Dynein light chain roadblock

Overview
NameDynein light chain roadblock
Smed IDSMED30014345
Uniprot Best hitDynein light chain roadblock-type 2 OS=Mus musculus OX=10090 GN=Dynlrb2 PE=1 SV=1 (E=4.03329e-41)
Length (bp)448
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein light chain roadblock (SMED30014345) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein light chain roadblock (SMED30014345) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein light chain roadblock (SMED30014345) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein light chain roadblock (SMED30014345) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014345

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014345 SmedASXL_019654SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30014345 dd_Smed_v4_5440_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30014345 dd_Smed_v6_5440_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30014345 dd_Smed_v4_5440_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014345 dd_Smed_v4_5440_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30014345 dd_Smed_v4_5440_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein light chain roadblock vs. Ensembl Human
Match: DYNLRB2 (dynein light chain roadblock-type 2 [Source:HGNC Symbol;Acc:HGNC:15467])

HSP 1 Score: 132.109 bits (331), Expect = 2.412e-40
Identity = 60/92 (65.22%), Postives = 77/92 (83.70%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M ++EET++RIQ+HKGVIG ++VN EGIPIRT LDNS+T Q+   +  L +KA S VRDIDP N+LTF RIRSKK+EIMVAP+K+Y++IVIQ
Sbjct:    1 MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQ 92          
BLAST of Dynein light chain roadblock vs. Ensembl Human
Match: DYNLRB2 (dynein light chain roadblock-type 2 [Source:HGNC Symbol;Acc:HGNC:15467])

HSP 1 Score: 129.798 bits (325), Expect = 4.546e-39
Identity = 59/90 (65.56%), Postives = 76/90 (84.44%), Query Frame = 3
Query:   72 DIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            ++EET++RIQ+HKGVIG ++VN EGIPIRT LDNS+T Q+   +  L +KA S VRDIDP N+LTF RIRSKK+EIMVAP+K+Y++IVIQ
Sbjct:   32 EVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQ 121          
BLAST of Dynein light chain roadblock vs. Ensembl Human
Match: DYNLRB1 (dynein light chain roadblock-type 1 [Source:HGNC Symbol;Acc:HGNC:15468])

HSP 1 Score: 125.176 bits (313), Expect = 1.413e-37
Identity = 55/92 (59.78%), Postives = 73/92 (79.35%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M ++EET++R+Q+ KGV G+I+VN EGIPI++ +DN +T Q+   +    +KA S VRDIDP N+LTF RIRSKKNEIMVAP+KDY +IVIQ
Sbjct:    1 MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQ 92          
BLAST of Dynein light chain roadblock vs. Ensembl Human
Match: DYNLRB1 (dynein light chain roadblock-type 1 [Source:HGNC Symbol;Acc:HGNC:15468])

HSP 1 Score: 121.709 bits (304), Expect = 1.198e-35
Identity = 54/90 (60.00%), Postives = 72/90 (80.00%), Query Frame = 3
Query:   72 DIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            ++EET++R+Q+ KGV G+I+VN EGIPI++ +DN +T Q+   +    +KA S VRDIDP N+LTF RIRSKKNEIMVAP+KDY +IVIQ
Sbjct:   55 EVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQ 144          
BLAST of Dynein light chain roadblock vs. Ensembl Human
Match: DYNLRB2 (dynein light chain roadblock-type 2 [Source:HGNC Symbol;Acc:HGNC:15467])

HSP 1 Score: 45.8246 bits (107), Expect = 3.842e-7
Identity = 22/46 (47.83%), Postives = 32/46 (69.57%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCI 203
            M ++EET++RIQ+HKGVIG ++VN EG   +TN  + S N   D +
Sbjct:    1 MAEVEETLKRIQSHKGVIGTMVVNAEG--KKTNTMSQSKNFRADSL 44          
BLAST of Dynein light chain roadblock vs. Ensembl Celegans
Match: dyrb-1 (Dynein light chain roadblock [Source:UniProtKB/TrEMBL;Acc:Q22752])

HSP 1 Score: 105.916 bits (263), Expect = 1.621e-30
Identity = 44/95 (46.32%), Postives = 76/95 (80.00%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQELA 350
            M+D EETI+R+Q+ KGV+G+I+V++ G  I + +D+ +T  H   ++QL  K  +++R++D SN+LTF R+R+KKNEIM+AP+KD++++VI++L+
Sbjct:    1 MSDFEETIRRLQSEKGVVGIIVVDSAGRVIHSTIDSDATQSHTAFLQQLCEKTKTSIRELDSSNDLTFLRLRTKKNEIMIAPDKDHVIMVIKDLS 95          
BLAST of Dynein light chain roadblock vs. Ensembl Fly
Match: robl (gene:FBgn0024196 transcript:FBtr0086920)

HSP 1 Score: 129.798 bits (325), Expect = 1.060e-39
Identity = 56/90 (62.22%), Postives = 79/90 (87.78%), Query Frame = 3
Query:   72 DIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            ++EET++RIQ+HKGV+G I+VNNEGIP+++ LDN++T Q+   + QLA KA S VRD+DPSN++TF R+RSKK+EIMVAP+KD+++IVIQ
Sbjct:    4 EVEETLKRIQSHKGVVGTIVVNNEGIPVKSTLDNTTTVQYAGLMSQLADKARSVVRDLDPSNDMTFLRVRSKKHEIMVAPDKDFILIVIQ 93          
BLAST of Dynein light chain roadblock vs. Ensembl Fly
Match: robl22E (gene:FBgn0028570 transcript:FBtr0331451)

