATDIDRC--VKVISHPDSIAVSAHSVPLLLEVNNVP-----DLSAGITCSFGQQT-------QADGHVKGNRVMCLSPAGKEVPRIPEGQDWAGVELRLNSKETGQMVASTEVKFYNCSTHQMCLSCVNSTFRCHWCKYRNLCTHDP-SSCSFQEGRVNGSEDCPQLLNSGEIL-IPAGEVRPITLRARNLPQPQSGQRGYECVVNVQGASHRVTALRFNSTSVQCQNSSYMYESVKISDLAVDLSIIWN-GNFI---IDNPEKIKVHLYKCSAQRDSCGMCLRAEKKFQCGWCSGEGRCTMKQHCPPISPYASRWLDLSSRNVKCTNPRITEVSPVAGPVEGGTLVTIKGLNLGLSFSELEGNVEVAGVQ----CTPKEEGYITAEQIVCEMTVAPDGSVPGPVKLCIDECKPELQALSTQLYSFVSPTMVALIPGRGPESGGTKVTIVGESLDAGSNINILFGNQT----CELFKRTNLEIVC-------------FSGPSVTGAGPVQVSLTVDRARVPGSLSFEYIEDPTVQRIEPLWSITSGHTILTVTGTNLDVVQEPRVRVKYAGQESVNVCKVLNTTTISCFAPSLKADYTNDQESIKHVDEFGFVFNNVQALLTFNNTGFIYYPNPYLEPLSLTGVLEQKPGAPIILKGRNLVPSASGGARLNYSVLIGDAPCS-LTVSDTQLLC---EPPNLTGQHK----------ILVQVGGLHISPGEVHIRSDSLLTLPAISSITAGGGLLLIVVIIVLLAYR---RKSHENDLTLKRLQMQMDNLESRVALECKEAFAELQTDINELTSDLDRAGIPFLDYRTFAMRVLFPGID------------------------DHPVLRELEVPGSGQA--NVEKALKQFAQLVNNKVFLLTFIRTLELQRSFSMRDRGYVASLIMTALQSRLEYATDILKHLLSDLIERNLESKNHPKLLLRRTESVAEKMLTNWFAFLLHKFLKEC-AGEPLFMLFCAIKQQMEKGPIDAVTGEARYSLSEDKLIRQQIEYKTLTLSCVNPDNENSPEIPVKVLNCDTITQVKEKILDAVYKNMPYSLRPRAADMDLEWRQGRTARVVLQDED-----------ITTKIEGDWKRLNTLMHYQVSERCVVALVPKQMSSFIIPSSASFPRSVSRYGVDVPFRSTPTSPDSPHSR-----VPM--LTPDLESGVKVWHLVKN-HDHGDQKEGERGSKMVSEIYLTRLLATKG-------------TLQKFVDDLFETLFSTVCRGTALPLAIKYMFDFLDEQADRHGIHDVDVRHTWKSNCLPLRFWVNVIKNPQFVFDIH--KSSITDACLSVVAQTFMDSCSTSEHRLGKDSPSTKLLYAKDIPHYKSWVERYYADINRLPAISDQDMNAYLAEQARLHSSEFNVLSALHEIY-TYVSKYSQEIIEALE 1886          
BLAST of plexin A vs. Ensembl Medaka
Match: ENSORLT00000020869.2 (plexin-A1 [Source:NCBI gene;Acc:101175150])

HSP 1 Score: 254.988 bits (650), Expect = 1.236e-67
Identity = 345/1525 (22.62%), Postives = 640/1525 (41.97%), Query Frame = 2
Query: 1304 GKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYK-----------YELFEDTNYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKN---FVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQK------ASIKCSMKVSWILGNLLTGSIETETP--IEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKF--QKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNIN----DRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKD-KLIRFKRSSNPKKASLQLNIDANSIQF--TDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPTTSNITQFQKCSLLFAMEKG-------SVCVYNTSITIFSTPVLR-INP-NKISL-PTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVS-GYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQ--AAIQDEIHK-----NWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNIC-VAMKNESLPASNTASVSH-LESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFN-----NICKDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            G++FN+ +     G  S I    +  +   G + +    Y   T+A +G  +G L K             L+E          L  ++ F+  +      IY + D +++R  + +C   T C +CL    P CGWC+ +  C  KD+C  A   P +     + C  + V P +  +  S     ++ Q    P   LSE    + C F          V+    I    + C+ P   +I PI +NK     + L LK    D       +  YNC+  ++C  CVN  F C WC   + C  ++   C     +  N   CP +  S + +   VG    I L  KN     + + ++ C+      T   S+ A      + Q  K          + +   + V W       G    + P  I+  ++ C  L + C  C+     ++CG+C  + KC  +  C   ++ W+++     +C  P I ++ P        +++ + G NLG    D++N + +     +  C   E+ YIS+++  C++ +         +  V  +       K + +K F F +P    + PN GP  GGT I + GS LN GS   V  N G  P              CR   FE ++ K I    S+     ++ + +D NS +    +V+F +  +P + KI  +  +++GG    +TG +   + +P +  +    LS+     +NN+ + C+ P+ +   Q    +++   E G       SV V N + +    PVL  ++P  K+ L PT+ L +  + L+ +         V+  ++ ++ + +G   C  ++   + + C              +   L G++ +TV  G  ++  G + + + S++ +  I+ +     +L++VII+  +  K++ R     +  +++  + + +  R   E  +  A +Q +IH+     +    P   Y  Y +  LFP                                HP++  K+++V  N  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  DK  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+ L+CD ++Q K K+ + +YK +PYS           K +  ++   +  +A I L++    T        L TL  Y + DG  I  V  +N +   SN+++++  L    + L+T  S + +    PM    PD+     +  L  + H++S Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +     +   D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct:  404 