Vacuolar protein sorting-associated protein 52-like protein

Overview
NameVacuolar protein sorting-associated protein 52-like protein
Smed IDSMED30014331
Length (bp)2443
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Vacuolar protein sorting-associated protein 52-like protein (SMED30014331) t-SNE clustered cells

Violin plots show distribution of expression levels for Vacuolar protein sorting-associated protein 52-like protein (SMED30014331) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Vacuolar protein sorting-associated protein 52-like protein (SMED30014331) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Vacuolar protein sorting-associated protein 52-like protein (SMED30014331) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014331

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014331h1SMcG0004610 dd_Smed_v4_8633_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30014331h1SMcG0004610 dd_Smed_v4_8633_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Human
Match: VPS52 (VPS52 subunit of GARP complex [Source:HGNC Symbol;Acc:HGNC:10518])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 315/742 (42.45%), Postives = 475/742 (64.02%), Query Frame = 2
Query:  143 FDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
                DI SD+ +++EV  HIQANL+DE+V+EALK+GVDLR YS+ V+ EL  +E +SI DY++  + +  LH QIT+ DA+L+RME++L  F  DL SIS++I++LQ +S  M+  L+NRQ VRG+L + +  +VVP  ++  IL+ PVTE  FLEQL ELD K   V+EQ  + + +  DV  +L++L++KA+ KIRE++LQKIY+FRKPMTN+Q+PQ  +LKYRFF +FLL N+RA A EI  EYV+T SKI+ SY+++Y+ +L K+Q+++ A+K+D +G ED        +     F + S    L++++T+F+L  R S++    LEAPI++PHT    ++         ++ +E LFRSQHYALLD  CREYLF+C+FF++S  A  D F+ VMG+TL++  K +++ +A C+DAI + +CI IVL ++++  +R V ALD YW  +L LLWPR+  +++ +V SVR     R        +D RP+ +TR+YAEF +AL                 S+N        IP           + +    L ++QVE+E  ++R+     +RKE+L+F INN D++L VL E    D  E   F+ L+  +  EF+EE+L P FG L+ F+KE E+   +  ++E    EEA+V ++I+GF   WK+S+E ++ +++ SF+NF  GT I Q  L+QLIQ Y R    ++    + +P + ELINIHH+MVE+KK KPNF
Sbjct:   42 LGELDITSDEFILDEVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLVVPSALVTAILEAPVTEPRFLEQLQELDAKAAAVREQEARGTAACADVRGVLDRLRVKAVTKIREFILQKIYSFRKPMTNYQIPQTALLKYRFFYQFLLGNERATAKEIRDEYVETLSKIYLSYYRSYLGRLMKVQYEEVAEKDDLMGVED--------TAKKGFFSKPS----LRSRNTIFTLGTRGSVISPTELEAPILVPHTAQRGEQ---------RYPFEALFRSQHYALLDNSCREYLFICEFFVVSGPAAHDLFHAVMGRTLSMTLKHLDSYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGG-----LDTRPHYITRRYAEFSSAL----------------VSINQ------TIP-----------NERTMQLLGQLQVEVENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEFIEELLSPPFGGLVAFVKEAEALIERG-QAERLRGEEARVTQLIRGFGSSWKSSVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHKPNF 723          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Human
Match: VPS52 (VPS52 subunit of GARP complex [Source:HGNC Symbol;Acc:HGNC:10518])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 315/742 (42.45%), Postives = 475/742 (64.02%), Query Frame = 2
Query:  143 FDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
                DI SD+ +++EV  HIQANL+DE+V+EALK+GVDLR YS+ V+ EL  +E +SI DY++  + +  LH QIT+ DA+L+RME++L  F  DL SIS++I++LQ +S  M+  L+NRQ VRG+L + +  +VVP  ++  IL+ PVTE  FLEQL ELD K   V+EQ  + + +  DV  +L++L++KA+ KIRE++LQKIY+FRKPMTN+Q+PQ  +LKYRFF +FLL N+RA A EI  EYV+T SKI+ SY+++Y+ +L K+Q+++ A+K+D +G ED        +     F + S    L++++T+F+L  R S++    LEAPI++PHT    ++         ++ +E LFRSQHYALLD  CREYLF+C+FF++S  A  D F+ VMG+TL++  K +++ +A C+DAI + +CI IVL ++++  +R V ALD YW  +L LLWPR+  +++ +V SVR     R        +D RP+ +TR+YAEF +AL                 S+N        IP           + +    L ++QVE+E  ++R+     +RKE+L+F INN D++L VL E    D  E   F+ L+  +  EF+EE+L P FG L+ F+KE E+   +  ++E    EEA+V ++I+GF   WK+S+E ++ +++ SF+NF  GT I Q  L+QLIQ Y R    ++    + +P + ELINIHH+MVE+KK KPNF
Sbjct:   42 LGELDITSDEFILDEVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLVVPSALVTAILEAPVTEPRFLEQLQELDAKAAAVREQEARGTAACADVRGVLDRLRVKAVTKIREFILQKIYSFRKPMTNYQIPQTALLKYRFFYQFLLGNERATAKEIRDEYVETLSKIYLSYYRSYLGRLMKVQYEEVAEKDDLMGVED--------TAKKGFFSKPS----LRSRNTIFTLGTRGSVISPTELEAPILVPHTAQRGEQ---------RYPFEALFRSQHYALLDNSCREYLFICEFFVVSGPAAHDLFHAVMGRTLSMTLKHLDSYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGG-----LDTRPHYITRRYAEFSSAL----------------VSINQ------TIP-----------NERTMQLLGQLQVEVENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEFIEELLSPPFGGLVAFVKEAEALIERG-QAERLRGEEARVTQLIRGFGSSWKSSVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHKPNF 723          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Human
Match: VPS52 (VPS52 subunit of GARP complex [Source:HGNC Symbol;Acc:HGNC:10518])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 315/742 (42.45%), Postives = 475/742 (64.02%), Query Frame = 2
Query:  143 FDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
                DI SD+ +++EV  HIQANL+DE+V+EALK+GVDLR YS+ V+ EL  +E +SI DY++  + +  LH QIT+ DA+L+RME++L  F  DL SIS++I++LQ +S  M+  L+NRQ VRG+L + +  +VVP  ++  IL+ PVTE  FLEQL ELD K   V+EQ  + + +  DV  +L++L++KA+ KIRE++LQKIY+FRKPMTN+Q+PQ  +LKYRFF +FLL N+RA A EI  EYV+T SKI+ SY+++Y+ +L K+Q+++ A+K+D +G ED        +     F + S    L++++T+F+L  R S++    LEAPI++PHT    ++         ++ +E LFRSQHYALLD  CREYLF+C+FF++S  A  D F+ VMG+TL++  K +++ +A C+DAI + +CI IVL ++++  +R V ALD YW  +L LLWPR+  +++ +V SVR     R        +D RP+ +TR+YAEF +AL                 S+N        IP           + +    L ++QVE+E  ++R+     +RKE+L+F INN D++L VL E    D  E   F+ L+  +  EF+EE+L P FG L+ F+KE E+   +  ++E    EEA+V ++I+GF   WK+S+E ++ +++ SF+NF  GT I Q  L+QLIQ Y R    ++    + +P + ELINIHH+MVE+KK KPNF
Sbjct:   42 LGELDITSDEFILDEVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLVVPSALVTAILEAPVTEPRFLEQLQELDAKAAAVREQEARGTAACADVRGVLDRLRVKAVTKIREFILQKIYSFRKPMTNYQIPQTALLKYRFFYQFLLGNERATAKEIRDEYVETLSKIYLSYYRSYLGRLMKVQYEEVAEKDDLMGVED--------TAKKGFFSKPS----LRSRNTIFTLGTRGSVISPTELEAPILVPHTAQRGEQ---------RYPFEALFRSQHYALLDNSCREYLFICEFFVVSGPAAHDLFHAVMGRTLSMTLKHLDSYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGG-----LDTRPHYITRRYAEFSSAL----------------VSINQ------TIP-----------NERTMQLLGQLQVEVENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEFIEELLSPPFGGLVAFVKEAEALIERG-QAERLRGEEARVTQLIRGFGSSWKSSVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHKPNF 723          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Human
Match: VPS52 (VPS52 subunit of GARP complex [Source:HGNC Symbol;Acc:HGNC:10518])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 315/742 (42.45%), Postives = 475/742 (64.02%), Query Frame = 2
Query:  143 FDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
                DI SD+ +++EV  HIQANL+DE+V+EALK+GVDLR YS+ V+ EL  +E +SI DY++  + +  LH QIT+ DA+L+RME++L  F  DL SIS++I++LQ +S  M+  L+NRQ VRG+L + +  +VVP  ++  IL+ PVTE  FLEQL ELD K   V+EQ  + + +  DV  +L++L++KA+ KIRE++LQKIY+FRKPMTN+Q+PQ  +LKYRFF +FLL N+RA A EI  EYV+T SKI+ SY+++Y+ +L K+Q+++ A+K+D +G ED        +     F + S    L++++T+F+L  R S++    LEAPI++PHT    ++         ++ +E LFRSQHYALLD  CREYLF+C+FF++S  A  D F+ VMG+TL++  K +++ +A C+DAI + +CI IVL ++++  +R V ALD YW  +L LLWPR+  +++ +V SVR     R        +D RP+ +TR+YAEF +AL                 S+N        IP           + +    L ++QVE+E  ++R+     +RKE+L+F INN D++L VL E    D  E   F+ L+  +  EF+EE+L P FG L+ F+KE E+   +  ++E    EEA+V ++I+GF   WK+S+E ++ +++ SF+NF  GT I Q  L+QLIQ Y R    ++    + +P + ELINIHH+MVE+KK KPNF
Sbjct:   42 LGELDITSDEFILDEVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLVVPSALVTAILEAPVTEPRFLEQLQELDAKAAAVREQEARGTAACADVRGVLDRLRVKAVTKIREFILQKIYSFRKPMTNYQIPQTALLKYRFFYQFLLGNERATAKEIRDEYVETLSKIYLSYYRSYLGRLMKVQYEEVAEKDDLMGVED--------TAKKGFFSKPS----LRSRNTIFTLGTRGSVISPTELEAPILVPHTAQRGEQ---------RYPFEALFRSQHYALLDNSCREYLFICEFFVVSGPAAHDLFHAVMGRTLSMTLKHLDSYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGG-----LDTRPHYITRRYAEFSSAL----------------VSINQ------TIP-----------NERTMQLLGQLQVEVENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEFIEELLSPPFGGLVAFVKEAEALIERG-QAERLRGEEARVTQLIRGFGSSWKSSVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHKPNF 723          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Human
Match: VPS52 (VPS52 subunit of GARP complex [Source:HGNC Symbol;Acc:HGNC:10518])