HSP 1 Score: 90.1225 bits (222), Expect = 3.578e-24
Identity = 37/90 (41.11%), Postives = 65/90 (72.22%), Query Frame = 3
Query:   72 DIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            ++EE ++R Q+ K V G+++V+N+GIPI+T LD + T  +   ++ +  KA   V D+D +NE TF R+R+++NE+M+ P++DY ++VIQ
Sbjct:    4 EVEELLKRFQSMKNVTGIVVVDNDGIPIKTTLDYTLTLHYAALMQTVREKARQVVLDLDATNEFTFLRLRTEQNEVMLCPQEDYFIMVIQ 93          
BLAST of Dynein light chain roadblock vs. Ensembl Fly
Match: robl22E (gene:FBgn0028570 transcript:FBtr0077800)

HSP 1 Score: 90.1225 bits (222), Expect = 3.578e-24
Identity = 37/90 (41.11%), Postives = 65/90 (72.22%), Query Frame = 3
Query:   72 DIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            ++EE ++R Q+ K V G+++V+N+GIPI+T LD + T  +   ++ +  KA   V D+D +NE TF R+R+++NE+M+ P++DY ++VIQ
Sbjct:    4 EVEELLKRFQSMKNVTGIVVVDNDGIPIKTTLDYTLTLHYAALMQTVREKARQVVLDLDATNEFTFLRLRTEQNEVMLCPQEDYFIMVIQ 93          
BLAST of Dynein light chain roadblock vs. Ensembl Fly
Match: CG10834 (gene:FBgn0032972 transcript:FBtr0085943)

HSP 1 Score: 70.4774 bits (171), Expect = 1.755e-16
Identity = 32/90 (35.56%), Postives = 59/90 (65.56%), Query Frame = 3
Query:   72 DIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            +IE+ ++R Q +  V G+II++   IPI+T ++ + T  +   I  L  KA+  + ++D SNEL   R+R+K +E++V P ++Y++IV+Q
Sbjct:    4 EIEDLLKRYQNYPNVSGIIILDPFAIPIKTTMEYTLTVHYAALISTLTYKAAKMITNLDASNELVTIRLRTKVHEVIVLPSENYIIIVVQ 93          
BLAST of Dynein light chain roadblock vs. Ensembl Fly
Match: robl37BC (gene:FBgn0028569 transcript:FBtr0081139)

HSP 1 Score: 70.4774 bits (171), Expect = 2.854e-16
Identity = 32/90 (35.56%), Postives = 58/90 (64.44%), Query Frame = 3
Query:   75 IEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQE 344
            ++ T  R+    GV G I+++  G+P+RTNL  +    + D +R L I A S V+D++  +EL++ R+R+++ E MVA E ++ +I+IQ+
Sbjct:    6 VQMTFDRLVQLPGVTGAILIDGNGVPVRTNLPANVARIYADRMRPLVILARSMVQDLENGDELSYVRLRTRRQETMVATENEHTIILIQD 95          
BLAST of Dynein light chain roadblock vs. Ensembl Zebrafish
Match: dynlrb2 (dynein light chain roadblock-type 2 [Source:ZFIN;Acc:ZDB-GENE-120709-101])

HSP 1 Score: 130.954 bits (328), Expect = 6.633e-40
Identity = 60/92 (65.22%), Postives = 76/92 (82.61%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M ++E+T++RIQA  GVIG I+VN EGIPIRT LDNS++ Q+   + QL +KA SAVRDIDP NELTF RIRSKK+EIMVAP+K+Y++I IQ
Sbjct:   17 MAEVEDTLKRIQAQHGVIGTIVVNGEGIPIRTTLDNSTSVQYAGLLHQLTMKARSAVRDIDPQNELTFLRIRSKKHEIMVAPDKEYLLIAIQ 108          
BLAST of Dynein light chain roadblock vs. Ensembl Zebrafish
Match: CR788324.3 (pep chromosome:GRCz11:CHR_ALT_CTG25_1_17:21894675:21903448:1 gene:ENSDARG00000113449.1 transcript:ENSDART00000188897.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR788324.3)

HSP 1 Score: 129.798 bits (325), Expect = 1.186e-39
Identity = 60/92 (65.22%), Postives = 76/92 (82.61%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M ++E+T++RIQA  GVIG I+VN EGIPIRT LDNS++ Q+   + QL +KA SAVRDIDP NELTF RIRSKK+EIMVAP+K+Y++I IQ
Sbjct:    1 MNNVEDTLKRIQAQHGVIGTIVVNGEGIPIRTTLDNSTSVQYAGLLHQLTMKARSAVRDIDPQNELTFLRIRSKKHEIMVAPDKEYLLIAIQ 92          
BLAST of Dynein light chain roadblock vs. Ensembl Zebrafish
Match: dynlrb1 (dynein, light chain, roadblock-type 1 [Source:ZFIN;Acc:ZDB-GENE-040426-989])

HSP 1 Score: 127.102 bits (318), Expect = 1.357e-38
Identity = 60/92 (65.22%), Postives = 75/92 (81.52%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M ++EETI+RIQ+ KGV G+IIVN EGIPI++ LDN+ST Q+   I QL +KA   VRDIDP N+LTF R+RSKKNEIM+AP+KDY +IVIQ
Sbjct:    1 MAEVEETIKRIQSQKGVQGIIIVNAEGIPIKSTLDNTSTVQYAANIHQLLMKARGIVRDIDPQNDLTFLRVRSKKNEIMIAPDKDYFLIVIQ 92          
BLAST of Dynein light chain roadblock vs. Ensembl Zebrafish
Match: CR788324.3 (pep chromosome:GRCz11:CHR_ALT_CTG25_1_17:21894675:21900573:1 gene:ENSDARG00000113449.1 transcript:ENSDART00000184632.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR788324.3)