GQDFNQPL-----GGTSPIEGVPLYIDKEDGMTSVAAYDYRGNTVAFVGTRNGKLKKILVNSVNSNRSAVLYEKVTVSEGGSPLLRDMLFSPDLQH----IYTLTDRQVVRVPVESCEQYTTCGECLGSRDPHCGWCVLHNVCSRKDRCERA-GEPQRFASDQRQCVELTVQPGNISVTMSEVQ--LVLQARNVP--DLSEG---VNCSFEDY-------VETEGRIQGEHIFCLSPSATDIAPITKNKGDKRVIKLYLKSKETDKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKFRHICTQNAY-DCSFMEGLIKNSEGCPQILPSTQ-IYIPVGVTKPIHLAAKNLPQPQSGQRNYECVFHIQGETH--SVPAVRFNSTSIQCQKTAYNYEGDDISDLPVDLSVMW------NGKFVIDNPLNIKAHLYKCDALRKSCGMCLKANPRFECGWCAAEKKCSLRQECTPPETTWMHATTGNTRCIHPKITKLTPDLGPRQGGTMLTILGENLGLQFKDIQNGVRIG----KVICIPQEEEYISAERIVCQLNDATGYRVQHAQVEVCVRDCLHPDYKTVSAKPFTFVTPFFTHVHPNVGPQSGGTRITIEGSDLNAGS--NVTVNIGLYP--------------CR---FEKRNSKEIVCVTSAAKATGAMPVMVDINSAELRNPEVKFNYTSDPTILKIDPDWSIASGGTTLTVTGTDFATIKEPRMRAKYGAALSVNNCTVLNNTVMVCLVPSVAGSDQLLPDAVISPDEIGFVMDDVHSVLVVNETFSYHPDPVLEPLSPTGKLVLKPTSPLILKGRNLIPV---------VTGNYKLNYTVLIGDTPCV-LTLSESQLLC--------------EWPNLTGEHKVTVRVGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLVIIMVLIAYKRKSRDADRTL--KRLQLQMDNLESRVALECKEAFAELQTDIHELTQELDGAGIPFLDYRTYAMRVLFPGIE----------------------------DHPVL--KEMEVPANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAMTGEARYSLSEDKLIRQQIDYKTLTLHCVNPENENAPEVTVKSLNCDTVTQVKEKLLDAVYKGTPYSQRP--------KASDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVMDGSVIALVPKQNSAYNISNSSTLTKSLSRYESMLRTASSPDSLRSRTPM--LTPDLESGTKLWHLVKN-HDHSDQREVDRGS--------------KMVSEIYLTRLLSTK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHFITDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDI--HKNSITDACLSVVAQTFMDSCSTSEHK 1785          
BLAST of plexin A vs. Ensembl Medaka
Match: ENSORLT00000035326.1 (plexin-A1 [Source:NCBI gene;Acc:101175150])

HSP 1 Score: 253.832 bits (647), Expect = 2.968e-67
Identity = 328/1435 (22.86%), Postives = 611/1435 (42.58%), Query Frame = 2
Query: 1541 NMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKN---FVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQK------ASIKCSMKVSWILGNLLTGSIETETP--IEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKF--QKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNIN----DRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKD-KLIRFKRSSNPKKASLQLNIDANSIQF--TDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPTTSNITQFQKCSLLFAMEKG-------SVCVYNTSITIFSTPVLR-INP-NKISL-PTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVS-GYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQ--AAIQDEIHK-----NWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNIC-VAMKNESLPASNTASVSH-LESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFN-----NICKDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            +M+ + +   IY + D +++R  + +C   T C +CL    P CGWC+ +  C  KD+C  A   P +     + C  + V P +  +  S     ++ Q    P   LSE    + C F          V+    I    + C+ P   +I PI +NK     + L LK    D       +  YNC+  ++C  CVN  F C WC   + C  ++   C     +  N   CP +  S + +   VG    I L  KN     + + ++ C+      T   S+ A      + Q  K          + +   + V W       G    + P  I+  ++ C  L + C  C+     ++CG+C  + KC  +  C   ++ W+++     +C  P I ++ P        +++ + G NLG    D++N + +     +  C   E+ YIS+++  C++ +         +  V  +       K + +K F F +P    + PN GP  GGT I + GS LN GS   V  N G  P              CR   FE ++ K I    S+     ++ + +D NS +    +V+F +  +P + KI  +  +++GG    +TG +   + +P +  +    LS+     +NN+ + C+ P+ +   Q    +++   E G       SV V N + +    PVL  ++P  K+ L PT+ L +  + L+ +         V+  ++ ++ + +G   C  ++   + + C              +   L G++ +TV  G  ++  G + + + S++ +  I+ +     +L++VII+  +  K++ R     +  +++  + + +  R   E  +  A +Q +IH+     +    P   Y  Y +  LFP                                HP++  K+++V  N  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  DK  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+ L+CD ++Q K K+ + +YK +PYS           K +  ++   +  +A I L++    T        L TL  Y + DG  I  V  +N +   SN+++++  L    + L+T  S + +    PM    PD+     +  L  + H++S Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +     +   D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct:  424 