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 315/742 (42.45%), Postives = 475/742 (64.02%), Query Frame = 2
Query:  143 FDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
                DI SD+ +++EV  HIQANL+DE+V+EALK+GVDLR YS+ V+ EL  +E +SI DY++  + +  LH QIT+ DA+L+RME++L  F  DL SIS++I++LQ +S  M+  L+NRQ VRG+L + +  +VVP  ++  IL+ PVTE  FLEQL ELD K   V+EQ  + + +  DV  +L++L++KA+ KIRE++LQKIY+FRKPMTN+Q+PQ  +LKYRFF +FLL N+RA A EI  EYV+T SKI+ SY+++Y+ +L K+Q+++ A+K+D +G ED        +     F + S    L++++T+F+L  R S++    LEAPI++PHT    ++         ++ +E LFRSQHYALLD  CREYLF+C+FF++S  A  D F+ VMG+TL++  K +++ +A C+DAI + +CI IVL ++++  +R V ALD YW  +L LLWPR+  +++ +V SVR     R        +D RP+ +TR+YAEF +AL                 S+N        IP           + +    L ++QVE+E  ++R+     +RKE+L+F INN D++L VL E    D  E   F+ L+  +  EF+EE+L P FG L+ F+KE E+   +  ++E    EEA+V ++I+GF   WK+S+E ++ +++ SF+NF  GT I Q  L+QLIQ Y R    ++    + +P + ELINIHH+MVE+KK KPNF
Sbjct:   42 LGELDITSDEFILDEVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLVVPSALVTAILEAPVTEPRFLEQLQELDAKAAAVREQEARGTAACADVRGVLDRLRVKAVTKIREFILQKIYSFRKPMTNYQIPQTALLKYRFFYQFLLGNERATAKEIRDEYVETLSKIYLSYYRSYLGRLMKVQYEEVAEKDDLMGVED--------TAKKGFFSKPS----LRSRNTIFTLGTRGSVISPTELEAPILVPHTAQRGEQ---------RYPFEALFRSQHYALLDNSCREYLFICEFFVVSGPAAHDLFHAVMGRTLSMTLKHLDSYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGG-----LDTRPHYITRRYAEFSSAL----------------VSINQ------TIP-----------NERTMQLLGQLQVEVENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEFIEELLSPPFGGLVAFVKEAEALIERG-QAERLRGEEARVTQLIRGFGSSWKSSVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHKPNF 723          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Celegans
Match: vps-52 (Vacuolar protein sorting-associated protein 52 homolog [Source:UniProtKB/Swiss-Prot;Acc:G5EFV8])

HSP 1 Score: 412.535 bits (1059), Expect = 4.482e-133
Identity = 246/715 (34.41%), Postives = 397/715 (55.52%), Query Frame = 2
Query:  224 IVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
            +V++A+ SG  L E    V + L      S++  + + +++ +LH Q+   D + +R++  L++F  +LGSI  D+++LQ +S  +HQ L+NRQ VR EL QF+ ++ V + M+  I DT   +R FLE LHEL HK+  + ++   D+ + +D   ILE LK+KA++K+RE+LLQK++ FRKP++N+QV Q  +LK RFF EFLL +D   A E+  EY+DT SK+ ++YFKAY T+L KL     A KED LG  DF       +  G+IF  SS    ++NK+TVFS+ QR  IL ++ L A +I+PH    N +S         + +E LFRS   A +D    EYLF+ DFF++S+    +  N+ M + +++  K  E  IA  +DAI + +CI +   + ++  ER V  + +YW  + + LW R   +M  H  SV+     +  +S +  +D RP+ + R+YAE  +A H ++ +       ASG                        M A++ + L   +  IE +L R+      +K K +F INN DLILS++   E           +L    I++FVEE+L P+ G +I F+ E ES   +   ++       KV  ++  FN  W+ +++ INSE +  F+NF +GT I Q + ++ +QY  R    ++   +   PV ++L+N+H +M+E+K+FKP +
Sbjct:   37 LVKKAIASGDGLTESKNDVSTRLSEAHRYSVQQCLDNSEQLAQLHNQLVHCDNVFERLQATLYSFQDNLGSIGQDMKNLQLQSHHIHQELENRQKVRVELSQFVDDIAVSQTMMKTINDTDANDRGFLEALHELHHKITLILQRGNGDAVAVNDTMPILEGLKLKAVVKVREWLLQKMFQFRKPLSNYQVFQHQLLKCRFFYEFLLHHDLISAKELQDEYIDTISKMFFTYFKAYATRLFKLAMKDVATKEDALGSIDF----AKPAGLGAIF--SSKQHVVRNKATVFSIGQRHQILSDDFLGA-LIVPHAATQNHQS---------YQFEALFRSIQLAFVDHYSHEYLFITDFFLVSNDEAIELHNKAMARAMSVVLKSCEEQIALSWDAISLHLCICLCDKFTEVLAEREVPEVSDYWNTVTSFLWTRLNLVMSQHYESVKSVDLKKLMHSGS--LDARPHFIVRRYAELTSA-HLMIAK-------ASGKE----------------------MGAKMEAVLENSEDSIEQLLTRMSAMQQTQKNKHVFLINNYDLILSIIDNEESKHTKIYAIVHELEQKSIDDFVEEMLEPHIGYMIKFVNECESLIVQG-HTQLLVRYNDKVGTVVANFNAKWRPAVDSINSECIQLFTNFSLGTTILQTIFTKYVQYINRFTKILSHDVFAKNPVCSQLVNVHQVMLEIKRFKPAY 702          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Fly
Match: Vps52 (gene:FBgn0031710 transcript:FBtr0079129)

HSP 1 Score: 537.339 bits (1383), Expect = 0.000e+0
Identity = 297/721 (41.19%), Postives = 437/721 (60.61%), Query Frame = 2
Query:  212 LQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASR-LMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMP-VKNELINIHHIMVEMKKFKPNF 2368
            L +E VRE LK+  DLR+YS  ++ E   VEN+SIEDY+     +  LH QI   D +L+RME +L +F   L +IST+I  LQ KS+ M   L NRQ V+ +L QF+ +M V E+MIN I++TPVTER F  QL+ L+HKL  VKE SFK+SKS  DVSD+L++L++KA+ KIR YLL++IY FRKPMTN+Q+PQ+ MLK++FF EF+L+N+R +A EI  EY+DT  KI+YSYFK+Y T+L  L+F+++  K+D +G ED       N++ G +F   S + +LK+KST+F++ +R  IL N  LEAPII+PH  + N           ++T E LFRS+ YAL+D  CREYLF+ +FF++     QD FNQ+MGKTL +  K +ETSI  CFD I + +CI ++  Y+ +C +R V ALD YW  L  ++WPR+  +   ++ S+     T+ +       +  P+ +TR+YAEF AA+  I                                  S +   ++ SR L+ +Q E+E  ++R+    P RK++LI+ INN DL+L VL E    +  E   F++ +  +  E+VEE+L P+FG +I F+KE E    K    E    E   +  ++  F+ +WK S+E++N E+L SF +   G+Q+ Q  L+ L+QYY R    +        P  + +L NIH +MVE+KK+K N+
Sbjct:   13 LDNEEVREILKNTTDLRQYSRQIEKEFKEVENKSIEDYIAESQNIANLHNQINDCDDVLERMENMLMSFQSVLNNISTEITQLQRKSVSMSLQLTNRQSVKAQLSQFIEDMAVSEEMINIIMETPVTERDFSTQLNVLNHKLSLVKELSFKESKSTSDVSDVLQKLRLKAMAKIRSYLLEQIYKFRKPMTNYQIPQNAMLKHKFFFEFILSNERHVAQEICSEYIDTMGKIYYSYFKSYSTRLTSLKFEESCTKDDLMGIED-------NASKG-LF---SKTTSLKHKSTIFTIGKRGDIL-NQQLEAPIIVPHAQLKN-----------RYTAEALFRSEQYALVDNACREYLFVTEFFMVRGTQAQDLFNQIMGKTLTLMIKNLETSIHDCFDTIAMFLCIHLIFRYQLMCHKRCVPALDKYWDSLQAVIWPRFELVFRLNIQSIHDCDPTKFNK------ELGPHYITRRYAEFSAAIVGI----------------------------------SEHFPNELVSRLLLELQNEVECFILRMAAIFPTRKDQLIYLINNYDLVLGVLMEHTRDNSKEAEAFREQLNSRSAEYVEEILAPHFGGIIQFVKECEHFFEKEQMDELRKQERRSL-ALVASFSANWKKSLEELNREVLLSFPSLLTGSQLLQLALASLVQYYHRFHKLLT-------PNARAQLTNIHVVMVEIKKYKSNY 662          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Zebrafish
Match: vps52 (VPS52 subunit of GARP complex [Source:ZFIN;Acc:ZDB-GENE-010430-2])

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 325/744 (43.68%), Postives = 498/744 (66.94%), Query Frame = 2
Query:  140 SFDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQI-DFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
            +F + DI +D+++++EV  HIQANL+D++V+EALK+GVDLR+YS  V++EL  +E  SI+DY+K    +  LH QIT+ D+IL+RME +L +F  DL SIS++IQ+LQ +S+ M+  L+NRQ VR +L Q + E+VVP  MI+ ILD+PVTE+ FLEQLHEL++K+ F KE SF+++ +  D+ DI+++LKIKA+ KIRE++LQKIY+FRKPMTN+Q+PQ+ +LKYRFF +FLLAN+R +A EI  EYVDT SKI+ SYFK+Y  +L K+Q++  ADK+D +G ED        +     F + S    LK+++T+F+L QR +IL    LE PI++PH   A Q+ DS      ++ YETLFRSQHYALLD  CRE+LFL DFF+++  +  D FN +MGKTL+IF K + T ++ C+D+I + +CI I+L ++ +  +R + ALD Y   +L LLWPR+  +++ ++ S+R       ++ Q + + D RP+ +TR+YAEF +A+ +I       + T      N+L                          L ++Q+E+E  ++++    P+R+++LIF INN D++LSVL E    D  E   F+ L+  +  EF+EE+L P FG +I F+KE+E+   K  + +   N+EA++ ++++GF+  WK S+E ++ +++ SF+NF  GT I Q  L+QLIQYY      ++   ++++ V++ELIN+HH+MVE+KK KPNF
Sbjct:   42 NFGDLDITTDELILDEVDIHIQANLEDDLVKEALKTGVDLRQYSRQVETELQQIEQASIKDYIKESQNIASLHNQITACDSILERMEGMLSSFQSDLSSISSEIQTLQQQSVSMNMRLKNRQAVRSQLSQLVDELVVPSTMISVILDSPVTEQEFLEQLHELNNKINFAKELSFRETLACSDIQDIVDRLKIKAVTKIREFILQKIYSFRKPMTNYQIPQNTLLKYRFFYQFLLANERTVAKEIRDEYVDTMSKIYLSYFKSYSGRLLKVQYEDVADKDDLMGVED--------TAKKGFFSKPS----LKSRNTIFTLGQRGAILSPAELEGPILIPH---AAQRGDS------RYPYETLFRSQHYALLDNGCREFLFLSDFFMVAGNSALDLFNSIMGKTLSIFLKNLSTYLSDCYDSIAVFLCIHIILRFRAIVAKRNIPALDKYLEAVLELLWPRFELILEMNIQSIRN------TDPQKLGVLDTRPHYITRRYAEFSSAIVSI-------NQTFPNERTNTL--------------------------LGQLQIEVENFVLKMAAEFPSRRDQLIFLINNYDMMLSVLMERAADDSKEVESFQQLLLARTQEFIEEILSPPFGGMIAFVKESEALMEKG-QLDKLKNDEARITQLVRGFSGTWKQSVEALSQDVMRSFTNFKNGTSIIQGALTQLIQYYHGFHKVLSQPTFRSLAVRSELINLHHLMVEVKKHKPNF 724          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Xenopus
Match: VPS52 (VPS52, GARP complex subunit [Source:NCBI gene;Acc:100489528])