HSP 1 Score: 117.857 bits (294), Expect = 6.198e-35
Identity = 55/82 (67.07%), Postives = 67/82 (81.71%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAP 311
            M ++E+T++RIQA  GVIG I+VN EGIPIRT LDNS++ Q+   + QL +KA SAVRDIDP NELTF RIRSKK+EIMVAP
Sbjct:    1 MNNVEDTLKRIQAQHGVIGTIVVNGEGIPIRTTLDNSTSVQYAGLLHQLTMKARSAVRDIDPQNELTFLRIRSKKHEIMVAP 82          
BLAST of Dynein light chain roadblock vs. Ensembl Zebrafish
Match: dynlrb1 (dynein, light chain, roadblock-type 1 [Source:ZFIN;Acc:ZDB-GENE-040426-989])

HSP 1 Score: 68.5514 bits (166), Expect = 4.290e-16
Identity = 30/42 (71.43%), Postives = 36/42 (85.71%), Query Frame = 3
Query:  216 IKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            +KA   VRDIDP N+LTF R+RSKKNEIM+AP+KDY +IVIQ
Sbjct:    1 MKARGIVRDIDPQNDLTFLRVRSKKNEIMIAPDKDYFLIVIQ 42          
BLAST of Dynein light chain roadblock vs. Ensembl Xenopus
Match: akap6 (A-kinase anchoring protein 6 [Source:Xenbase;Acc:XB-GENE-982363])

HSP 1 Score: 132.88 bits (333), Expect = 1.494e-40
Identity = 61/90 (67.78%), Postives = 78/90 (86.67%), Query Frame = 3
Query:   72 DIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            ++EET++RIQ+HKGVIG I+VN EGIPIRT LDNS+T Q+   + QL++KA S VRDIDP N+LTF RIRSKK+EIMVAP+K+Y++IVIQ
Sbjct:   14 EVEETLKRIQSHKGVIGTIVVNAEGIPIRTTLDNSTTVQYAGLLHQLSMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQ 103          
BLAST of Dynein light chain roadblock vs. Ensembl Xenopus
Match: tmc2 (transmembrane channel like 2 [Source:Xenbase;Acc:XB-GENE-6050839])

HSP 1 Score: 124.79 bits (312), Expect = 1.665e-37
Identity = 57/93 (61.29%), Postives = 75/93 (80.65%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQE 344
            M D+EET++RIQ  KGV G+IIVN+EGIPI++ +DN +T Q+   + QL +KA  +VRDID  N+LTF RIRSKKNEIM+AP+KDY +IVIQ+
Sbjct:    1 MADVEETLKRIQGQKGVQGIIIVNSEGIPIKSTMDNQTTVQYASLMHQLVMKARGSVRDIDCQNDLTFLRIRSKKNEIMIAPDKDYFLIVIQQ 93          
BLAST of Dynein light chain roadblock vs. Ensembl Xenopus
Match: akap6 (A-kinase anchoring protein 6 [Source:Xenbase;Acc:XB-GENE-982363])

HSP 1 Score: 123.25 bits (308), Expect = 6.035e-37
Identity = 57/82 (69.51%), Postives = 70/82 (85.37%), Query Frame = 3
Query:   96 IQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            IQ+HKGVIG I+VN EGIPIRT LDNS+T Q+   + QL++KA S VRDIDP N+LTF RIRSKK+EIMVAP+K+Y++IVIQ
Sbjct:    2 IQSHKGVIGTIVVNAEGIPIRTTLDNSTTVQYAGLLHQLSMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQ 83          
BLAST of Dynein light chain roadblock vs. Ensembl Mouse
Match: Dynlrb2 (dynein light chain roadblock-type 2 [Source:MGI Symbol;Acc:MGI:1922715])

HSP 1 Score: 135.961 bits (341), Expect = 5.766e-42
Identity = 62/92 (67.39%), Postives = 79/92 (85.87%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            MT++EET++RIQ+HKGVIG ++VN EGIPIRT LDNS+T Q+   + QL +KA S VRDIDP N+LTF RIRSKK+EIMVAP+K+Y++IVIQ
Sbjct:    1 MTEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQ 92          
BLAST of Dynein light chain roadblock vs. Ensembl Mouse
Match: Dynlrb2 (dynein light chain roadblock-type 2 [Source:MGI Symbol;Acc:MGI:1922715])

HSP 1 Score: 125.176 bits (313), Expect = 7.339e-38
Identity = 57/83 (68.67%), Postives = 70/83 (84.34%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPE 314
            MT++EET++RIQ+HKGVIG ++VN EGIPIRT LDNS+T Q+   + QL +KA S VRDIDP N+LTF RIRSKK+EIMVAPE
Sbjct:    1 MTEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPE 83          
BLAST of Dynein light chain roadblock vs. Ensembl Mouse
Match: Dynlrb1 (dynein light chain roadblock-type 1 [Source:MGI Symbol;Acc:MGI:1914318])

HSP 1 Score: 123.25 bits (308), Expect = 5.277e-37
Identity = 54/92 (58.70%), Postives = 74/92 (80.43%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M ++EET++R+Q+ KGV G+I+VN EGIPI++ +DN +T Q+ + +    +KA S VR+IDP N+LTF RIRSKKNEIMVAP+KDY +IVIQ
Sbjct:    1 MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQ 92          
BLAST of Dynein light chain roadblock vs. Ensembl Mouse
Match: Dynlrb1 (dynein light chain roadblock-type 1 [Source:MGI Symbol;Acc:MGI:1914318])