DMLFSPDLQHIYTLTDRQVVRVPVESCEQYTTCGECLGSRDPHCGWCVLHNVCSRKDRCERA-GEPQRFASDQRQCVELTVQPGNISVTMSEVQ--LVLQARNVP--DLSEG---VNCSFEDY-------VETEGRIQGEHIFCLSPSATDIAPITKNKGDKRVIKLYLKSKETDKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKFRHICTQNAY-DCSFMEGLIKNSEGCPQILPSTQ-IYIPVGVTKPIHLAAKNLPQPQSGQRNYECVFHIQGETH--SVPAVRFNSTSIQCQKTAYNYEGDDISDLPVDLSVMW------NGKFVIDNPLNIKAHLYKCDALRKSCGMCLKANPRFECGWCAAEKKCSLRQECTPPETTWMHATTGNTRCIHPKITKLTPDLGPRQGGTMLTILGENLGLQFKDIQNGVRIG----KVICIPQEEEYISAERIVCQLNDATGYRVQHAQVEVCVRDCLHPDYKTVSAKPFTFVTPFFTHVHPNVGPQSGGTRITIEGSDLNAGS--NVTVNIGLYP--------------CR---FEKRNSKEIVCVTSAAKATGAMPVMVDINSAELRNPEVKFNYTSDPTILKIDPDWSIASGGTTLTVTGTDFATIKEPRMRAKYGAALSVNNCTVLNNTVMVCLVPSVAGSDQLLPDAVISPDEIGFVMDDVHSVLVVNETFSYHPDPVLEPLSPTGKLVLKPTSPLILKGRNLIPV---------VTGNYKLNYTVLIGDTPCV-LTLSESQLLC--------------EWPNLTGEHKVTVRVGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLVIIMVLIAYKRKSRDADRTL--KRLQLQMDNLESRVALECKEAFAELQTDIHELTQELDGAGIPFLDYRTYAMRVLFPGIE----------------------------DHPVL--KEMEVPANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAMTGEARYSLSEDKLIRQQIDYKTLTLHCVNPENENAPEVTVKSLNCDTVTQVKEKLLDAVYKGTPYSQRP--------KASDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVMDGSVIALVPKQNSAYNISNSSTLTKSLSRYESMLRTASSPDSLRSRTPM--LTPDLESGTKLWHLVKN-HDHSDQREVDRGS--------------KMVSEIYLTRLLSTK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHFITDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDI--HKNSITDACLSVVAQTFMDSCSTSEHK 1724          
BLAST of plexin A vs. Ensembl Medaka
Match: ENSORLT00000040208.1 (plexin-A1 [Source:NCBI gene;Acc:101175150])

HSP 1 Score: 253.832 bits (647), Expect = 3.429e-67
Identity = 345/1525 (22.62%), Postives = 640/1525 (41.97%), Query Frame = 2
Query: 1304 GKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIVFSIYEKFTLAMIGGNDGILYK-----------YELFEDTNYLFSTENLFNNISFNMVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCL-RVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSILSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAENKN---FVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDNSCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQK------ASIKCSMKVSWILGNLLTGSIETETP--IEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKF--QKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNIN----DRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKD-KLIRFKRSSNPKKASLQLNIDANSIQF--TDVQFEFFPNPHVKKISKNKFLSNGGQMFKITGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPTTSNITQFQKCSLLFAMEKG-------SVCVYNTSITIFSTPVLR-INP-NKISL-PTNLLRIIKQKLVTINLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIYHKYQISLLMGKNVLTVS-GYIQFEKGDISLDNMSXXXXXXXXXXXXXXXXXXXXXXXKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQ--AAIQDEIHK-----NWNTAPIHQYIVYILYNLFPNTHPRLYXXXXXXXXXXXXXXYYKYNCNDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEVESK-KSDIVSFLSLILMKDLPNYTRILKILIKNDYDK--KKLNEEERSMFRQSDLLSKLLSNWFFILMYDHLQNINAGGDXXXXXXXXXXXXXXGPVNWETSKSQYALNENSXXXXXXXXXXXXXXXXXXXXXNDSELVVEVLDCDCISQAKLKIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT--------LKTLKDYDIKDGDNIC-VAMKNESLPASNTASVSH-LESNSASLKTNKSRN-ISKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDGHHLKPACLIY-TQVLKSKIEGQIKNLFDDIFDY--------ESVPLCVSDLFTHFN-----NICKDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRILMDICSENQNK 5644
            G++FN+ +     G  S I    +  +   G + +    Y   T+A +G  +G L K             L+E          L  ++ F+  +      IY + D +++R  + +C   T C +CL    P CGWC+ +  C  KD+C  A   P +     + C  + V P +  +  S     ++ Q    P   LSE    + C F          V+    I    + C+ P   +I PI +NK     + L LK    D       +  YNC+  ++C  CVN  F C WC   + C  ++   C     +  N   CP +  S + +   VG    I L  KN     + + ++ C+      T   S+ A      + Q  K          + +   + V W       G    + P  I+  ++ C  L + C  C+     ++CG+C  + KC  +  C   ++ W+++     +C  P I ++ P        +++ + G NLG    D++N + +     +  C   E+ YIS+++  C++ +         +  V  +       K + +K F F +P    + PN GP  GGT I + GS LN GS   V  N G  P              CR   FE ++ K I    S+     ++ + +D NS +    +V+F +  +P + KI  +  +++GG    +TG +   + +P +  +    LS+     +NN+ + C+ P+ +   Q    +++   E G       SV V N + +    PVL  ++P  K+ L PT+ L +  + L+ +         V+  ++ ++ + +G   C  ++   + + C              +   L G++ +TV  G  ++  G + + + S++ +  I+ +     +L++VII+  +  K++ R     +  +++  + + +  R   E  +  A +Q +IH+     +    P   Y  Y +  LFP                                HP++  K+++V  N  +      +L   + F+L F   LE  +    + + ++ S +   L  ++   T +LK L+ +  DK  +  N  +  + R   +  K+L+NWF  L+Y  L+   AG  L +LY  I   +  GP++  T +++Y+L+E+ L+ ++I++K L L   +   EN  E+ V+ L+CD ++Q K K+ + +YK +PYS           K +  ++   +  +A I L++    T        L TL  Y + DG  I  V  +N +   SN+++++  L    + L+T  S + +    PM    PD+     +  L  + H++S Q+   +                K    IY T++L +K  G ++   DD+F+          ++PL +  +F   +     +   D  +    KSN L LRFW+ +I N  F+FD+   K++    CL  V++  MD CS +++K