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 323/740 (43.65%), Postives = 489/740 (66.08%), Query Frame = 2
Query:  149 NFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
            + D+ SDD+ ++ V  HIQ NL+D +V+EALK+GVDLR+YS+ V+ EL  +E+ SI DY++    +  LH QI + DAIL+RM  +L +F  DL SIS++I +LQ +SL M+  L+NRQ VR EL Q + E+++P  MI+ ILD PVT++ F+EQLHEL++K+ +VKEQSF+D+++  DV + L++LKIKA+ K+RE++LQKIY+FRKPMTN+Q+PQ+ +LKYRFF +FLL N+R++A EI  EYV+T SK++ SYFK+Y ++L KLQ+++ A+K+D +G ED         T+   F        L++K+TVF++  R +I+    LE PII+PHT    Q+ D       ++ +E+LFRSQHYALLD  CRE+LFL +FF+++  A Q+ FN VMG++L +F K I++ ++ C+D+I I +CI IVL +K +   R + A+D YW  LL++LWPR+  +++ ++ S+R     R        +D RP+ +TR+YAEF +A+ +I       + T      N+L                          L ++QVE+E  ++R+     +RKE+LIF INN D++LSVL E   SD  E   F+ L+  +  EF+EE+L P FG +I F+KE+ES   K  + E   +EEA+V ++++GF+  WK ++E ++ +++ SF+NF  GT I Q  L+QLIQYY R    ++  P +N+PV +ELIN+HH+MVE+KK KPNF
Sbjct:   49 DLDLTSDDLTLDTVSIHIQENLEDALVQEALKAGVDLRQYSKQVELELQQIEHASITDYIQESQNIASLHNQIIACDAILERMGHMLCSFQSDLSSISSEIHTLQEQSLAMNIKLKNRQTVRSELSQLVDELIIPSTMISVILDVPVTDQQFVEQLHELNNKINYVKEQSFRDTQACADVQETLQKLKIKAVTKVREFILQKIYSFRKPMTNYQIPQNALLKYRFFYQFLLGNERSVAQEIQDEYVETMSKVYLSYFKSYTSRLMKLQYEEVAEKDDLMGIED---------TAKKGFFS---KPALRSKNTVFTVGNRAAIISPTELEGPIIVPHTA---QRGD------IRYPFESLFRSQHYALLDNSCREFLFLSEFFLVNGAAAQELFNSVMGRSLAMFLKHIDSYVSDCYDSIAIFLCIHIVLRFKGIAQRRDIPAVDKYWDALLDMLWPRFQLILELNIQSIRNTDPQRLGT-----VDTRPHYITRRYAEFSSAIVSI-------NQTFPNEKTNAL--------------------------LGQLQVEVENFVLRMAAEFSSRKEQLIFLINNYDMMLSVLMERASSDSKEVESFQQLLTARTQEFIEEILAPSFGGMIAFVKESESLIEKG-QQERLRSEEARVAQLVRGFSSTWKQAVENLSQDVMRSFTNFKNGTSIIQGALTQLIQYYHRFHKILSQPPLRNLPVCSELINLHHLMVELKKHKPNF 728          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Xenopus
Match: VPS52 (VPS52, GARP complex subunit [Source:NCBI gene;Acc:100489528])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 307/707 (43.42%), Postives = 464/707 (65.63%), Query Frame = 2
Query:  248 GVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
            GVDLR+YS+ V+ EL  +E+ SI DY++    +  LH QI + DAIL+RM  +L +F  DL SIS++I +LQ +SL M+  L+NRQ VR EL Q + E+++P  MI+ ILD PVT++ F+EQLHEL++K+ +VKEQSF+D+++  DV + L++LKIKA+ K+RE++LQKIY+FRKPMTN+Q+PQ+ +LKYRFF +FLL N+R++A EI  EYV+T SK++ SYFK+Y ++L KLQ+++ A+K+D +G ED         T+    L       L++K+TVF++  R +I+    LE PII+PHT    Q+ D       ++ +E+LFRSQHYALLD  CRE+LFL +FF+++  A Q+ FN VMG++L +F K I++ ++ C+D+I I +CI IVL +K +   R + A+D YW  LL++LWPR+  +++ ++ S+R     R        +D RP+ +TR+YAEF +A+ +I       + T      N+L                          L ++QVE+E  ++R+     +RKE+LIF INN D++LSVL E   SD  E   F+ L+  +  EF+EE+L P FG +I F+KE+ES   K  + E   +EEA+V ++++GF+  WK ++E ++ +++ SF+NF  GT I Q  L+QLIQYY R    ++  P +N+PV +ELIN+HH+MVE+KK KPNF
Sbjct:   54 GVDLRQYSKQVELELQQIEHASITDYIQESQNIASLHNQIIACDAILERMGHMLCSFQSDLSSISSEIHTLQEQSLAMNIKLKNRQTVRSELSQLVDELIIPSTMISVILDVPVTDQQFVEQLHELNNKINYVKEQSFRDTQACADVQETLQKLKIKAVTKVREFILQKIYSFRKPMTNYQIPQNALLKYRFFYQFLLGNERSVAQEIQDEYVETMSKVYLSYFKSYTSRLMKLQYEEVAEKDDLMGIED---------TAKKDILMYHFGPALRSKNTVFTVGNRAAIISPTELEGPIIVPHTA---QRGD------IRYPFESLFRSQHYALLDNSCREFLFLSEFFLVNGAAAQELFNSVMGRSLAMFLKHIDSYVSDCYDSIAIFLCIHIVLRFKGIAQRRDIPAVDKYWDALLDMLWPRFQLILELNIQSIRNTDPQRLGT-----VDTRPHYITRRYAEFSSAIVSI-------NQTFPNEKTNAL--------------------------LGQLQVEVENFVLRMAAEFSSRKEQLIFLINNYDMMLSVLMERASSDSKEVESFQQLLTARTQEFIEEILAPSFGGMIAFVKESESLIEKG-QQERLRSEEARVAQLVRGFSSTWKQAVENLSQDVMRSFTNFKNGTSIIQGALTQLIQYYHRFHKILSQPPLRNLPVCSELINLHHLMVELKKHKPNF 703          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Xenopus
Match: VPS52 (VPS52, GARP complex subunit [Source:NCBI gene;Acc:100489528])

HSP 1 Score: 602.053 bits (1551), Expect = 0.000e+0
Identity = 304/708 (42.94%), Postives = 462/708 (65.25%), Query Frame = 2
Query:  245 SGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
            +GVDLR+YS+ V+ EL  +E+ SI DY++    +  LH QI + DAIL+RM  +L +F  DL SIS++I +LQ +SL M+  L+NRQ VR EL Q + E+++P  MI+ ILD PVT++ F+EQLHEL++K+ +VKEQSF+D+++  DV + L++LKIKA+ K+RE++LQKIY+FRKPMTN+Q+PQ+ +LKYRFF +FLL N+R++A EI  EYV+T SK++ SYFK+Y ++L KLQ+++ A+K+D +G ED                  +   ++  K+TVF++  R +I+    LE PII+PHT    Q+ D       ++ +E+LFRSQHYALLD  CRE+LFL +FF+++  A Q+ FN VMG++L +F K I++ ++ C+D+I I +CI IVL +K +   R + A+D YW  LL++LWPR+  +++ ++ S+R     R        +D RP+ +TR+YAEF +A+ +I       + T      N+L                          L ++QVE+E  ++R+     +RKE+LIF INN D++LSVL E   SD  E   F+ L+  +  EF+EE+L P FG +I F+KE+ES   K  + E   +EEA+V ++++GF+  WK ++E ++ +++ SF+NF  GT I Q  L+QLIQYY R    ++  P +N+PV +ELIN+HH+MVE+KK KPNF
Sbjct:    1 NGVDLRQYSKQVELELQQIEHASITDYIQESQNIASLHNQIIACDAILERMGHMLCSFQSDLSSISSEIHTLQEQSLAMNIKLKNRQTVRSELSQLVDELIIPSTMISVILDVPVTDQQFVEQLHELNNKINYVKEQSFRDTQACADVQETLQKLKIKAVTKVREFILQKIYSFRKPMTNYQIPQNALLKYRFFYQFLLGNERSVAQEIQDEYVETMSKVYLSYFKSYTSRLMKLQYEEVAEKDDLMGIED------------------TAKKDILIKNTVFTVGNRAAIISPTELEGPIIVPHTA---QRGD------IRYPFESLFRSQHYALLDNSCREFLFLSEFFLVNGAAAQELFNSVMGRSLAMFLKHIDSYVSDCYDSIAIFLCIHIVLRFKGIAQRRDIPAVDKYWDALLDMLWPRFQLILELNIQSIRNTDPQRLGT-----VDTRPHYITRRYAEFSSAIVSI-------NQTFPNEKTNAL--------------------------LGQLQVEVENFVLRMAAEFSSRKEQLIFLINNYDMMLSVLMERASSDSKEVESFQQLLTARTQEFIEEILAPSFGGMIAFVKESESLIEKG-QQERLRSEEARVAQLVRGFSSTWKQAVENLSQDVMRSFTNFKNGTSIIQGALTQLIQYYHRFHKILSQPPLRNLPVCSELINLHHLMVELKKHKPNF 642          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Mouse
Match: Vps52 (VPS52 GARP complex subunit [Source:MGI Symbol;Acc:MGI:1330304])