HSP 1 Score: 121.709 bits (304), Expect = 2.322e-36
Identity = 54/96 (56.25%), Postives = 74/96 (77.08%), Query Frame = 3
Query:   54 PERQMTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            P     ++EET++R+Q+ KGV G+I+VN EGIPI++ +DN +T Q+ + +    +KA S VR+IDP N+LTF RIRSKKNEIMVAP+KDY +IVIQ
Sbjct:    5 PPLWEAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQ 100          
BLAST of Dynein light chain roadblock vs. UniProt
Match: sp|Q9DAJ5|DLRB2_MOUSE (Dynein light chain roadblock-type 2 OS=Mus musculus OX=10090 GN=Dynlrb2 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 4.033e-41
Identity = 62/92 (67.39%), Postives = 79/92 (85.87%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            MT++EET++RIQ+HKGVIG ++VN EGIPIRT LDNS+T Q+   + QL +KA S VRDIDP N+LTF RIRSKK+EIMVAP+K+Y++IVIQ
Sbjct:    1 MTEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQ 92          
BLAST of Dynein light chain roadblock vs. UniProt
Match: sp|Q32P85|DLRB2_BOVIN (Dynein light chain roadblock-type 2 OS=Bos taurus OX=9913 GN=DYNLRB2 PE=3 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 2.197e-40
Identity = 61/92 (66.30%), Postives = 78/92 (84.78%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M ++EET++RIQ+HKGVIG ++VN EGIPIRT LDNS+T Q+   + QL +KA S VRDIDP N+LTF RIRSKK+EIMVAP+K+Y++IVIQ
Sbjct:    1 MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQ 92          
BLAST of Dynein light chain roadblock vs. UniProt
Match: sp|Q8TF09|DLRB2_HUMAN (Dynein light chain roadblock-type 2 OS=Homo sapiens OX=9606 GN=DYNLRB2 PE=1 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.158e-39
Identity = 60/92 (65.22%), Postives = 77/92 (83.70%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M ++EET++RIQ+HKGVIG ++VN EGIPIRT LDNS+T Q+   +  L +KA S VRDIDP N+LTF RIRSKK+EIMVAP+K+Y++IVIQ
Sbjct:    1 MAEVEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQ 92          
BLAST of Dynein light chain roadblock vs. UniProt
Match: sp|Q9NP97|DLRB1_HUMAN (Dynein light chain roadblock-type 1 OS=Homo sapiens OX=9606 GN=DYNLRB1 PE=1 SV=3)

HSP 1 Score: 125.176 bits (313), Expect = 6.786e-37
Identity = 55/92 (59.78%), Postives = 73/92 (79.35%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M ++EET++R+Q+ KGV G+I+VN EGIPI++ +DN +T Q+   +    +KA S VRDIDP N+LTF RIRSKKNEIMVAP+KDY +IVIQ
Sbjct:    1 MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQ 92          
BLAST of Dynein light chain roadblock vs. UniProt
Match: sp|P62628|DLRB1_RAT (Dynein light chain roadblock-type 1 OS=Rattus norvegicus OX=10116 GN=Dynlrb1 PE=1 SV=3)