Sbjct:  404 GQDFNQPL-----GGTSPIEGVPLYIDKEDGMTSVAAYDYRGNTVAFVGTRNGKLKKILVNSVNSNRSAVLYEKVTVSEGGSPLLRDMLFSPDLQH----IYTLTDRQVVRVPVESCEQYTTCGECLGSRDPHCGWCVLHNVCSRKDRCERA-GEPQRFASDQRQCVELTVQPGNISVTMSEVQ--LVLQARNVP--DLSEG---VNCSFEDY-------VETEGRIQGEHIFCLSPSATDIAPITKNKGDKRVIKLYLKSKETDKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKFRHICTQNAY-DCSFMEGLIKNSEGCPQILPSTQ-IYIPVGVTKPIHLAAKNLPQPQSGQRNYECVFHIQGETH--SVPAVRFNSTSIQCQKTAYNYEGDDISDLPVDLSVMW------NGKFVIDNPLNIKAHLYKCDALRKSCGMCLKANPRFECGWCAAEKKCSLRQECTPPETTWMHATTGNTRCIHPKITKLTPDLGPRQGGTMLTILGENLGLQFKDIQNGVRIG----KVICIPQEEEYISAERIVCQLNDATGYRVQHAQVEVCVRDCLHPDYKTVSAKPFTFVTPFFTHVHPNVGPQSGGTRITIEGSDLNAGS--NVTVNIGLYP--------------CR---FEKRNSKEIVCVTSAAKATGAMPVMVDINSAELRNPEVKFNYTSDPTILKIDPDWSIASGGTTLTVTGTDFATIKEPRMRAKYGAALSVNNCTVLNNTVMVCLVPSVAGSDQLLPDAVISPDEIGFVMDDVHSVLVVNETFSYHPDPVLEPLSPTGKLVLKPTSPLILKGRNLIPV---------VTGNYKLNYTVLIGDTPCV-LTLSESQLLC--------------EWPNLTGEHKVTVRVGGFEYSPGTLQIYSDSLLTLPAIIGIGGGGGLLLLVIIMVLIAYKRKSRDADRTL--KRLQLQMDNLESRVALECKEAFAELQTDIHELTQELDGAGIPFLDYRTYAMRVLFPGIE----------------------------DHPVL--KEMEVPANVEKSLTLFGQLLTKKHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIDKNLESKNHPKLLLRRTESVAEKMLTNWFTFLLYKFLKEC-AGEPLFMLYCAIKQQMEKGPIDAMTGEARYSLSEDKLIRQQIDYKTLTLHCVNPENENAPEVTVKSLNCDTVTQVKEKLLDAVYKGTPYSQRP--------KASDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVMDGSVIALVPKQNSAYNISNSSTLTKSLSRYESMLRTASSPDSLRSRTPM--LTPDLESGTKLWHLVKN-HDHSDQREVDRGS--------------KMVSEIYLTRLLSTK--GTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHFITDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDI--HKNSITDACLSVVAQTFMDSCSTSEHK 1785          
BLAST of plexin A vs. Planmine SMEST
Match: SMESG000006542.1 (SMESG000006542.1)

HSP 1 Score: 838.951 bits (2166), Expect = 0.000e+0
Identity = 409/434 (94.24%), Postives = 413/434 (95.16%), Query Frame = 2
Query:   62 MIKTKRFLILSVINIFITEICALTSEIFVYKYENLDKIMLHNNKSHKSILVSGKNYILQFSENNLKEPLAIRKTGPVNHSVMCTEPNQCQTSLCPKELISRDQCRIKLTDVFVKLWTFADSYLVVCYDVFQGFCEIIDLYNQFSSSYKNKAYSIVTNDRKFHSTVLYHDQRLFFANEVYHPSNYREIDFNTMSILSFPNMTYFKPDYPFQANFGKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIG 1363
            MIKTKRFLILSVINIFITEICALTSEIFVYKYENLDKIMLHNNKSHKSILVSGKNYILQFSENNLKEPLAIRKTGPVNHSVMCTEP QCQTSLCPKELISRDQCRIKLTDVFVKLWTFADSYLVVCYDVFQGFCEIIDLYNQFSSSYKNK YSIVTNDRKFHSTVLYHDQRLFFANEVYHPSNYREIDFNTMSILSFPNMTYFKPDYPFQANFGKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFT   + +C     +   +  H G    IG
Sbjct:    1 MIKTKRFLILSVINIFITEICALTSEIFVYKYENLDKIMLHNNKSHKSILVSGKNYILQFSENNLKEPLAIRKTGPVNHSVMCTEPYQCQTSLCPKELISRDQCRIKLTDVFVKLWTFADSYLVVCYDVFQGFCEIIDLYNQFSSSYKNKVYSIVTNDRKFHSTVLYHDQRLFFANEVYHPSNYREIDFNTMSILSFPNMTYFKPDYPFQANFGKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQVHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNNYRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRCMEDGFT---QPDCPTLEVSNETLSFHVGSPISIG 431          

HSP 2 Score: 140.969 bits (354), Expect = 1.147e-34
Identity = 67/69 (97.10%), Postives = 68/69 (98.55%), Query Frame = 2
Query: 2219 QPDCPTLEVSNETLSFHVGFPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMM 2425
            QPDCPTLEVSNETLSFHVG PISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQM+
Sbjct:  407 QPDCPTLEVSNETLSFHVGSPISIGLMTKNFRNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMV 475          
BLAST of plexin A vs. Planmine SMEST
Match: SMESG000006541.1 (SMESG000006541.1)

HSP 1 Score: 488.804 bits (1257), Expect = 2.066e-159
Identity = 238/238 (100.00%), Postives = 238/238 (100.00%), Query Frame = 2
Query: 2423 MKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILE 3136
            MKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILE
Sbjct:    1 MKVLQKASIKCSMKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILE 238          
BLAST of plexin A vs. Planmine SMEST
Match: SMESG000006541.1 (SMESG000006541.1)

HSP 1 Score: 465.307 bits (1196), Expect = 5.071e-151
Identity = 226/226 (100.00%), Postives = 226/226 (100.00%), Query Frame = 2
Query: 2459 MKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILE 3136
            MKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILE
Sbjct:    1 MKVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCTVKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVKGRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRIETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGSFLNIGSRREVKFNYGTAPIICNILE 226          
BLAST of plexin A vs. Planmine SMEST
Match: SMESG000049328.1 (SMESG000049328.1)