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 316/742 (42.59%), Postives = 473/742 (63.75%), Query Frame = 2
Query:  143 FDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
                DI SD+ +++EV  HIQANL+DE+V+EALK+GVDLR YS+ V+ EL  +E +SI DY++  + +  LH QIT+ DA+L+RME++L  F  DL SIS++I++LQ +S  M+  L+NRQ VRG+L + +  +VVP  ++  IL+ PVTE  FLEQL ELD K   V+EQ    + +  DV  +L++L++KA+ KIRE++LQKIY+FRKPMTN+Q+PQ  +LKYRFF +FLL N+RA A EI  EYV+T SKI+ SY+++Y+ +L K+Q+++ A+K+D +G ED        +     F + S    L++++T+F+L  R +++    LEAPI++PHT    ++         ++ +E LFRSQHYALLD  CREYLF+C+FFI+S  A  D F+ VMG+TL++  K +E+ +A C+DAI + +CI IVL ++++  +R V ALD YW  +L LLWPR+  +++ +V SVR     R        +D RP+ +TR+YAEF +AL                 S+N        IP           + +    L ++QVE+E  ++R+     +RKE+L+F INN D++L VL E    D  E   F+ L+  +  EF+EE+L P FG L+ F+KE E+   +  ++E    EEA+V ++I+GF   WK S+E ++ +++ SF+NF  GT I Q  L+QLIQ Y R    ++    + +P + ELINIHH+MVE+KK KPNF
Sbjct:   42 LGELDITSDEFILDEVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLVVPSALVTAILEAPVTEPRFLEQLQELDAKAAAVREQEAMGTAACADVRGVLDRLRVKAVTKIREFILQKIYSFRKPMTNYQIPQAALLKYRFFYQFLLGNERATAKEIRDEYVETLSKIYLSYYRSYVGRLMKVQYEEVAEKDDLMGVED--------TAKKGFFSKPS----LRSRNTIFTLGTRGTVISPAELEAPILVPHTAQRGEQ---------RYPFEALFRSQHYALLDNSCREYLFICEFFIVSGPAAHDLFHAVMGRTLSMTLKHLESYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGG-----LDTRPHYITRRYAEFSSAL----------------VSINQ------TIP-----------NERTLQLLGQLQVEVENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEFIEELLSPPFGGLVAFVKEAEALIERG-QAERLRGEEARVTQLIRGFGSSWKASVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHKPNF 723          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Mouse
Match: Vps52 (VPS52 GARP complex subunit [Source:MGI Symbol;Acc:MGI:1330304])

HSP 1 Score: 426.402 bits (1095), Expect = 2.585e-139
Identity = 222/551 (40.29%), Postives = 337/551 (61.16%), Query Frame = 2
Query:  587 VTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQ 2239
            V E  FLEQL ELD K   V+EQ    + +  DV  +L++L++KA+ KIRE++LQKIY+FRKPMTN+Q+PQ  +LKYRFF +FLL N+RA A EI  EYV+T SKI+ SY+++Y+ +L K+Q+++ A+K+D +G ED        +     F + S    L++++T+F+L  R +++    LEAPI++PHT    ++         ++ +E LFRSQHYALLD  CREYLF+C+FFI+S  A  D F+ VMG+TL++  K +E+ +A C+DAI + +CI IVL ++++  +R V ALD YW  +L LLWPR+  +++ +V SVR     R        +D RP+ +TR+YAEF +AL                 S+N        IP           + +    L ++QVE+E  ++R+     +RKE+L+F INN D++L VL E    D  E   F+ L+  +  EF+EE+L P FG L+ F+KE E+   +  ++E    EEA+V ++I+GF   WK S+E ++ +++ SF+NF  GT I Q  L+Q
Sbjct:  122 VLEPRFLEQLQELDAKAAAVREQEAMGTAACADVRGVLDRLRVKAVTKIREFILQKIYSFRKPMTNYQIPQAALLKYRFFYQFLLGNERATAKEIRDEYVETLSKIYLSYYRSYVGRLMKVQYEEVAEKDDLMGVED--------TAKKGFFSKPS----LRSRNTIFTLGTRGTVISPAELEAPILVPHTAQRGEQ---------RYPFEALFRSQHYALLDNSCREYLFICEFFIVSGPAAHDLFHAVMGRTLSMTLKHLESYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGG-----LDTRPHYITRRYAEFSSAL----------------VSINQ------TIP-----------NERTLQLLGQLQVEVENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEFIEELLSPPFGGLVAFVKEAEALIERG-QAERLRGEEARVTQLIRGFGSSWKASVESLSQDVMRSFTNFRNGTSIIQGALTQ 612          

HSP 2 Score: 90.8929 bits (224), Expect = 1.950e-18
Identity = 42/83 (50.60%), Postives = 61/83 (73.49%), Query Frame = 2
Query:  143 FDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILK 391
                DI SD+ +++EV  HIQANL+DE+V+EALK+GVDLR YS+ V+ EL  +E +SI DY++  + +  LH QIT+ DA+L+
Sbjct:   42 LGELDITSDEFILDEVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLE 124          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. UniProt/SwissProt
Match: sp|Q8N1B4|VPS52_HUMAN (Vacuolar protein sorting-associated protein 52 homolog OS=Homo sapiens OX=9606 GN=VPS52 PE=1 SV=1)

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 315/742 (42.45%), Postives = 475/742 (64.02%), Query Frame = 2
Query:  143 FDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
                DI SD+ +++EV  HIQANL+DE+V+EALK+GVDLR YS+ V+ EL  +E +SI DY++  + +  LH QIT+ DA+L+RME++L  F  DL SIS++I++LQ +S  M+  L+NRQ VRG+L + +  +VVP  ++  IL+ PVTE  FLEQL ELD K   V+EQ  + + +  DV  +L++L++KA+ KIRE++LQKIY+FRKPMTN+Q+PQ  +LKYRFF +FLL N+RA A EI  EYV+T SKI+ SY+++Y+ +L K+Q+++ A+K+D +G ED        +     F + S    L++++T+F+L  R S++    LEAPI++PHT    ++         ++ +E LFRSQHYALLD  CREYLF+C+FF++S  A  D F+ VMG+TL++  K +++ +A C+DAI + +CI IVL ++++  +R V ALD YW  +L LLWPR+  +++ +V SVR     R        +D RP+ +TR+YAEF +AL                 S+N        IP           + +    L ++QVE+E  ++R+     +RKE+L+F INN D++L VL E    D  E   F+ L+  +  EF+EE+L P FG L+ F+KE E+   +  ++E    EEA+V ++I+GF   WK+S+E ++ +++ SF+NF  GT I Q  L+QLIQ Y R    ++    + +P + ELINIHH+MVE+KK KPNF
Sbjct:   42 LGELDITSDEFILDEVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLVVPSALVTAILEAPVTEPRFLEQLQELDAKAAAVREQEARGTAACADVRGVLDRLRVKAVTKIREFILQKIYSFRKPMTNYQIPQTALLKYRFFYQFLLGNERATAKEIRDEYVETLSKIYLSYYRSYLGRLMKVQYEEVAEKDDLMGVED--------TAKKGFFSKPS----LRSRNTIFTLGTRGSVISPTELEAPILVPHTAQRGEQ---------RYPFEALFRSQHYALLDNSCREYLFICEFFVVSGPAAHDLFHAVMGRTLSMTLKHLDSYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGG-----LDTRPHYITRRYAEFSSAL----------------VSINQ------TIP-----------NERTMQLLGQLQVEVENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEFIEELLSPPFGGLVAFVKEAEALIERG-QAERLRGEEARVTQLIRGFGSSWKSSVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHKPNF 723          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. UniProt/SwissProt
Match: sp|Q8C754|VPS52_MOUSE (Vacuolar protein sorting-associated protein 52 homolog OS=Mus musculus OX=10090 GN=Vps52 PE=1 SV=1)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 316/742 (42.59%), Postives = 473/742 (63.75%), Query Frame = 2
Query:  143 FDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
                DI SD+ +++EV  HIQANL+DE+V+EALK+GVDLR YS+ V+ EL  +E +SI DY++  + +  LH QIT+ DA+L+RME++L  F  DL SIS++I++LQ +S  M+  L+NRQ VRG+L + +  +VVP  ++  IL+ PVTE  FLEQL ELD K   V+EQ    + +  DV  +L++L++KA+ KIRE++LQKIY+FRKPMTN+Q+PQ  +LKYRFF +FLL N+RA A EI  EYV+T SKI+ SY+++Y+ +L K+Q+++ A+K+D +G ED        +     F + S    L++++T+F+L  R +++    LEAPI++PHT    ++         ++ +E LFRSQHYALLD  CREYLF+C+FFI+S  A  D F+ VMG+TL++  K +E+ +A C+DAI + +CI IVL ++++  +R V ALD YW  +L LLWPR+  +++ +V SVR     R        +D RP+ +TR+YAEF +AL                 S+N        IP           + +    L ++QVE+E  ++R+     +RKE+L+F INN D++L VL E    D  E   F+ L+  +  EF+EE+L P FG L+ F+KE E+   +  ++E    EEA+V ++I+GF   WK S+E ++ +++ SF+NF  GT I Q  L+QLIQ Y R    ++    + +P + ELINIHH+MVE+KK KPNF
Sbjct:   42 LGELDITSDEFILDEVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLVVPSALVTAILEAPVTEPRFLEQLQELDAKAAAVREQEAMGTAACADVRGVLDRLRVKAVTKIREFILQKIYSFRKPMTNYQIPQAALLKYRFFYQFLLGNERATAKEIRDEYVETLSKIYLSYYRSYVGRLMKVQYEEVAEKDDLMGVED--------TAKKGFFSKPS----LRSRNTIFTLGTRGTVISPAELEAPILVPHTAQRGEQ---------RYPFEALFRSQHYALLDNSCREYLFICEFFIVSGPAAHDLFHAVMGRTLSMTLKHLESYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGG-----LDTRPHYITRRYAEFSSAL----------------VSINQ------TIP-----------NERTLQLLGQLQVEVENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEFIEELLSPPFGGLVAFVKEAEALIERG-QAERLRGEEARVTQLIRGFGSSWKASVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHKPNF 723          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. UniProt/SwissProt
Match: sp|O55166|VPS52_RAT (Vacuolar protein sorting-associated protein 52 homolog OS=Rattus norvegicus OX=10116 GN=Vps52 PE=1 SV=2)

HSP 1 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 314/742 (42.32%), Postives = 473/742 (63.75%), Query Frame = 2
Query:  143 FDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
                DI SD+ +++EV  HIQANL+DE+V+EALK+GVDLR YS+ V+ EL  +E +SI DY++  + +  LH QIT+ DA+L+RME++L  F  DL SIS +I++LQ +S  M+  L+NRQ VRG+L + +  +VVP  ++  IL+ PVTE  FLEQL ELD K   V+EQ  + + +  DV  +L++L++KA+ KIRE++LQKIY+FRKPMTN+Q+PQ  +LKYRFF +FLL N+RA A E+  EYV+T SKI+ SY+++Y+ +L K+Q+++ A+K+D +G ED        +     F + S    L++++T+F+L  R +++    LEAPI++PHT    ++         ++ +E LFRSQHYALLD  CREYLF+C+FF++S  A  D F+ VMG+TL++  K +E+ +A C+DAI + +CI IVL ++++  +R V ALD YW  +L LLWPR+  +++ +V SVR     R        +D RP+ +TR+YAEF +AL                 S+N        IP           + +    L ++QVE+E  ++R+     +RKE+L+F INN D++L VL E    D  E   F+ L+  +  EF+EE+L P FG L+ F+KE E+   +  ++E    EEA+V ++I+GF   WK S+E ++ +++ SF+NF  GT I Q  L+QLIQ Y R    ++    + +P + ELINIHH+MVE+KK KPNF
Sbjct:   42 LGELDITSDEFILDEVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISCEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLVVPSALVTAILEAPVTEPRFLEQLQELDAKAAAVREQEARGTAACADVRGVLDRLRVKAVTKIREFILQKIYSFRKPMTNYQIPQTALLKYRFFYQFLLGNERATAKEVRDEYVETLSKIYLSYYRSYVGRLMKVQYEEVAEKDDLMGVED--------TAKKGFFSKPS----LRSRNTIFTLGTRGAVISPAELEAPILVPHTAQRGEQ---------RYPFEALFRSQHYALLDNSCREYLFICEFFVVSGPAAHDLFHAVMGRTLSMTLKHLESYLADCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGG-----LDTRPHYITRRYAEFSSAL----------------VSINQ------TIP-----------NERTLQLLGQLQVEVENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEFIEELLSPPFGGLVAFVKEAEALIERG-QAERLRGEEARVTQLIRGFGSSWKASVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHKPNF 723          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. UniProt/SwissProt
Match: sp|Q5TJF0|VPS52_CANLF (Vacuolar protein sorting-associated protein 52 homolog OS=Canis lupus familiaris OX=9615 GN=VPS52 PE=3 SV=1)