HSP 1 Score: 123.25 bits (308), Expect = 3.691e-36
Identity = 54/92 (58.70%), Postives = 74/92 (80.43%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M ++EET++R+Q+ KGV G+I+VN EGIPI++ +DN +T Q+ + +    +KA S VR+IDP N+LTF RIRSKKNEIMVAP+KDY +IVIQ
Sbjct:    1 MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQ 92          
BLAST of Dynein light chain roadblock vs. TrEMBL
Match: gnl|BL_ORD_ID|175983057 (tr|A0A402ENZ2|A0A402ENZ2_9SAUR Robl_LC7 domain-containing protein OS=Paroedura picta OX=143630 GN=parPi_0005545 PE=4 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 4.305e-40
Identity = 65/96 (67.71%), Postives = 81/96 (84.38%), Query Frame = 3
Query:   54 PERQMTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            P R+M ++EET++RIQAHKGVIG I+VN EGIPIRT LDNS+T Q+   + QL +KA S VRDIDP N+LTF RIRSKK+EIMVAP+K+Y++IVIQ
Sbjct:   38 PGREMAEVEETLKRIQAHKGVIGTIVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKAKSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQ 133          
BLAST of Dynein light chain roadblock vs. TrEMBL
Match: gnl|BL_ORD_ID|17540982 (tr|A7SMZ7|A7SMZ7_NEMVE Dynein light chain roadblock OS=Nematostella vectensis OX=45351 GN=v1g237378 PE=3 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 6.372e-40
Identity = 64/92 (69.57%), Postives = 80/92 (86.96%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M+++EET++RIQ HKGVIG+IIVN+EGIPIRT LDNS+T Q+   I QL IKA S VRDIDP N+LTF RIRSKK+EIMVAP+K+Y+++VIQ
Sbjct:    1 MSEVEETLKRIQGHKGVIGVIIVNSEGIPIRTTLDNSTTVQYTGLIHQLTIKARSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLVVIQ 92          
BLAST of Dynein light chain roadblock vs. TrEMBL
Match: gnl|BL_ORD_ID|174141914 (tr|A0A5N5NF01|A0A5N5NF01_PANHP Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00243450 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.297e-39
Identity = 63/92 (68.48%), Postives = 79/92 (85.87%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M ++EET++RIQAHKGVIG I+VN EGIPIRT LDNS+T Q+   + QLA+KA S VRDIDP N+LTF R+RSKK+EIMVAP+K+Y++IVIQ
Sbjct:    1 MAEVEETLKRIQAHKGVIGTIVVNAEGIPIRTTLDNSTTVQYAGLLHQLAMKARSTVRDIDPQNDLTFLRVRSKKHEIMVAPDKEYLLIVIQ 92          
BLAST of Dynein light chain roadblock vs. TrEMBL
Match: gnl|BL_ORD_ID|175458450 (tr|A0A1L8GEX4|A0A1L8GEX4_XENLA Dynein light chain roadblock OS=Xenopus laevis OX=8355 GN=XELAEV_18024816mg PE=3 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 1.401e-39
Identity = 63/92 (68.48%), Postives = 79/92 (85.87%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M ++EET++RIQ+HKGVIG I+VN EGIPIRT LDNS+T Q+   + QL++KA S VRDIDP NELTF RIRSKK+EIMVAP+K+Y++IVIQ
Sbjct:    1 MAEVEETLKRIQSHKGVIGTIVVNAEGIPIRTTLDNSTTVQYAGLLHQLSMKAKSTVRDIDPQNELTFLRIRSKKHEIMVAPDKEYLLIVIQ 92          
BLAST of Dynein light chain roadblock vs. TrEMBL
Match: gnl|BL_ORD_ID|18854958 (tr|H2XQ56|H2XQ56_CIOIN Dynein light chain roadblock OS=Ciona intestinalis OX=7719 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.669e-39
Identity = 62/92 (67.39%), Postives = 82/92 (89.13%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M+++EETI+RIQ+HKGV+G+I+VN+EGIPIRT+LDNS+T Q+   I QL +KA S VRDIDP N+LTF R+RSKK+EIMVAP+K+Y++IVIQ
Sbjct:    1 MSEVEETIKRIQSHKGVLGIIVVNSEGIPIRTSLDNSTTVQYAGLIHQLTMKARSTVRDIDPQNDLTFLRLRSKKHEIMVAPDKEYLLIVIQ 92          
BLAST of Dynein light chain roadblock vs. Ensembl Cavefish
Match: dynlrb2 (dynein light chain roadblock-type 2 [Source:NCBI gene;Acc:103025073])

HSP 1 Score: 134.42 bits (337), Expect = 6.542e-41
Identity = 61/92 (66.30%), Postives = 77/92 (83.70%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M ++E+T++RIQ HKGVIG I+VN EGIPIRT LDNS+T Q+   + QL +KA S VRDIDP N+LTF RIRSKK+EIMVAP+K+Y++IVIQ
Sbjct:   50 MAEVEDTLKRIQTHKGVIGTIVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKARSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQ 141          
BLAST of Dynein light chain roadblock vs. Ensembl Cavefish
Match: dynlrb2 (dynein light chain roadblock-type 2 [Source:NCBI gene;Acc:103025073])

HSP 1 Score: 122.094 bits (305), Expect = 1.067e-36
Identity = 57/82 (69.51%), Postives = 68/82 (82.93%), Query Frame = 3
Query:   96 IQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            IQ HKGVIG I+VN EGIPIRT LDNS+T Q+   + QL +KA S VRDIDP N+LTF RIRSKK+EIMVAP+K+Y++IVIQ
Sbjct:    3 IQTHKGVIGTIVVNAEGIPIRTTLDNSTTVQYAGLLHQLTMKARSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLIVIQ 84          
BLAST of Dynein light chain roadblock vs. Ensembl Cavefish
Match: ENSAMXT00000049115.1 (pep primary_assembly:Astyanax_mexicanus-2.0:22:15317328:15320932:-1 gene:ENSAMXG00000029379.1 transcript:ENSAMXT00000049115.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 96.2857 bits (238), Expect = 5.564e-24
Identity = 43/66 (65.15%), Postives = 54/66 (81.82%), Query Frame = 3
Query:  144 GIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            GIPI++ LDNSST Q+   + QL +KA S VRD+DP N+LTF R+RSKKNEIM+AP+KDY +IVIQ
Sbjct:  324 GIPIKSTLDNSSTVQYAGLLHQLMMKARSTVRDLDPQNDLTFLRVRSKKNEIMIAPDKDYFLIVIQ 389          
BLAST of Dynein light chain roadblock vs. Ensembl Nematostella
Match: EDO34906 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMZ7])

HSP 1 Score: 139.043 bits (349), Expect = 8.812e-44
Identity = 64/92 (69.57%), Postives = 80/92 (86.96%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M+++EET++RIQ HKGVIG+IIVN+EGIPIRT LDNS+T Q+   I QL IKA S VRDIDP N+LTF RIRSKK+EIMVAP+K+Y+++VIQ
Sbjct:    1 MSEVEETLKRIQGHKGVIGVIIVNSEGIPIRTTLDNSTTVQYTGLIHQLTIKARSTVRDIDPQNDLTFLRIRSKKHEIMVAPDKEYLLVVIQ 92          
BLAST of Dynein light chain roadblock vs. Ensembl Nematostella
Match: EDO28944 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZX7])