HSP 1 Score: 157.147 bits (396), Expect = 7.577e-45
Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 2
Query: 1544 MVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKA 1762
            MVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKA
Sbjct:    1 MVVNENKSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVSPFCGWCISNGKCVVKDQCTTAMWLPFQRNRTVKA 73          
BLAST of plexin A vs. Planmine SMEST
Match: SMESG000070796.1 (SMESG000070796.1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.629e-13
Identity = 71/256 (27.73%), Postives = 115/256 (44.92%), Query Frame = 2
Query:  197 HKSILVSGKNYILQFSENNLKEPLAIRKTGPVNHSVMCTEPNQCQTSLCPKELISRDQCRIKLTDVFVKLWTFA--DSYLVVCYDVFQGFCE--IIDLYNQFSS--SYKNKAYSIVTNDRKFHSTVLYHDQRLFFANEVYHPSNYREIDFNTMSILSFPNMTYF-----KPDYPFQANFGKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFFLVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNC 931
            HK I+V+ KN+I+  S++   + L    TGPVN S+ C    +C  + CP        C    TDV VK W       YL+VCY+++QG+CE  +ID     +   S       +V  D +  ST+   D  L   ++     +Y  +  N + ++SF N+  F     KP    + N   L  +     F L+F   F       +AF    I  L +QP    + ++    + + R+C  D D+ S+++I + C
Sbjct:   41 HKRIIVAIKNFII-VSDSFTYQILNTITTGPVNDSLYCINSMECDPN-CPSS------CGKVSTDVSVKSWIVDRNQQYLIVCYNIYQGYCERFLIDTDGNINPNRSIDKTTTPVVNADPRGASTLFVFDNILIVCSQ--RNISYDPLKLN-LPVISFRNIDDFHIIQPKPFQLLRENLSGLQLKTTSE-FSLKFHKVFEFTTRTSEAF----ILILFSQPRKLKDSRSSDNCIVMSRMCKEDYDFESYVEIQLQC 280          
The following BLAST results are available for this feature:
BLAST of plexin A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLXNA11.257e-6822.62plexin A1 [Source:HGNC Symbol;Acc:HGNC:9099][more]
PLXNA23.207e-5020.70plexin A2 [Source:HGNC Symbol;Acc:HGNC:9100][more]
PLXNB22.320e-3919.84plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104][more]
PLXNB22.320e-3919.84plexin B2 [Source:HGNC Symbol;Acc:HGNC:9104][more]
PLXNA44.810e-3920.84plexin A4 [Source:HGNC Symbol;Acc:HGNC:9102][more]
back to top
BLAST of plexin A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plx-11.880e-7923.06PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-14.347e-7923.06PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-18.038e-7822.95PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-11.488e-7722.95PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
plx-12.136e-5023.73PLeXin [Source:UniProtKB/TrEMBL;Acc:U4PC90][more]
back to top
BLAST of plexin A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PlexA3.808e-8022.44gene:FBgn0025741 transcript:FBtr0089223[more]
PlexA8.460e-7822.23gene:FBgn0025741 transcript:FBtr0309865[more]
PlexA8.828e-7122.45gene:FBgn0025741 transcript:FBtr0089224[more]
PlexA8.828e-7122.45gene:FBgn0025741 transcript:FBtr0089225[more]
PlexB8.963e-4522.19gene:FBgn0025740 transcript:FBtr0308297[more]
back to top
BLAST of plexin A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plxna1a7.986e-7222.34plexin A1a [Source:ZFIN;Acc:ZDB-GENE-140106-137][more]
plxna21.359e-5222.00plexin A2 [Source:ZFIN;Acc:ZDB-GENE-090311-6][more]
plxna21.359e-5222.00plexin A2 [Source:ZFIN;Acc:ZDB-GENE-090311-6][more]
plxna21.776e-5222.00plexin A2 [Source:ZFIN;Acc:ZDB-GENE-090311-6][more]
plxnb2b5.143e-5121.71plexin b2b [Source:ZFIN;Acc:ZDB-GENE-080902-1][more]
back to top
BLAST of plexin A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plxna17.727e-6422.49plexin A1 [Source:NCBI gene;Acc:100037845][more]
plxna13.638e-6322.48plexin A1 [Source:NCBI gene;Acc:100037845][more]
plxna11.118e-6022.28plexin A1 [Source:NCBI gene;Acc:100037845][more]
plxna19.134e-6022.01plexin A1 [Source:NCBI gene;Acc:100037845][more]
plxna29.985e-5821.69plexin A2 [Source:NCBI gene;Acc:100144723][more]
back to top
BLAST of plexin A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plxna23.132e-6721.47plexin A2 [Source:MGI Symbol;Acc:MGI:107684][more]
Plxna12.739e-4323.19plexin A1 [Source:MGI Symbol;Acc:MGI:107685][more]
Plxna12.739e-4323.19plexin A1 [Source:MGI Symbol;Acc:MGI:107685][more]
Plxnb21.949e-4020.04plexin B2 [Source:MGI Symbol;Acc:MGI:2154239][more]
Plxnb21.949e-4020.04plexin B2 [Source:MGI Symbol;Acc:MGI:2154239][more]
back to top
BLAST of plexin A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UIW2|PLXA1_HUMAN6.035e-6822.62Plexin-A1 OS=Homo sapiens OX=9606 GN=PLXNA1 PE=1 S... [more]
sp|P70207|PLXA2_MOUSE2.191e-6621.47Plexin-A2 OS=Mus musculus OX=10090 GN=Plxna2 PE=1 ... [more]