HSP 1 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 315/742 (42.45%), Postives = 473/742 (63.75%), Query Frame = 2
Query:  143 FDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
                DI SD+ +++EV  HIQANL+DE+V+EALK+GVDLR YS+ V+ EL  +E +SI DY++  + +  LH QIT+ DA+L+RME++L  F  DL SIS++I++LQ +S  M+  L+NRQ VRG+L + +  ++VP  +I  IL+ PVTE  FLEQL ELD K   V+EQ  + + +  DV  IL++L++KA+ KIRE++LQKIY+FRKPMTN+Q+PQ  +LKYRFF +FLL N+RA A EI  EYV+T SKI+ SY+++Y+ +L K+Q+++ A+K+D +G ED        +     F + S    L++++T+F+L  R S++    LEAPI++PHT    ++         ++ +E LFRSQHYALLD  CREYLF+C+FF++S  A  D F+ VMG+TL +  K +E+ +  C+DAI + +CI IVL ++++  +R V ALD YW  +L LLWPR+  +++ +V SVR     R        +D RP+ +TR+YAEF +AL                 S+N        +P           + +    L ++QVE+E  ++R+     +RKE+L+F INN D++L VL E    D  E   F+ L+  +  EF+EE+L P FG L+ F+KE E+   +  ++E    EEA+V ++I+GF   WK+S+E ++ +++ SF+NF  GT I Q  L+QLIQ Y R    ++    + +P + ELINIHH+MVE+KK KPNF
Sbjct:   42 LGELDISSDEFILDEVDVHIQANLEDELVKEALKTGVDLRHYSKQVELELQQIEQKSIRDYIQESENIASLHNQITACDAVLERMEQMLGAFQSDLSSISSEIRTLQEQSGAMNIRLRNRQAVRGKLGELVDGLIVPSALIMAILEAPVTEPRFLEQLQELDAKAAAVREQEARGTAACADVRGILDRLRVKAVTKIREFILQKIYSFRKPMTNYQIPQTALLKYRFFYQFLLGNERATAKEIRDEYVETLSKIYLSYYRSYLGRLMKVQYEEVAEKDDLMGVED--------TAKKGFFSKPS----LRSRNTIFTLGTRGSVISPTELEAPILVPHTAQRGEQ---------RYPFEALFRSQHYALLDNSCREYLFICEFFVVSGSAAHDLFHAVMGRTLGMTLKHLESYLTDCYDAIAVFLCIHIVLRFRNIAAKRDVPALDRYWEQVLALLWPRFELILEMNVQSVRSTDPQRLGG-----LDTRPHYITRRYAEFSSAL----------------VSINQ------TVP-----------NERTMQLLGQLQVEVENFVLRVAAEFSSRKEQLVFLINNYDMMLGVLMERAADDSKEVESFQQLLNARTQEFIEELLSPPFGGLVAFVKEAEALIERG-QAERLRGEEARVTQLIRGFGSSWKSSVESLSQDVMRSFTNFRNGTSIIQGALTQLIQLYHRFHRVLSQPQLRALPARAELINIHHLMVELKKHKPNF 723          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. UniProt/SwissProt
Match: sp|G5EFV8|VPS52_CAEEL (Vacuolar protein sorting-associated protein 52 homolog OS=Caenorhabditis elegans OX=6239 GN=vps-52 PE=1 SV=2)

HSP 1 Score: 412.535 bits (1059), Expect = 5.701e-132
Identity = 246/715 (34.41%), Postives = 397/715 (55.52%), Query Frame = 2
Query:  224 IVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
            +V++A+ SG  L E    V + L      S++  + + +++ +LH Q+   D + +R++  L++F  +LGSI  D+++LQ +S  +HQ L+NRQ VR EL QF+ ++ V + M+  I DT   +R FLE LHEL HK+  + ++   D+ + +D   ILE LK+KA++K+RE+LLQK++ FRKP++N+QV Q  +LK RFF EFLL +D   A E+  EY+DT SK+ ++YFKAY T+L KL     A KED LG  DF       +  G+IF  SS    ++NK+TVFS+ QR  IL ++ L A +I+PH    N +S         + +E LFRS   A +D    EYLF+ DFF++S+    +  N+ M + +++  K  E  IA  +DAI + +CI +   + ++  ER V  + +YW  + + LW R   +M  H  SV+     +  +S +  +D RP+ + R+YAE  +A H ++ +       ASG                        M A++ + L   +  IE +L R+      +K K +F INN DLILS++   E           +L    I++FVEE+L P+ G +I F+ E ES   +   ++       KV  ++  FN  W+ +++ INSE +  F+NF +GT I Q + ++ +QY  R    ++   +   PV ++L+N+H +M+E+K+FKP +
Sbjct:   37 LVKKAIASGDGLTESKNDVSTRLSEAHRYSVQQCLDNSEQLAQLHNQLVHCDNVFERLQATLYSFQDNLGSIGQDMKNLQLQSHHIHQELENRQKVRVELSQFVDDIAVSQTMMKTINDTDANDRGFLEALHELHHKITLILQRGNGDAVAVNDTMPILEGLKLKAVVKVREWLLQKMFQFRKPLSNYQVFQHQLLKCRFFYEFLLHHDLISAKELQDEYIDTISKMFFTYFKAYATRLFKLAMKDVATKEDALGSIDF----AKPAGLGAIF--SSKQHVVRNKATVFSIGQRHQILSDDFLGA-LIVPHAATQNHQS---------YQFEALFRSIQLAFVDHYSHEYLFITDFFLVSNDEAIELHNKAMARAMSVVLKSCEEQIALSWDAISLHLCICLCDKFTEVLAEREVPEVSDYWNTVTSFLWTRLNLVMSQHYESVKSVDLKKLMHSGS--LDARPHFIVRRYAELTSA-HLMIAK-------ASGKE----------------------MGAKMEAVLENSEDSIEQLLTRMSAMQQTQKNKHVFLINNYDLILSIIDNEESKHTKIYAIVHELEQKSIDDFVEEMLEPHIGYMIKFVNECESLIVQG-HTQLLVRYNDKVGTVVANFNAKWRPAVDSINSECIQLFTNFSLGTTILQTIFTKYVQYINRFTKILSHDVFAKNPVCSQLVNVHQVMLEIKRFKPAY 702          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. TrEMBL
Match: A0A1S3JRM5 (vacuolar protein sorting-associated protein 52 homolog isoform X1 OS=Lingula unguis OX=7574 GN=LOC106175268 PE=4 SV=1)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 368/739 (49.80%), Postives = 498/739 (67.39%), Query Frame = 2
Query:  152 FDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
             D+ S+D L++EV  HIQ NL+D+IVREALK+GVDLR+YS+ V+ EL+ VEN SI+DY+K    +  LH QIT+ D+IL+ ME++L +F  DL SIS++IQ+LQ +S+ M+  L+NRQ VRGEL QF+ EMVVPE MINHILD+PVTER FLEQLHEL+HK+ FVKEQSFK+S+S  DV DILE+LKIKAI KIRE+LLQKIY F+KPMTN+QVPQ+ MLK+RFF EFLLAN+R +A E+  EY+D  SKI+YSYFK Y ++L KLQF++ ADK+D +G ED         T+   F  S  +  LKN+ST+F++  R ++L  + LEAPII+PH   A QKSD K      +T+E+LFRSQHYALLD CCREYLF+ DFF++S  A QD FN VMGKT++ F KQ++     CFD+I I +CI I+  ++    +R V ALD YW  LL +LWPR+ +++  ++ SV+    +R        ID RP+ + R+YAEF AA+  +       + +     VN L                          L  +Q E+E  ++R+      RKE+LIF INN D++LSV+ E    D  E   FK+L+  +  EFVEE+L P+FG L++F+KE E    K   +E   ++E +VQ+I++GFN +WK +IE  N + + SF+NF  GTQI Q  L+QLIQYY R    M+  P+K+M +++ELINIHH+MVE+KK KP F
Sbjct:   24 LDLTSEDFLLDEVDFHIQQNLEDDIVREALKTGVDLRQYSKQVEQELLEVENASIQDYIKESQNIASLHTQITACDSILETMEQMLQSFQTDLSSISSEIQTLQEQSIAMNIKLKNRQAVRGELSQFVDEMVVPESMINHILDSPVTEREFLEQLHELNHKINFVKEQSFKESRSCMDVKDILEKLKIKAIAKIREFLLQKIYQFKKPMTNYQVPQNAMLKFRFFYEFLLANERHVAKEVRDEYLDIMSKIYYSYFKGYSSRLMKLQFEEVADKDDLMGAED---------TAKKGFFSSKPA--LKNRSTIFTVGNRGAVL-TSELEAPIIVPH---AAQKSDKK------YTFESLFRSQHYALLDNCCREYLFIVDFFMVSGSAAQDLFNAVMGKTMSSFLKQMDLFTNECFDSIAIFLCIHIIYRFQVAMHKRSVPALDKYWETLLEILWPRFEQILHMNIQSVKDCDPSRLG-----PIDTRPHYIVRRYAEFSAAIVGL-------NESFPSEKVNRL--------------------------LALLQGEVENFVLRMAAEFSARKEQLIFLINNYDMMLSVIMERTHEDSKESESFKELLAARTQEFVEEILAPHFGGLMSFVKECEVQLEKG-NTEQLKHQERRVQQIVRGFNSEWKKAIELTNQDAMRSFTNFKNGTQILQGALTQLIQYYHRFTKIMSQAPFKSMAIRSELINIHHVMVEVKKHKPTF 702          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. TrEMBL
Match: K1QC55 (Vacuolar protein sorting-associated protein 52-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10009841 PE=4 SV=1)