HSP 1 Score: 102.449 bits (254), Expect = 2.133e-29
Identity = 47/91 (51.65%), Postives = 69/91 (75.82%), Query Frame = 3
Query:   69 TDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            + +E  ++RIQ+HKGVIG I+VN+EG PIR++LDNS+T  +      LA  A S VRDIDP N+L+  R++S+K EI++AP ++YM+IV+Q
Sbjct:    3 SSVENILKRIQSHKGVIGSIVVNSEGTPIRSDLDNSTTLLYASNCHHLAKLARSTVRDIDPQNDLSILRVKSRKYEIIIAPYEEYMLIVVQ 93          
BLAST of Dynein light chain roadblock vs. Ensembl Nematostella
Match: EDO43024 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZX7])

HSP 1 Score: 102.449 bits (254), Expect = 2.133e-29
Identity = 47/91 (51.65%), Postives = 69/91 (75.82%), Query Frame = 3
Query:   69 TDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            + +E  ++RIQ+HKGVIG I+VN+EG PIR++LDNS+T  +      LA  A S VRDIDP N+L+  R++S+K EI++AP ++YM+IV+Q
Sbjct:    3 SSVENILKRIQSHKGVIGSIVVNSEGTPIRSDLDNSTTLLYASNCHHLAKLARSTVRDIDPQNDLSILRVKSRKYEIIIAPYEEYMLIVVQ 93          
BLAST of Dynein light chain roadblock vs. Ensembl Nematostella
Match: EDO45898 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRW8])

HSP 1 Score: 100.138 bits (248), Expect = 2.379e-28
Identity = 48/90 (53.33%), Postives = 65/90 (72.22%), Query Frame = 3
Query:   72 DIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            ++EE ++RI  H GV G II N EG+ IR+ +DNS+T  ++  I+ +   A SAVRD+DP N+L F RIRS+K EI+VAPE DY +IVIQ
Sbjct:    6 EVEEVLKRIINHPGVTGSIITNPEGVAIRSTMDNSTTQIYLSNIQSMTQMARSAVRDLDPLNDLKFLRIRSRKYEILVAPENDYTLIVIQ 95          
BLAST of Dynein light chain roadblock vs. Ensembl Nematostella
Match: EDO39602 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9M3])

HSP 1 Score: 98.2117 bits (243), Expect = 1.336e-27
Identity = 43/95 (45.26%), Postives = 68/95 (71.58%), Query Frame = 3
Query:   69 TDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQELAN 353
            +++E T+QRI  H GV+G +++NN+G PI++++D  +T  +      LA  A SAVRD+DP NEL F R+R+ K E MVAP+ +Y++IVIQ++ +
Sbjct:    4 SEVENTLQRISLHPGVMGWLVINNQGEPIKSSMDIPTTQLYASEFAPLAHFAHSAVRDMDPQNELRFIRVRTNKMEFMVAPDNEYLLIVIQKVTS 98          
BLAST of Dynein light chain roadblock vs. Ensembl Medaka
Match: dynlrb1 (dynein light chain roadblock-type 1 [Source:NCBI gene;Acc:101160277])

HSP 1 Score: 130.954 bits (328), Expect = 4.118e-40
Identity = 59/92 (64.13%), Postives = 77/92 (83.70%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQ 341
            M D+EET++RIQ+ KGV G+IIVN+EGIPI+T LDN+ST Q+   I+QL + A S VR++DP N+LTF R+RSKKNEIM+AP+KDY +IVIQ
Sbjct:    1 MADVEETLKRIQSQKGVQGVIIVNSEGIPIKTTLDNTSTVQYAGLIQQLVLMARSTVRELDPQNDLTFLRVRSKKNEIMIAPDKDYFLIVIQ 92          
BLAST of Dynein light chain roadblock vs. Ensembl Medaka
Match: dynlrb1 (dynein light chain roadblock-type 1 [Source:NCBI gene;Acc:101160277])

HSP 1 Score: 115.161 bits (287), Expect = 6.025e-34
Identity = 52/82 (63.41%), Postives = 68/82 (82.93%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAP 311
            M D+EET++RIQ+ KGV G+IIVN+EGIPI+T LDN+ST Q+   I+QL + A S VR++DP N+LTF R+RSKKNEIM+AP
Sbjct:    1 MADVEETLKRIQSQKGVQGVIIVNSEGIPIKTTLDNTSTVQYAGLIQQLVLMARSTVRELDPQNDLTFLRVRSKKNEIMIAP 82          
BLAST of Dynein light chain roadblock vs. Planmine SMEST
Match: SMESG000072361.1 (SMESG000072361.1)

HSP 1 Score: 130.568 bits (327), Expect = 3.901e-40
Identity = 62/93 (66.67%), Postives = 77/93 (82.80%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQE 344
            M+++EE I+RI +HKGVIG IIVN +GIPIRT LDN++T Q+   I QL  KA SAV+D+DP N+LTF RIRSKKNEIMVAP++DY+ IVIQE
Sbjct:    1 MSEVEEAIKRILSHKGVIGAIIVNTDGIPIRTTLDNATTVQYCALITQLNTKARSAVKDLDPGNDLTFLRIRSKKNEIMVAPDRDYIFIVIQE 93          
BLAST of Dynein light chain roadblock vs. Planmine SMEST
Match: SMESG000072361.1 (SMESG000072361.1)

HSP 1 Score: 130.183 bits (326), Expect = 6.785e-40
Identity = 62/97 (63.92%), Postives = 78/97 (80.41%), Query Frame = 3
Query:   54 PERQMTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQE 344
            P+   +++EE I+RI +HKGVIG IIVN +GIPIRT LDN++T Q+   I QL  KA SAV+D+DP N+LTF RIRSKKNEIMVAP++DY+ IVIQE
Sbjct:    6 PKEGKSEVEEAIKRILSHKGVIGAIIVNTDGIPIRTTLDNATTVQYCALITQLNTKARSAVKDLDPGNDLTFLRIRSKKNEIMVAPDRDYIFIVIQE 102          
BLAST of Dynein light chain roadblock vs. Planmine SMEST
Match: SMESG000011794.1 (SMESG000011794.1)