sp|O75051|PLXA2_HUMAN1.540e-4920.70Plexin-A2 OS=Homo sapiens OX=9606 GN=PLXNA2 PE=1 S... [more]
sp|Q9V4A7|PLXB_DROME8.985e-4422.19Plexin-B OS=Drosophila melanogaster OX=7227 GN=Ple... [more]
sp|P70206|PLXA1_MOUSE1.916e-4223.19Plexin-A1 OS=Mus musculus OX=10090 GN=Plxna1 PE=1 ... [more]
back to top
BLAST of plexin A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0K0LJ460.000e+099.70Plexin A (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A016RRU93.535e-8023.30Sema domain-containing protein OS=Ancylostoma ceyl... [more]
A0A016RT134.764e-8023.30Sema domain-containing protein OS=Ancylostoma ceyl... [more]
A0A183UAV31.693e-7823.23Sema domain-containing protein OS=Toxocara canis O... [more]
A8XIW22.104e-7823.42Protein CBR-PLX-1 OS=Caenorhabditis briggsae OX=62... [more]
back to top
BLAST of plexin A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plxna1a1.240e-7321.86plexin-A1-like [Source:NCBI gene;Acc:103026658][more]
ENSAMXT00000016691.25.398e-6922.35plexin A1 [Source:NCBI gene;Acc:103028361][more]
ENSAMXT00000046590.13.981e-6220.86pep primary_assembly:Astyanax_mexicanus-2.0:22:185... [more]
plxna1a3.041e-5322.87plexin-A1-like [Source:NCBI gene;Acc:103026658][more]
plxna46.575e-4721.15plexin A4 [Source:NCBI gene;Acc:325938][more]
back to top
BLAST of plexin A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000009284.11.384e-1329.59pep scaffold:Pmarinus_7.0:GL476385:264710:288126:-... [more]
ENSPMAT00000006110.11.082e-728.95pep scaffold:Pmarinus_7.0:GL484765:748:3341:1 gene... [more]
ENSPMAT00000007728.14.269e-627.16pep scaffold:Pmarinus_7.0:GL483331:9686:16681:-1 g... [more]
back to top
BLAST of plexin A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of plexin A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO390093.039e-6320.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297101.666e-932.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of plexin A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plxna21.479e-6921.47plexin-A2 [Source:NCBI gene;Acc:101158766][more]
PLXNA25.199e-6921.19plexin-A2 [Source:NCBI gene;Acc:101160644][more]
ENSORLT00000020869.21.236e-6722.62plexin-A1 [Source:NCBI gene;Acc:101175150][more]
ENSORLT00000035326.12.968e-6722.86plexin-A1 [Source:NCBI gene;Acc:101175150][more]
ENSORLT00000040208.13.429e-6722.62plexin-A1 [Source:NCBI gene;Acc:101175150][more]
back to top
BLAST of plexin A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006542.11.147e-3494.24SMESG000006542.1[more]
SMESG000006541.12.066e-159100.00SMESG000006541.1[more]
SMESG000006541.15.071e-151100.00SMESG000006541.1[more]
SMESG000049328.17.577e-45100.00SMESG000049328.1[more]
SMESG000070796.11.629e-1327.73SMESG000070796.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014347
GenBankAJA72712.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014347 ID=SMED30014347|Name=plexin A|organism=Schmidtea mediterranea sexual|type=transcript|length=6045bp
ATTATTTGTTAAGTTTTATTTATTTCTTATTTTTAATTGTAACTAGAATA
TTTTTAATTCAATGATCAAGACAAAAAGATTTCTCATTTTATCTGTTATC
AATATTTTCATAACTGAAATTTGTGCTTTGACATCAGAAATATTTGTTTA
TAAATATGAAAACCTTGATAAGATAATGCTTCACAATAATAAATCACATA
AATCTATTCTTGTGTCCGGGAAAAATTATATATTGCAATTTTCAGAAAAT
AATTTAAAGGAACCTTTAGCAATCAGAAAGACCGGACCGGTAAACCATTC
CGTTATGTGCACGGAACCTAACCAGTGCCAAACCTCATTATGTCCAAAAG
AATTGATTTCACGTGATCAATGTAGAATAAAGTTAACAGATGTTTTTGTT
AAATTATGGACGTTTGCAGATTCTTATTTAGTAGTTTGCTATGATGTTTT
TCAAGGTTTTTGTGAAATTATAGATTTATATAATCAGTTTTCTTCCTCAT
ATAAAAATAAAGCTTATTCCATTGTGACTAATGATCGAAAATTCCATTCC
ACTGTTTTGTATCATGATCAAAGACTTTTCTTTGCTAATGAAGTCTATCA
TCCATCAAATTATCGAGAGATCGACTTCAATACAATGTCTATTCTATCAT
TTCCTAATATGACATACTTCAAACCAGATTATCCATTCCAGGCCAATTTT
GGGAAATTAGTGTATCAGGGAGGGGAAACTATATTTCCATTGGAATTTGT
AGGATCATTTCATATTTACGATTCAAGAAAAGATGCATTTTTTAAGAACT
ATATATTTTTTTTGGTTAATCAACCAGAAAATAAGCATGAGCCGAAAAAT
GGACTATTTCAAGTGAGGCTGGTTCGAATTTGTTCATTTGATGATGATTA
TACCTCATTTATTGATATTGGTATGAATTGTGACATTGATAATCAATGGA
CATATTATCAAGTCCACAGTTGGATCGTTGCCAATGTTAGTGATGATATG
GCAAATTGGTATCGGAATAAAACTAGATTTTCTCGCATTAAAACGGAAAT
GGATTCAGATTTTCATCAAATTCTTTTTATAAATTTCAAAATAATTCTGG
TTACGAACAATTACAGGGAAACTTTTAATTCTTTTGTTACCTGCGCATAT
CCCATTGCTGAAATCATGGAATTATATGATGTTGTTAGAAATTTGTGTTT
AGTGGGGAGTGGATCTGTTAACGAGAATCCATATAACTTCAAATCAACTG
ATAAAAGGTGTATGGAAGATGGTTTTACGAGTACCGGAAAAGGCGAGTGT
GGTGGGAAAAATTTTAATAAATTTATAATTGGGGATCATTATGGAGAAAA