HSP 1 Score: 702.205 bits (1811), Expect = 0.000e+0
Identity = 367/760 (48.29%), Postives = 498/760 (65.53%), Query Frame = 2
Query:  134 NDSFDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKA--------------IMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVN-SLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
            N +    D+ S+D  ++EV +HIQ NL+DE+V++ALK G DLR Y++ V+ EL+ VEN SI+DY+K    +  LHKQI + D IL+RMEE+L  F  DL SIS++IQ+LQ +S+ M+  L+NRQ VRGEL QF+ EMV+PE MINHILDTPVTER FLEQLHEL+HK+ FVKEQSFKD++S HDV DILE+LKIKA              I KIRE+L+QKIY+FRKPM+N+QVPQ+ MLK+RFFNEFL+AN+R +A EI  EY+DT SKI+YSYFK Y+ +L KLQF++ ADK+D +G ED         T+   F  S  +  LKN+STVF+L  R  +L    LE PII+PH   A QKSD      TKF +E+LFRS HYAL+D CCREYLFL DF++ S  A QD FN +M KTL  + K +E  ++ C+D+I I + I IV  ++++  +R V ALD YW  LL ++WPR+  ++  ++ SVR     +  +     ID RP+ +TR+YAEF AA+                  +N S P                  D +V   L ++Q E+E  ++++    P RKE+LIF INN D++L VL E    +  E   FK+L+  +  EF+EEVL P+FG +I+F+K+ E+   +       P+E  +VQ I++GFN DWK ++E IN +++ +F+NF  GTQI Q  L+QLIQYY R Q  +   PYKNM ++NELINIHH+MVE+KK+KP F
Sbjct:   11 NLNLGELDLTSEDFWLDEVDEHIQKNLEDEVVQDALKKGTDLRTYAKEVERELLDVENASIQDYIKESGNIASLHKQIAACDTILERMEEMLNGFQGDLSSISSEIQTLQEQSVSMNIKLKNRQAVRGELSQFVDEMVIPEHMINHILDTPVTEREFLEQLHELNHKINFVKEQSFKDARSCHDVKDILEKLKIKAKYIFLKLCVLIYLAISKIREFLMQKIYSFRKPMSNYQVPQNAMLKFRFFNEFLMANERHVAREIRDEYLDTMSKIYYSYFKGYLGRLMKLQFEEVADKDDLMGVED---------TAKKSFFSSKPA--LKNRSTVFTLGNRGEVL-TARLEEPIIVPH---AQQKSD------TKFNFESLFRSLHYALMDNCCREYLFLVDFYMASGTASQDLFNAIMSKTLQTYLKTMEEHVSECYDSIAIFLSIHIVHRFRNIMHKRAVPALDRYWDTLLGIMWPRFETILHLNIQSVRDVDPQKFGH-----IDNRPHYITRRYAEFSAAI----------------VGINQSFP------------------DDRVHHLLEQLQTEVENFILKMAAEFPLRKEQLIFLINNYDMMLGVLLERTAEESKESESFKELLTARTQEFIEEVLSPHFGGMISFVKDCENTIERAGVEALRPDER-RVQSIVRGFNNDWKRALELINGDVMRAFTNFKNGTQILQGALTQLIQYYHRFQKVLGQGPYKNMQIRNELINIHHVMVEVKKYKPTF 709          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. TrEMBL
Match: R7TK94 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_183678 PE=4 SV=1)

HSP 1 Score: 687.182 bits (1772), Expect = 0.000e+0
Identity = 362/739 (48.99%), Postives = 496/739 (67.12%), Query Frame = 2
Query:  152 FDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
             D+ S++ L++EV  +IQANL+DEIV+EALK+GVDLR+YS+ V+++L+ VEN SI+DY+K    +  LHKQI S D +L+RME++L  F +DL SIS +IQSLQ++S  M+  L+NRQ VRGEL QF+ EMVVP  MI+ IL++ VT+R F+EQLH+L+HK+ FVKEQSFKD+KS  DV DILE+LKIKAI KIRE+LLQKIY F+KPMTN+Q+PQ+ MLKYRFFNEFL+ ++R IA EI  EYVDTTSKI++SYFK+Y ++L KLQFD+ ADKED +G E     +R+        + +     LKN+ST+F++  R +IL  N LEAPII+PH   A QKSD K      +T+E LFRS HYALLD CCREYLFLCDFF++S    QD F  +MGK++++F KQ+E +I   FD+I + +CI +V  YK L  +R   AL+ YW  +L +L PR+  ++  ++ S+R    +R        ID RP+ +TR+YAEF AA+   L     N  T      N L                          L  +Q E E  ++R+    P+RKE+LIF INN D++LSV+ E    D  E   FK+L+  +  EF+EE+L P+FG ++ F+KE E  + +  + +   N+E ++ +I++GFN DWK +IE  N E + SF+NF  GTQI Q  L+QLIQYY R Q  ++  P+KNM V++ELINIH++MVE+KK KP F
Sbjct:   11 LDLTSEEYLLDEVDVYIQANLEDEIVKEALKTGVDLRQYSKNVETDLLDVENASIQDYIKESQNIASLHKQIASCDTVLERMEDMLKGFQQDLSSISQEIQSLQSQSFAMNLRLRNRQAVRGELSQFVDEMVVPTSMISLILESQVTDRGFVEQLHDLNHKINFVKEQSFKDAKSCFDVKDILEKLKIKAIEKIREFLLQKIYQFKKPMTNYQIPQNAMLKYRFFNEFLMTHERGIAREIKDEYVDTTSKIYFSYFKSYHSRLMKLQFDEVADKEDLMGSEGIA--KRD--------ILAFFKPALKNRSTIFTVGNRGNIL-TNELEAPIIVPH---AAQKSDKK------YTFEELFRSLHYALLDNCCREYLFLCDFFMVSGPGAQDLFMLIMGKSISMFMKQMEAAINESFDSIALFLCIHVVHRYKVLMLKRNAPALEKYWETMLEMLQPRFEGILQLNIQSIRDCDPSRLG-----VIDVRPHYITRRYAEFTAAI-VGLNENFPNERT------NRL--------------------------LATLQTETENFVLRIAAEFPHRKEQLIFLINNYDMMLSVIMERTTDDSKESEGFKELLAARTQEFIEEILTPHFGGMMMFVKEAEVLQERG-QLDILKNQERRIVQIVRGFNSDWKHAIEMTNQETMRSFTNFKNGTQILQGALTQLIQYYHRFQKILSQSPFKNMAVRSELINIHNVMVEVKKHKPTF 690          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. TrEMBL
Match: C3Y4K0 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_97676 PE=4 SV=1)

HSP 1 Score: 682.945 bits (1761), Expect = 0.000e+0
Identity = 358/756 (47.35%), Postives = 498/756 (65.87%), Query Frame = 2
Query:  131 SNDSFDN---------FDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVN-SLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
            S D+ DN          D+ SD+ +++EV  HIQ NL+DE+V+EALK+GVDLR YS  V+ EL  VEN SI+DY+K    +  LH QIT+ D+IL+RME++L  F  DL SIS++IQSLQ +SL M+  L+NRQ VRGEL QF+ E+VVPE M+N ILD PVT+R FLEQLHEL+HK+ FVKEQSFK++ +  DV DILE+LK+KAI KIRE+LLQKIY FRKPMTN+QVPQ+ MLK+RFF EFLLAN+R +A E   EY+DT SK++YSYFK Y ++L KLQ+++ ADK+D +G ED        +     F + S    LKN+ST+F+L  R +I+  + LEAPII+PH   A QKS+      T++++E+LFRSQH+AL+D  C EYLF  +FF++     QD FN V GKTL++F K ++   + CFDAI I +CI I+  Y+ L  +R V ALD YW  LL +LWPR+  ++D ++ S+R     +  +     ID RP+ +TR+YAEF +AL                 S+N + P                  D +V   L ++Q E+E  ++R+    P RKE+L+F INN D++L VL E    +  E   F+ L+  +  EFVEE+L P+FG +I F+KETE    +  +++   N++A++ K+++GF ++WK +I+ IN E++ SF+NF  GTQI Q  L+QLIQYY R Q  ++  P+K + V+ ELINIHH+MVE+KK KP F
Sbjct:   34 SGDNLDNELVELNLGELDLTSDEFILDEVDTHIQENLEDELVKEALKTGVDLRHYSRQVEKELQQVENASIQDYIKEAHNIASLHNQITACDSILERMEQMLSGFQTDLSSISSEIQSLQDQSLSMNIKLKNRQAVRGELSQFVDELVVPEVMVNAILDAPVTQRQFLEQLHELNHKINFVKEQSFKEAVACRDVQDILEKLKLKAITKIREFLLQKIYQFRKPMTNYQVPQNAMLKFRFFYEFLLANERHVAKECRDEYIDTMSKMYYSYFKGYTSRLMKLQYEEVADKDDLMGVED--------TAKKGFFSKPS----LKNRSTIFTLGNRGNII-TSELEAPIIVPH---AAQKSE------TRYSFESLFRSQHFALVDNACCEYLFSVEFFLVQGSPAQDLFNAVFGKTLSMFLKHMDVYTSDCFDAIAIYLCIHIIYRYQVLMHKRIVPALDKYWETLLEVLWPRFSYILDLNIQSIRDCDPQKLGS-----IDVRPHYITRRYAEFSSAL----------------ISLNQTFP------------------DERVDQLLAQLQAEVENFILRMAAEFPLRKEQLVFLINNYDMMLGVLMERTSEESKETESFQQLLQARTQEFVEEILAPHFGGMIAFVKETEGLLERG-QTDQVKNQDARITKLVRGFAVNWKQAIDVINQEVMRSFTNFKNGTQILQVTLTQLIQYYHRFQKVLSQAPFKGLQVRGELINIHHVMVEVKKNKPTF 727          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. TrEMBL
Match: A7RMV5 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g87088 PE=4 SV=1)