HSP 1 Score: 102.064 bits (253), Expect = 6.239e-29
Identity = 42/94 (44.68%), Postives = 71/94 (75.53%), Query Frame = 3
Query:   66 MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQEL 347
            M++++E + RIQ+HKG+IG++I+NN+G+PI++ L+++ T Q+      L  K   AV+++DP+N+LT  RIRS  NE+M+ PE D++ IVIQ++
Sbjct:    1 MSEVDEFMTRIQSHKGIIGIVILNNDGVPIKSTLEDNETIQYCSLFHHLIYKTKMAVQELDPTNDLTLMRIRSLNNEVMIVPEHDFIFIVIQKV 94          
BLAST of Dynein light chain roadblock vs. Planmine SMEST
Match: SMESG000061103.1 (SMESG000061103.1)

HSP 1 Score: 102.449 bits (254), Expect = 8.810e-29
Identity = 48/93 (51.61%), Postives = 67/93 (72.04%), Query Frame = 3
Query:   69 TDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQEL 347
            +++E  ++RI+ HK V+G +I+N + IP+RT LDNS+T Q       L  +A S VRDIDPSNELTF R+RS+KNEIMV+P   Y +IV+Q +
Sbjct:   14 SEVEMCLERIRTHKNVVGWLILNADYIPVRTCLDNSATQQLSGVFIPLVKRAQSVVRDIDPSNELTFLRVRSRKNEIMVSPYFGYTIIVVQNI 106          
BLAST of Dynein light chain roadblock vs. Planmine SMEST
Match: SMESG000011794.1 (SMESG000011794.1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.148e-26
Identity = 40/85 (47.06%), Postives = 64/85 (75.29%), Query Frame = 3
Query:   93 RIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLAIKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQEL 347
            RIQ+HKG+IG++I+NN+G+PI++ L+++ T Q+      L  K   AV+++DP+N+LT  RIRS  NE+M+ PE D++ IVIQ++
Sbjct:    3 RIQSHKGIIGIVILNNDGVPIKSTLEDNETIQYCSLFHHLIYKTKMAVQELDPTNDLTLMRIRSLNNEVMIVPEHDFIFIVIQKV 87          
The following BLAST results are available for this feature:
BLAST of Dynein light chain roadblock vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DYNLRB22.412e-4065.22dynein light chain roadblock-type 2 [Source:HGNC S... [more]
DYNLRB24.546e-3965.56dynein light chain roadblock-type 2 [Source:HGNC S... [more]
DYNLRB11.413e-3759.78dynein light chain roadblock-type 1 [Source:HGNC S... [more]
DYNLRB11.198e-3560.00dynein light chain roadblock-type 1 [Source:HGNC S... [more]
DYNLRB23.842e-747.83dynein light chain roadblock-type 2 [Source:HGNC S... [more]
back to top
BLAST of Dynein light chain roadblock vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dyrb-11.621e-3046.32Dynein light chain roadblock [Source:UniProtKB/Tr... [more]
back to top
BLAST of Dynein light chain roadblock vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
robl1.060e-3962.22gene:FBgn0024196 transcript:FBtr0086920[more]
robl22E3.578e-2441.11gene:FBgn0028570 transcript:FBtr0331451[more]
robl22E3.578e-2441.11gene:FBgn0028570 transcript:FBtr0077800[more]
CG108341.755e-1635.56gene:FBgn0032972 transcript:FBtr0085943[more]
robl37BC2.854e-1635.56gene:FBgn0028569 transcript:FBtr0081139[more]
back to top
BLAST of Dynein light chain roadblock vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dynlrb26.633e-4065.22dynein light chain roadblock-type 2 [Source:ZFIN;A... [more]
CR788324.31.186e-3965.22pep chromosome:GRCz11:CHR_ALT_CTG25_1_17:21894675:... [more]
dynlrb11.357e-3865.22dynein, light chain, roadblock-type 1 [Source:ZFIN... [more]
CR788324.36.198e-3567.07pep chromosome:GRCz11:CHR_ALT_CTG25_1_17:21894675:... [more]
dynlrb14.290e-1671.43dynein, light chain, roadblock-type 1 [Source:ZFIN... [more]
back to top
BLAST of Dynein light chain roadblock vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
akap61.494e-4067.78A-kinase anchoring protein 6 [Source:Xenbase;Acc:X... [more]
tmc21.665e-3761.29transmembrane channel like 2 [Source:Xenbase;Acc:X... [more]
akap66.035e-3769.51A-kinase anchoring protein 6 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Dynein light chain roadblock vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Dynlrb25.766e-4267.39dynein light chain roadblock-type 2 [Source:MGI Sy... [more]
Dynlrb27.339e-3868.67dynein light chain roadblock-type 2 [Source:MGI Sy... [more]
Dynlrb15.277e-3758.70dynein light chain roadblock-type 1 [Source:MGI Sy... [more]
Dynlrb12.322e-3656.25dynein light chain roadblock-type 1 [Source:MGI Sy... [more]
back to top
BLAST of Dynein light chain roadblock vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DAJ5|DLRB2_MOUSE4.033e-4167.39Dynein light chain roadblock-type 2 OS=Mus musculu... [more]
sp|Q32P85|DLRB2_BOVIN2.197e-4066.30Dynein light chain roadblock-type 2 OS=Bos taurus ... [more]
sp|Q8TF09|DLRB2_HUMAN1.158e-3965.22Dynein light chain roadblock-type 2 OS=Homo sapien... [more]
sp|Q9NP97|DLRB1_HUMAN6.786e-3759.78Dynein light chain roadblock-type 1 OS=Homo sapien... [more]
sp|P62628|DLRB1_RAT3.691e-3658.70Dynein light chain roadblock-type 1 OS=Rattus norv... [more]
back to top
BLAST of Dynein light chain roadblock vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|1759830574.305e-4067.71tr|A0A402ENZ2|A0A402ENZ2_9SAUR Robl_LC7 domain-con... [more]
gnl|BL_ORD_ID|175409826.372e-4069.57tr|A7SMZ7|A7SMZ7_NEMVE Dynein light chain roadbloc... [more]
gnl|BL_ORD_ID|1741419141.297e-3968.48tr|A0A5N5NF01|A0A5N5NF01_PANHP Uncharacterized pro... [more]
gnl|BL_ORD_ID|1754584501.401e-3968.48tr|A0A1L8GEX4|A0A1L8GEX4_XENLA Dynein light chain ... [more]
gnl|BL_ORD_ID|188549581.669e-3967.39tr|H2XQ56|H2XQ56_CIOIN Dynein light chain roadbloc... [more]
back to top
BLAST of Dynein light chain roadblock vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dynlrb26.542e-4166.30dynein light chain roadblock-type 2 [Source:NCBI g... [more]
dynlrb21.067e-3669.51dynein light chain roadblock-type 2 [Source:NCBI g... [more]
ENSAMXT00000049115.15.564e-2465.15pep primary_assembly:Astyanax_mexicanus-2.0:22:153... [more]
back to top
BLAST of Dynein light chain roadblock vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain roadblock vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dynein light chain roadblock vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO349068.812e-4469.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289442.133e-2951.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430242.133e-2951.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458982.379e-2853.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396021.336e-2745.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein light chain roadblock vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dynlrb14.118e-4064.13dynein light chain roadblock-type 1 [Source:NCBI g... [more]
dynlrb16.025e-3463.41dynein light chain roadblock-type 1 [Source:NCBI g... [more]
back to top
BLAST of Dynein light chain roadblock vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000072361.13.901e-4066.67SMESG000072361.1[more]
SMESG000072361.16.785e-4063.92SMESG000072361.1[more]
SMESG000011794.16.239e-2944.68SMESG000011794.1[more]
SMESG000061103.18.810e-2951.61SMESG000061103.1[more]
SMESG000011794.11.148e-2647.06SMESG000011794.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014345 ID=SMED30014345|Name=Dynein light chain roadblock|organism=Schmidtea mediterranea sexual|type=transcript|length=448bp
TGACTAATTTGATATATTTGTTTTATTAAATTATCTTCATAGTTACAACA
AACCCAGAAAGACAAATGACAGACATTGAAGAAACGATACAAAGAATCCA
AGCTCATAAAGGAGTTATTGGATTGATAATCGTGAACAATGAAGGTATTC
CAATAAGAACCAATCTAGATAATTCCTCAACGAATCAACACATTGATTGT
ATCAGACAGTTGGCAATAAAAGCTAGCAGTGCTGTTCGTGATATCGATCC
TTCTAATGAGTTGACATTTTGCAGAATTCGCAGCAAAAAGAATGAAATTA
TGGTGGCACCTGAAAAAGATTACATGGTCATCGTCATTCAGGAATTGGCT
AATACTAATGATTATGAAGCATTATAAATTTTTAAAGAACAAAAGAAAAA
TAAATAATTCAGAGTTTCACCTCGTATTGTTCGTATTACAATTTCAAG
back to top