TAGTATTATTGGACATAGAGTAATTAGTAGAAATGGAGTGCAAGGTTACA
GTTTGATTGTTTTCTCAATTTATGAGAAATTTACATTAGCCATGATAGGC
GGCAATGATGGAATTTTATACAAGTATGAACTTTTTGAAGACACAAATTA
TCTATTTTCTACGGAGAATCTTTTTAATAATATTAGTTTCAATATGGTTG
TAAATGAAAACAAATCTGTTATATATGCAGTGGCAGATTCAAAAATAATT
CGTCATAATCTTAGAAATTGCTATAATGGCACTAATTGTGAAGATTGTTT
ACGCGTTAGTCCATTTTGTGGATGGTGTATTTCTAATGGAAAATGTGTAG
TTAAAGATCAGTGTACCACTGCGATGTGGCTTCCATTTCAACGAAACCGA
ACAGTAAAAGCATGTCCTCTAATAAATGTAATACCAAGTCATAGCATTTT
GGAATATTCTAACAAAAGTCCAACTGTAATTTTTCAAGTATCTAAGACTC
CTCTTTCTATACTATCAGAAAATGATAAATTTTTGAAGTGTAAATTTACA
TCAAATAATAATCGCGAAATAGCTAACGTAAAAGCACATTATTTTATACA
CAATCATTCGTTAAGCTGTATTGGACCACATGGAAAAAATATTCCACCAA
TTGCTGAAAATAAAAATTTTGTTGATTTAAAACTCAAAGTTTTAATTAAT
GATTCTCACCTGGTCGAGGGGATCTATCATATTTACAACTGTGCTCACAG
TAGAACATGCGCCCATTGTGTTAATAACAAATTTAATTGTTCTTGGTGCG
TCTTGGACAATTCATGTATTTCCAGTTCTCTAGGTAAATGCAAGAAAAAC
TTTGAAATACAAAATAATCAACCGGATTGTCCTACGCTAGAAGTTAGCAA
TGAAACTTTATCATTCCATGTCGGGTTCCCAATATCAATAGGACTTATGA
CAAAAAATTTTCGAAATTATTTTAACAGCAAAACGGATTTTGTCTGTTTG
GAAACATGTGACAATTCCACCGCCATTGGAAGTTTATCAGCTTCCAACCG
TTTGGTTTGCACTTTTCAAATGATGAAAGTACTTCAAAAAGCCAGTATCA
AATGTTCAATGAAGGTTTCTTGGATATTGGGCAATCTTTTAACTGGATCT
ATCGAAACTGAAACTCCAATTGAATTTCAAGTATTTGATTGCCTGAAACT
CTCTGAGCATTGTGATGATTGTGTTCATCTACCTCAAATATATAAATGCG
GATTCTGTACAGTTAAAGATAAATGTGTTCAAAAACACATTTGTGGAAAT
GATGATAGCAAATGGATTAATTCCAAATTCCAGAAATGTCCTTTGCCATC
AATAATGGAGATAATTCCTTCAAATTCCACTTTATCAAGTGAAAGTGTTA
TTCTAGTAAAAGGAAGAAATTTAGGATTTTATGAAAATGATGTTAAAAAC
GCTATAACATTAGAAAATAATCACTTCCAATTTTTTTGTAAATATATTGA
ACAATCATATATTAGTTCCAAACAATTCAAGTGTAAAATACAGAATATAA
ATGATCGAATCGAAACTCCAGTAGCTTTCCAATTCAAGTTCAAAACAAAG
GATAAATATTTGGTCTCTAAAGAATTTAAGTTTTTCTCACCCCGTGTATA
TTCTATAGAACCAAATTTCGGACCGTTTATTGGCGGCACTATTATTAAAG
TTAATGGCAGTTTTCTAAATATTGGATCCAGAAGGGAAGTAAAATTTAAT
TATGGAACAGCTCCTATTATTTGCAATATTTTAGAAAATCAGGAAAATTA
TATTTCTTGCCGTTTAAATGATTTTGAGGTGAAAGATAAATTAATTCGAT
TCAAAAGGAGTTCCAATCCTAAGAAAGCTTCTTTGCAATTAAATATAGAT
GCAAATTCTATCCAATTCACTGATGTTCAATTTGAATTTTTTCCAAATCC
TCATGTAAAGAAAATTTCTAAAAATAAATTTTTATCAAATGGGGGACAGA
TGTTCAAAATTACCGGCGACAACTTGAATCGTCTCAACAAACCGAGTGTA
GCATTTCGATGTGAAACATTTCTTAGCATTTATGAAAATTGTTTCGTGAA
TAATAGTGACATTGACTGTATTTCTCCCACAACTTCCAATATAACACAAT
TTCAAAAATGTTCTTTACTTTTTGCAATGGAAAAGGGAAGCGTATGTGTA
TACAATACATCTATTACTATTTTCTCAACTCCTGTTTTAAGAATAAATCC
CAATAAAATAAGTCTCCCAACCAATTTATTAAGAATCATCAAACAAAAGC
TGGTTACGATAAATTTAGAAGTAAACGATCAAATTTCTGTCAGTGCATTT
CATCAATCGGATTTTAAAATATTCGTTGGTCCAATTATTTGTACAAATAT
CAGTTTCTTTGGAAATAATATTCGTTGTAATATTATTGAAGTTAATCAAA
TTGATATTTATCATAAATATCAGATTAGTCTTTTGATGGGTAAAAATGTT
TTGACTGTTTCCGGATACATTCAATTTGAAAAGGGTGACATTTCATTAGA
CAATATGAGTGTTATTATAATCATACCTATAATGGTCGTTATAATATTTA
TTATAATTTTGGTAGTAGTTATTATTGTAAAAAAAGTTCAAAGCAAACAA
AGGTTAAGACACGAGAAAGAAAATATATTTACAGAAAAAATTATAAAAGA
AGCAAATGAAGTTTTAAAGAGAGGGATAGCTGAGCTCAATCAAGCCGCAA
TTCAAGATGAAATTCATAAAAATTGGAATACTGCTCCAATTCATCAATAT
ATTGTATATATTTTGTATAACCTCTTCCCAAATACACATCCCAGATTGTA
CAACGAGAGCAAAAATATAAATGAATCTATCATTAATTTGAATTATTATA
AATATAACTGCAATGACCCATTCACTCATCCATTAATAGTCAATAAACAA
ATTCAAGTTATTGAAAATACTGTGGAATATTCACGAAAACTATCGAAATT
ATTTGAAGATGAATTATTTGTATTAATGTTCTTTTCATTTTTAGAAGACC
ATCAAGAAGTGGAGTCAAAAAAGTCTGATATTGTATCATTTCTTTCTTTG
ATTCTTATGAAAGATCTCCCTAATTACACCAGAATTTTAAAAATTTTAAT
CAAGAATGATTATGATAAGAAAAAACTCAATGAAGAAGAAAGATCCATGT
TTCGTCAATCTGATTTATTGTCTAAACTATTGTCCAACTGGTTTTTTATT
CTTATGTACGATCACTTACAAAATATAAATGCTGGAGGAGATCTTTTGAT
ATTATATTTAAATATTTTAAATATAATAAATAACGGACCTGTTAATTGGG
AAACGAGCAAATCGCAATATGCTCTCAATGAAAATTCTTTGTTAGAAAGG
AAAATTGAATTTAAAAAACTTAAACTGAAAGTGAAACACGAATTCTTTGA
AAATGATTCTGAATTAGTAGTAGAAGTTTTAGATTGCGACTGTATAAGTC
AAGCAAAATTAAAAATATTTGAAGAAATATATAAATATTCGCCATATTCT
AATTGGTCTAGTTTTGAAAGTTATTGTTTAATAAAATTAAACCAAGATGA
AGTTCCTGAGAGTGAACGATTACTTGCGCCAATAGCTCTCAAAGAAGTAG
TAGGTTATACTCTCAAAACATTGAAAGATTATGATATTAAAGATGGAGAT
AATATTTGTGTAGCTATGAAAAACGAAAGTCTACCAGCCAGCAATACAGC
TAGTGTATCTCATTTGGAATCCAACAGTGCAAGTTTGAAAACTAATAAAT
CCAGAAACATTTCAAAGGACATTCCAATGACCTCGTTCCTTCCAGATATT
TCTAAAAGAATTCCTATACATCGCTTATCTGATTCATTACATGAAAACTC
ATCACAGAAATCTAAAATAAAATGTTGTTACAAAACTAAGATCAGTGCAT
TTAAAGATGGACATCATTTAAAACCTGCTTGTTTAATATATACTCAAGTT
TTAAAGTCAAAAATTGAAGGTCAAATAAAAAATCTTTTTGATGACATTTT
TGATTATGAATCCGTACCTCTGTGTGTTTCAGATTTATTTACACATTTCA
ATAATATCTGTAAAGATGATAGTATTGTTTTTGCAGTGAAATCCAACAGC
TTAGTTTTGAGATTTTGGATTCAACTCATTAATAACATAGATTTTTTATT
TGATGTTCCTTTAGTAAAGCATACCCCAGTTCTGGAATGCTTGAAATGTG