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 354/735 (48.16%), Postives = 489/735 (66.53%), Query Frame = 2
Query:  167 DDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVN-SLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
            D+ +++EV  HIQ NL+DE+VREALK+GVDLR+YS+ ++ EL  VEN SI DY+K    +  LH QI S D IL+RME++L +F +DLGSIS++IQ+LQ +SL M+  L+NRQ +RGEL QF+ EM+V + MI HI DTPVTE+ F+EQLHEL HK+ FVKEQSFK + S +DV DILE  K+KA+ KIR+Y+LQKIY FR+P TN+QVPQ+ +LKYR+FNEFLLA+ R +A E+  EYVDT SKI++SYFK+Y+ KL KLQ+++ AD++D +G ED       N+  G  F  S     LKN+ST+F+L  R +++  + LE PII+PHT    +K         K+++E+LFRS H+ALLD  CREYLFL DFF+++  A +D F QV+GKTL++F KQ+++ I   +DAIG+ +CI I+  Y+ L  +R V ALD YW  LL + WPR+  +++ ++ SVR    T P    +  ID RP+ +TR+YAEF AA+                 S+N S P                  D +V   L  +Q E+E  ++R+    P RKE+L+F INN D++L+VL E    D  E   F+ L+  +I EFVEEVL P FG +I F+KETE    +       P+E  ++Q++++GF  DWK S+E IN EI+ SFSNF  GT I QA L+QLIQYY R Q  ++  P+K +P+++ELINIHH+MVE+KK K  F
Sbjct:   15 DEFILDEVDVHIQENLEDELVREALKAGVDLRQYSKQIEGELHEVENASINDYIKESKNIASLHNQIASCDTILERMEKMLTSFQEDLGSISSEIQTLQEQSLSMNIKLKNRQAIRGELSQFVDEMMVTDSMIKHICDTPVTEQSFIEQLHELHHKIDFVKEQSFKGALSCNDVGDILE--KLKAVQKIRDYILQKIYLFRRPNTNYQVPQNALLKYRYFNEFLLAHHRQVAREVKDEYVDTMSKIYFSYFKSYMAKLMKLQYEEVADRDDLIGVED-------NARKG--FFTS--RPMLKNRSTIFTLGNRGNVI-TSELEEPIIVPHTAQKMEK---------KYSFESLFRSLHFALLDNSCREYLFLVDFFMVTGNAAKDVFTQVLGKTLSLFLKQMDSYIENSYDAIGLFLCIHIIHRYRILMHKRSVPALDKYWDTLLEMFWPRFTIIVEMNIDSVR---TTDPQKLGH--IDVRPHYITRRYAEFSAAI----------------VSLNESFP------------------DEKVNKVLASLQCEVENFILRMAAEFPLRKEQLVFLINNYDMMLAVLMERTSEDSKEVEGFQQLLTARIGEFVEEVLSPAFGGMIAFVKETEPQLERGQGQAIRPDER-RIQQLVRGFAADWKKSVENINQEIMRSFSNFKNGTTILQAALTQLIQYYHRFQKILSQHPFKRLPIRSELINIHHVMVEVKKHKTTF 686          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000008133.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000407.1:136723:166005:-1 gene:ENSAMXG00000007894.2 transcript:ENSAMXT00000008133.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 511.146 bits (1315), Expect = 6.469e-172
Identity = 286/734 (38.96%), Postives = 440/734 (59.95%), Query Frame = 2
Query:  173 ILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRM-HQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQI-DFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
            IL E    HIQANL+DE+V+EALK+GVDLR+YS+ V++EL  +E  SI+D                               F  DL SIS++IQ+LQ    +  HQ  +      G L                ILD+PVTE+ FLEQLHEL++K+ F KE SF+++ +  D+ DI+++LKIKA+ KIRE++LQKIY+FRKPMTN+Q+PQ+ +LKYRFF +FLLAN+R +A EI  EYVDT SKI++ YFK+Y ++L K+Q++  ADK+D +G ED  + +++   SG  F + SL    K+++T+F+L QR ++L    LE P   P      Q+    +    +F YETLFRSQHYALLD  CRE+LFL DFF ++  +      Q  G+ L++F K +   ++ C+D+I + +CI I+L +K +  +R + ALD YW  +L +LWPR+  +++ ++ S+R       ++ Q + + D RP+ +TR+YAEF +A+ +I       + T      N+L                          L + Q+E+E  ++++    P+RK++LIF INN D++L VL E    D  E   F+ L+  +  EF+EE+L P FG +I F+KE+E+   K  + +   N+E ++ ++++GF+  WK S+E ++ +++ SF+NF  GT I Q  L+QLIQYY      ++   ++++ V++ELIN+HH+MVE+KK KPNF
Sbjct:    3 ILDEWTVIHIQANLEDELVQEALKTGVDLRQYSKQVEAELQRIEQASIKD-----------------------------LGFRVDLSSISSEIQTLQQAVGQYEHQAEEQA----GRLV---------------ILDSPVTEQEFLEQLHELNNKINFAKELSFRETLACSDIQDIVDRLKIKAVSKIREFILQKIYSFRKPMTNYQIPQNTLLKYRFFYQFLLANERTVAKEIRDEYVDTMSKIYFCYFKSYSSRLLKVQYEDVADKDDLMGVED--TAKKDILPSG-FFSKPSL----KSRNTIFTLGQRGAVLSPAELEVPSFHP---TRRQRDFVCVCVCVQFPYETLFRSQHYALLDNGCREFLFLSDFFHVAGNSAPGSVQQCDGEDLSMFLKNMSAYVSDCYDSIAVFLCIHIILRFKAITAKRNIPALDKYWEAVLEMLWPRFELILEMNIQSIRN------TDPQKLGVLDTRPHYITRRYAEFSSAIVSI-------NQTFPNERTNAL--------------------------LGQFQIEVENFVLKMAAEFPSRKDQLIFLINNYDMMLGVLMERAADDSKEVEGFQQLLLARTQEFIEEILAPPFGGMITFVKESEALMEKG-QLDKLKNDEVRITQLVRGFSSSWKQSVEALSQDVMRSFTNFKNGTSIIQGALTQLIQYYHGFHKILSQPTFRSLAVRSELINLHHLMVEVKKHKPNF 638          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Cavefish
Match: vps52 (VPS52 subunit of GARP complex [Source:ZFIN;Acc:ZDB-GENE-010430-2])

HSP 1 Score: 298.901 bits (764), Expect = 4.027e-92
Identity = 209/658 (31.76%), Postives = 320/658 (48.63%), Query Frame = 2
Query:  152 FDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQI-DFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETES-------NKNKNPKSEYTPNE 2101
             DI +D+ +++EV  HIQANL+DE+V+EALK+GVDLR+                                           MEE+L  F  DL SIS++IQ+LQ +S+ M+  L+NRQ VR +L Q + E+VVP  MI+++   P+   H       L                           +++ A+ KIRE++L +I       +N+ +   +     FF +FLLAN+R +A EI  EYVDT SKI++ YFK+Y ++L K+Q  +N    D +G ED          +    + S L  N     T+F+L QR ++L    LE PI++P                  F YETLFRSQHYALLD  CRE+LFL DFF+++  +  D FN VMGKTL++F K +   ++ C+D+I + +CI I+L +K +  +R + ALD YW ++L +LWPR+  +++ ++ S+R       ++ Q + + D RP+ +T +Y   C  L  I+       N  +   V +L    G                                        P+RK++LIF INN         E    D  E   F+ L+  +  EF+EE+L P FG +I F+KE+E+       +K KN + ++  N+
Sbjct:    1 LDITTDEFILDEVDIHIQANLEDELVQEALKTGVDLRQ-------------------------------------------MEEMLSGFQSDLSSISSEIQTLQQQSVSMNIRLKNRQAVRSQLSQLVDELVVPSTMISYV---PLVLLHLYPLFAYL---------------------------IRLIAVSKIREFILYRI------KSNYFISNIL-----FFYQFLLANERTVAKEIRDEYVDTMSKIYFCYFKSYSSRLLKVQV-RNV-LGDLMGVED----------TAKKDIHSWLYRN-----TIFTLGQRGAVLSPAELEGPILIPRR---------------PFPYETLFRSQHYALLDNGCREFLFLSDFFMVAGNSALDLFNSVMGKTLSMFLKNMSAYVSDCYDSIAVFLCIHIILRFKAITAKRNIPALDKYWEVVLEMLWPRFELILEMNIQSIRN------TDPQKLGVLDTRPHYITGRY---CLNLLRIVSINQTFPNERTNIEVENLRAEDGG------------------------------------SEFPSRKDQLIFLINN---------ERAADDSKEVEGFQQLLLARTQEFIEEILAPPFGGMITFVKESEALMEKGQLDKLKNDEGKFPINQ 488          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Cavefish
Match: vps52 (VPS52 subunit of GARP complex [Source:ZFIN;Acc:ZDB-GENE-010430-2])

HSP 1 Score: 290.812 bits (743), Expect = 1.159e-88
Identity = 178/493 (36.11%), Postives = 278/493 (56.39%), Query Frame = 2
Query:  149 NFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQI-DFRPYSV 1624
            + DI +D+ +++EV  HIQANL+DE+V+EALK+GVDLR+                                           MEE+L  F  DL SIS++IQ+LQ +S+ M+  L+NRQ VR +L Q + E+VVP  MI+++   P+    F+       +K+ F KE SF+++ +  D+ DI+++LKIKA+ KIRE++L +I       +N+ +   +     FF +FLLAN+R +A EI  EYVDT SKI++ YFK+Y ++L K+Q  +N    D +G ED          +    + S L  N     T+F+L QR ++L                 + + DS+      F YETLFRSQHYALLD  CRE+LFL DFF+++  +  D FN VMGKTL++F K +   ++ C+D+I + +CI I+L +K +  +R + ALD YW ++L +LWPR+  +++ ++ S+R       ++ Q + + D RP+ +
Sbjct:   45 DLDITTDEFILDEVDIHIQANLEDELVQEALKTGVDLRQ-------------------------------------------MEEMLSGFQSDLSSISSEIQTLQQQSVSMNIRLKNRQAVRSQLSQLVDELVVPSTMISYV---PLVLLSFMNS----TNKINFAKELSFRETLACSDIQDIVDRLKIKAVSKIREFILYRI------KSNYFISNIL-----FFYQFLLANERTVAKEIRDEYVDTMSKIYFCYFKSYSSRLLKVQV-RNV-LGDLMGVED----------TAKKDIHSWLYRN-----TIFTLGQRGAVL-----------------SPRGDSR------FPYETLFRSQHYALLDNGCREFLFLSDFFMVAGNSALDLFNSVMGKTLSMFLKNMSAYVSDCYDSIAVFLCIHIILRFKAITAKRNIPALDKYWEVVLEMLWPRFELILEMNIQSIRN------TDPQKLGVLDTRPHYI 430          

HSP 2 Score: 51.9878 bits (123), Expect = 2.433e-6
Identity = 31/88 (35.23%), Postives = 48/88 (54.55%), Query Frame = 2
Query: 1859 PNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETES-------NKNKNPKSEYTPNE 2101
            P+RK++LIF INN         E    D  E   F+ L+  +  EF+EE+L P FG +I F+KE+E+       +K KN + ++  N+
Sbjct:  445 PSRKDQLIFLINN---------ERAADDSKEVEGFQQLLLARTQEFIEEILAPPFGGMITFVKESEALMEKGQLDKLKNDEGKFPINQ 523          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000036953.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000336.1:41392:78407:-1 gene:ENSAMXG00000037165.1 transcript:ENSAMXT00000036953.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 248.44 bits (633), Expect = 3.849e-72
Identity = 167/473 (35.31%), Postives = 245/473 (51.80%), Query Frame = 2
Query:  158 ILSDDILIEE-VGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHF-LEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWP-------RWFELMDTHVS 1549
            I +D+ +++E    HIQANL+DE+V+EALK+GVDLR+YS+ V++EL  +E  SI+DY+K    +  LH QIT+ D+IL+   +     H DL  +S  +    +  L M  CL                              PVT R F         +K+ F KE SF+   + +    ++    ++A+ KIRE++LQKIY+FRKPMTN+Q+PQ+ +LKYRFF +FLLAN+R +A EI  EYVDT SKI++ YFK+Y ++L K+Q                      N  +G  F + S    LK+++T+F+L QR ++L    LE PI+  HT  A       +G             QH  LLD  CRE+LFL DFF ++  +      Q  G+   +F K +   ++ C+D+I     I I+L +K + T RG F    YW     +LWP       R   ++DT  S
Sbjct:    1 ITTDEFILDEWTVIHIQANLEDELVQEALKTGVDLRQYSKQVEAELQRIEQASIKDYIKESQNIASLHNQITACDSILEVSSD---QSHADLSCLSVSLSIYLSIPLSM--CLSGDS------------------------GRPVTSRSFSWSSFMNSTNKINFAKELSFRRRSALYFNLLLIYVFDLQAVSKIREFILQKIYSFRKPMTNYQIPQNTLLKYRFFYQFLLANERTVAKEIRDEYVDTMSKIYFCYFKSYSSRLLKVQV--------------------RNVLAG-FFSKPS----LKSRNTIFTLGQRGAVLSPAELEGPILSSHTPPA-------VG-------------QHSLLLDNGCREFLFLSDFFHVAGNSAPGSVQQCDGEDPQMFLKNMSAYVSDCYDSILCSSDIHIILRFKAI-TARGTFP-RPYWEWCFEMLWPTSETPTLRKLGVLDTRTS 397          