protein sequence of SMED30014345-orf-1

>SMED30014345-orf-1 ID=SMED30014345-orf-1|Name=SMED30014345-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=104bp
MTDIEETIQRIQAHKGVIGLIIVNNEGIPIRTNLDNSSTNQHIDCIRQLA
IKASSAVRDIDPSNELTFCRIRSKKNEIMVAPEKDYMVIVIQELANTNDY
EAL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR004942Roadblock/LAMTOR2_dom
IPR016561DYNLRB1/2
Vocabulary: cellular component
TermDefinition
GO:0005868cytoplasmic dynein complex
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005874microtubule
GO:0030286dynein complex
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0007018microtubule-based movement
GO:0006810transport
Vocabulary: molecular function
TermDefinition
GO:0003774motor activity
GO:0005515protein binding
GO:0045505dynein intermediate chain binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004942Roadblock/LAMTOR2 domainSMARTSM00960Robl_LC7_a_2coord: 4..92
e-value: 4.7E-14
score: 62.7
IPR004942Roadblock/LAMTOR2 domainPFAMPF03259Robl_LC7coord: 4..92
e-value: 2.0E-22
score: 78.7
NoneNo IPR availableGENE3DG3DSA:3.30.450.30coord: 1..95
e-value: 5.4E-38
score: 131.1
NoneNo IPR availablePANTHERPTHR10779:SF17DYNEIN LIGHT CHAIN ROADBLOCK-TYPE 1coord: 1..93
NoneNo IPR availablePANTHERPTHR10779DYNEIN LIGHT CHAIN ROADBLOCKcoord: 1..93
NoneNo IPR availableSUPERFAMILYSSF103196Roadblock/LC7 domaincoord: 3..94
IPR016561Dynein light chain roadblock-type 1/2PIRSFPIRSF009998DLC7coord: 1..96
e-value: 5.9E-38
score: 126.7