TCAGTCGCATATTAATGGATATTTGTTCAGAAAATCAAAATAAAGATGTT
TGGTTAACTCAGTTGTTCTCTGATGTTATAAAGCTCTACAGTCCAAAGGT
TTTGAATTATTACGAAGGAATTAAAGGTACTGGGAGTTTTAATTATAATG
AGTACTATGGCTCTTCAAGAATCGATGGTATAAACATTAGTTTGGCAATT
GTTATATTATATCAAAACTATATAAATTCTGTTCACAAAGAACTTGTGGA
AGTAATTCAGATTTCAAATTATCCAAAAGACAAACAAAATGAATGGATAA
CGATCTTGGAAGAAGTTAAAAATTTATATGTTGCAGAGAGCTTTCTGAAT
GAGAGTAATGGAGAAATAATAAAAACATCTATTTGTTAAAAAATAAATCA
AAGCTGTAATAAATTGTAATTTTGTAAATATTTCTAGTAAACAGA
back to top

protein sequence of SMED30014347-orf-1

>SMED30014347-orf-1 ID=SMED30014347-orf-1|Name=SMED30014347-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1976bp
MIKTKRFLILSVINIFITEICALTSEIFVYKYENLDKIMLHNNKSHKSIL
VSGKNYILQFSENNLKEPLAIRKTGPVNHSVMCTEPNQCQTSLCPKELIS
RDQCRIKLTDVFVKLWTFADSYLVVCYDVFQGFCEIIDLYNQFSSSYKNK
AYSIVTNDRKFHSTVLYHDQRLFFANEVYHPSNYREIDFNTMSILSFPNM
TYFKPDYPFQANFGKLVYQGGETIFPLEFVGSFHIYDSRKDAFFKNYIFF
LVNQPENKHEPKNGLFQVRLVRICSFDDDYTSFIDIGMNCDIDNQWTYYQ
VHSWIVANVSDDMANWYRNKTRFSRIKTEMDSDFHQILFINFKIILVTNN
YRETFNSFVTCAYPIAEIMELYDVVRNLCLVGSGSVNENPYNFKSTDKRC
MEDGFTSTGKGECGGKNFNKFIIGDHYGENSIIGHRVISRNGVQGYSLIV
FSIYEKFTLAMIGGNDGILYKYELFEDTNYLFSTENLFNNISFNMVVNEN
KSVIYAVADSKIIRHNLRNCYNGTNCEDCLRVSPFCGWCISNGKCVVKDQ
CTTAMWLPFQRNRTVKACPLINVIPSHSILEYSNKSPTVIFQVSKTPLSI
LSENDKFLKCKFTSNNNREIANVKAHYFIHNHSLSCIGPHGKNIPPIAEN
KNFVDLKLKVLINDSHLVEGIYHIYNCAHSRTCAHCVNNKFNCSWCVLDN
SCISSSLGKCKKNFEIQNNQPDCPTLEVSNETLSFHVGFPISIGLMTKNF
RNYFNSKTDFVCLETCDNSTAIGSLSASNRLVCTFQMMKVLQKASIKCSM
KVSWILGNLLTGSIETETPIEFQVFDCLKLSEHCDDCVHLPQIYKCGFCT
VKDKCVQKHICGNDDSKWINSKFQKCPLPSIMEIIPSNSTLSSESVILVK
GRNLGFYENDVKNAITLENNHFQFFCKYIEQSYISSKQFKCKIQNINDRI
ETPVAFQFKFKTKDKYLVSKEFKFFSPRVYSIEPNFGPFIGGTIIKVNGS
FLNIGSRREVKFNYGTAPIICNILENQENYISCRLNDFEVKDKLIRFKRS
SNPKKASLQLNIDANSIQFTDVQFEFFPNPHVKKISKNKFLSNGGQMFKI
TGDNLNRLNKPSVAFRCETFLSIYENCFVNNSDIDCISPTTSNITQFQKC
SLLFAMEKGSVCVYNTSITIFSTPVLRINPNKISLPTNLLRIIKQKLVTI
NLEVNDQISVSAFHQSDFKIFVGPIICTNISFFGNNIRCNIIEVNQIDIY
HKYQISLLMGKNVLTVSGYIQFEKGDISLDNMSVIIIIPIMVVIIFIIIL
VVVIIVKKVQSKQRLRHEKENIFTEKIIKEANEVLKRGIAELNQAAIQDE
IHKNWNTAPIHQYIVYILYNLFPNTHPRLYNESKNINESIINLNYYKYNC
NDPFTHPLIVNKQIQVIENTVEYSRKLSKLFEDELFVLMFFSFLEDHQEV
ESKKSDIVSFLSLILMKDLPNYTRILKILIKNDYDKKKLNEEERSMFRQS
DLLSKLLSNWFFILMYDHLQNINAGGDLLILYLNILNIINNGPVNWETSK
SQYALNENSLLERKIEFKKLKLKVKHEFFENDSELVVEVLDCDCISQAKL
KIFEEIYKYSPYSNWSSFESYCLIKLNQDEVPESERLLAPIALKEVVGYT
LKTLKDYDIKDGDNICVAMKNESLPASNTASVSHLESNSASLKTNKSRNI
SKDIPMTSFLPDISKRIPIHRLSDSLHENSSQKSKIKCCYKTKISAFKDG
HHLKPACLIYTQVLKSKIEGQIKNLFDDIFDYESVPLCVSDLFTHFNNIC
KDDSIVFAVKSNSLVLRFWIQLINNIDFLFDVPLVKHTPVLECLKCVSRI
LMDICSENQNKDVWLTQLFSDVIKLYSPKVLNYYEGIKGTGSFNYNEYYG
SSRIDGINISLAIVILYQNYINSVHKELVEVIQISNYPKDKQNEWITILE
EVKNLYVAESFLNESNGEIIKTSIC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR031148Plexin
IPR031146Invert_Plexin-B
IPR001627Semap_dom
IPR002909IPT_dom
IPR016201PSI
IPR013548Plexin_cytoplasmic_RasGAP_dom
IPR013783Ig-like_fold
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR002165Plexin_repeat
IPR014756Ig_E-set
IPR008936Rho_GTPase_activation_prot
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0017154semaphorin receptor activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0071526semaphorin-plexin signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR016201PSI domainSMARTSM00423psinew7coord: 272..323
e-value: 0.76
score: 17.3
coord: 122..170
e-value: 0.0049
score: 26.1
IPR002909IPT domainSMARTSM00429iptmega2coord: 324..421
e-value: 0.079
score: 22.1
coord: 422..523
e-value: 1.4
score: 13.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 2..124
e-value: 1.3E-7
score: 33.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 423..525
e-value: 8.7E-8
score: 34.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 287..422
e-value: 1.2E-11
score: 46.8
IPR013548Plexin, cytoplasmic RasGAP domainPFAMPF08337Plexin_cytoplcoord: 804..1343
e-value: 1.0E-64
score: 219.2
IPR031148Plexin familyPANTHERPTHR22625PLEXINcoord: 705..1333
IPR031148Plexin familyPANTHERPTHR22625PLEXINcoord: 75..591
IPR031146Invertebrate plexin-BPANTHERPTHR22625:SF58PLEXIN-Bcoord: 75..591
IPR031146Invertebrate plexin-BPANTHERPTHR22625:SF58PLEXIN-Bcoord: 705..1333
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 874..1379
IPR014756Immunoglobulin E-setSUPERFAMILYSSF81296E set domainscoord: 420..484
NoneNo IPR availableTMHMMTMhelixcoord: 730..752
NoneNo IPR availableTMHMMTMhelixcoord: 666..688