HSP 2 Score: 162.925 bits (411), Expect = 6.778e-42
Identity = 75/189 (39.68%), Postives = 126/189 (66.67%), Query Frame = 2
Query: 1802 LMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
            L ++Q+E+E  ++++    P+RK++LIF INN D++L VL E    D  E   F+ L+  +  EF+EE+L P FG +I F+KE+E+   K  + +   N+E ++ ++++GF+  WK S+E ++ +++ SF+NF  GT I Q  L+QLIQYY      ++   ++++ V++ELIN+HH+MVE+KK KPNF
Sbjct:  413 LGQLQIEVENFVLKMAAEFPSRKDQLIFLINNYDMMLGVLMERAADDSKEVEGFQQLLLARTQEFIEEILAPPFGGMITFVKESEALMEKG-QLDKLKNDEVRITQLVRGFSSSWKQSVEALSQDVMRSFTNFKNGTSIIQGALTQLIQYYHGFHKILSQPTFRSLAVRSELINLHHLMVEVKKHKPNF 600          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Cavefish
Match: vps52 (VPS52 subunit of GARP complex [Source:ZFIN;Acc:ZDB-GENE-010430-2])

HSP 1 Score: 97.4413 bits (241), Expect = 6.833e-23
Identity = 61/177 (34.46%), Postives = 93/177 (52.54%), Query Frame = 2
Query:  191 GDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKA 721
             D + ANL+DE+V+EALK+GVDLR+                                           MEE+L  F  DL SIS++IQ+LQ +S+ M+  L+NRQ VR +L Q + E+VVP  MI+++   P+    F+       +K+ F KE SF+++ +  D+ DI+++LKIK 
Sbjct:    5 SDLVPANLEDELVQEALKTGVDLRQ-------------------------------------------MEEMLSGFQSDLSSISSEIQTLQQQSVSMNIRLKNRQAVRSQLSQLVDELVVPSTMISYV---PLVLLSFMNS----TNKINFAKELSFRETLACSDIQDIVDRLKIKG 131          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Yeast
Match: VPS52 (Component of the GARP (Golgi-associated retrograde protein) complex; GARP is required for the recycling of proteins from endosomes to the late Golgi, and for mitosis after DNA damage induced checkpoint arrest; involved in localization of actin and chitin; members of the GARP complex are Vps51p-Vps52p-Vps53p-Vps54p [Source:SGD;Acc:S000002892])

HSP 1 Score: 85.8853 bits (211), Expect = 9.430e-18
Identity = 109/471 (23.14%), Postives = 211/471 (44.80%), Query Frame = 2
Query:  383 ILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTER-----HFLEQLHELDHKLKFVK-EQSFKDSKSA--------HDVSDILEQLKIKAIMKIREYLLQKIYAFR--KPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGK----EDFNSFRRNNSTSGSIFLQSSLSANLKNKSTV--------FSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETS-------IAACFDAIGILICIRIVLWYKDLCTERGVFAL-DNYWGXXXXXXWPRWFELMDTHVSSVRQHAATR-------PSNSQNIQIDFRPYSVTRKYAEFCAALHTI 1666
            I+ ++ + L  F   L + + D+  ++ KS  +   L+        +   + ++++P ++I+ I+   + E       F+    E+ +K +    +Q  KD++++          +  +L+ LK   + + +  ++ KI   R   P+ + ++ Q+ +LK +    F+  N+ ++A E+ + Y  T    +  YF  YI  L  LQF +  D +  LG        + F  + S   S +L +S S    NK  V        F + +R +IL            +TV+ +Q ++    + TK   E  F++ + A+LD C  EY FL DFF ++     D F ++ G    IFQ   + +       I   +D  G+LI IR+    +     RG+ ++ D++    L  LWPR+ +L+D    S+R+ A T         S++ N      P+ +T ++ +F ++  T+
Sbjct:   73 IIPQLIDYLTEFTNRLSNYTQDLDFIKKKSNELQSLLEYNSTKLAHISPMVNDLMIPPELIDDIIKGKINESWQDNITFIADKEEIYNKYRSNNLDQDNKDAENSAMLAPKDFDKLCQLLDILKNVILERSKRLIISKIKTLRSHNPVPSQRI-QNKLLKVQKIFPFIRDNNLSLALELRQAYCYTMKWYYREYFSRYIRSLTILQFQQ-IDSQFALGNGLSTTSVSGFNNSPSLFFSNYLTTSASNAFYNKLPVTDEKIDKYFQIKKRLNILTQED--------NTVMVSQIAE---NNTTKNYIEIGFKNLNLAILDNCTVEYHFLKDFFAMNG----DNFEEINGLLEQIFQPTFDEATTYTQQLIQYNYDIFGVLISIRVANQLQFESERRGIPSMFDSFLNGQLIQLWPRFQQLVDFQCESLRKAAITTNVAKYAGNSSTSNSSPLTSPHELTVQFGKFLSSFLTL 526          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Nematostella
Match: EDO47167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMV5])

HSP 1 Score: 672.159 bits (1733), Expect = 0.000e+0
Identity = 354/735 (48.16%), Postives = 489/735 (66.53%), Query Frame = 2
Query:  167 DDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVN-SLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
            D+ +++EV  HIQ NL+DE+VREALK+GVDLR+YS+ ++ EL  VEN SI DY+K    +  LH QI S D IL+RME++L +F +DLGSIS++IQ+LQ +SL M+  L+NRQ +RGEL QF+ EM+V + MI HI DTPVTE+ F+EQLHEL HK+ FVKEQSFK + S +DV DILE  K+KA+ KIR+Y+LQKIY FR+P TN+QVPQ+ +LKYR+FNEFLLA+ R +A E+  EYVDT SKI++SYFK+Y+ KL KLQ+++ AD++D +G ED       N+  G  F  S     LKN+ST+F+L  R +++  + LE PII+PHT    +K         K+++E+LFRS H+ALLD  CREYLFL DFF+++  A +D F QV+GKTL++F KQ+++ I   +DAIG+ +CI I+  Y+ L  +R V ALD YW  LL + WPR+  +++ ++ SVR    T P    +  ID RP+ +TR+YAEF AA+                 S+N S P                  D +V   L  +Q E+E  ++R+    P RKE+L+F INN D++L+VL E    D  E   F+ L+  +I EFVEEVL P FG +I F+KETE    +       P+E  ++Q++++GF  DWK S+E IN EI+ SFSNF  GT I QA L+QLIQYY R Q  ++  P+K +P+++ELINIHH+MVE+KK K  F
Sbjct:   15 DEFILDEVDVHIQENLEDELVREALKAGVDLRQYSKQIEGELHEVENASINDYIKESKNIASLHNQIASCDTILERMEKMLTSFQEDLGSISSEIQTLQEQSLSMNIKLKNRQAIRGELSQFVDEMMVTDSMIKHICDTPVTEQSFIEQLHELHHKIDFVKEQSFKGALSCNDVGDILE--KLKAVQKIRDYILQKIYLFRRPNTNYQVPQNALLKYRYFNEFLLAHHRQVAREVKDEYVDTMSKIYFSYFKSYMAKLMKLQYEEVADRDDLIGVED-------NARKG--FFTS--RPMLKNRSTIFTLGNRGNVI-TSELEEPIIVPHTAQKMEK---------KYSFESLFRSLHFALLDNSCREYLFLVDFFMVTGNAAKDVFTQVLGKTLSLFLKQMDSYIENSYDAIGLFLCIHIIHRYRILMHKRSVPALDKYWDTLLEMFWPRFTIIVEMNIDSVR---TTDPQKLGH--IDVRPHYITRRYAEFSAAI----------------VSLNESFP------------------DEKVNKVLASLQCEVENFILRMAAEFPLRKEQLVFLINNYDMMLAVLMERTSEDSKEVEGFQQLLTARIGEFVEEVLSPAFGGMIAFVKETEPQLERGQGQAIRPDER-RIQQLVRGFAADWKKSVENINQEIMRSFSNFKNGTTILQAALTQLIQYYHRFQKILSQHPFKRLPIRSELINIHHVMVEVKKHKTTF 686          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Medaka
Match: vps52 (VPS52 subunit of GARP complex [Source:NCBI gene;Acc:101165569])

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 329/739 (44.52%), Postives = 491/739 (66.44%), Query Frame = 2
Query:  152 FDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
             D+ +D+ +++EV  HIQANL+D++V+EALK+GVDLR+YS+ V++EL  +E  SI+DY+K    +  LH QIT+ D+IL+RME +L  F  DL SIS++IQ+LQ +S+ M+  L+NRQ VR  L Q + E+VVP  MI+ ILD+PVTE+ FLEQLHEL+ K+ F KE SF+++ +  D+ DI+++LKIKA+ KIRE++LQKIY+FRKPMTN+Q+PQ+ +LKYRFF +FLLAN+R +A E+  EYVDT SKI+YSYFK+Y  +L K+Q+++ ADK+D +G ED        +     F + SL    K+++T+F++ QR +IL    LE PI++PHT    Q+ DS+      + YETLFRSQHYALLD  CRE+LFLCDFF+++  +  D FN +MGKTL++F K + T ++ C+D+I I +CI I+L ++ +  +R + ALD YW  LL LLWPR+  +++ ++ SVR     R        +D RP+ +TR+YAEF +A+ +I       + T      N+L                          L ++ VE+E  ++++    P+RK++LIF INN D++LSVL E    D  E   F+ L+  +  EF+EE+L P FG +I F+KE E+   K  + +   NEEA++ ++++GF+  WK S+E ++ +++ SF+NF  GT I Q  L+QLIQYY      +N   ++++ V++ELIN+HH+MVE+KK KPNF
Sbjct:   46 LDLTTDEFILDEVDVHIQANLEDDLVKEALKTGVDLRQYSKQVETELQRIEQASIKDYIKESQNIALLHNQITACDSILERMEGMLSGFQSDLSSISSEIQTLQQQSVSMNIRLKNRQAVRSHLSQLVDELVVPGAMISTILDSPVTEQEFLEQLHELNSKINFAKELSFRETLACSDIQDIVDRLKIKAVSKIREFILQKIYSFRKPMTNYQIPQNTLLKYRFFYQFLLANERTVAKEVRDEYVDTMSKIYYSYFKSYSGRLLKVQYEEVADKDDLMGVED--------TAKKGFFSKPSL----KSRNTIFTVGQRGAILSPAELEGPILVPHTA---QRGDSR------YPYETLFRSQHYALLDNGCREFLFLCDFFMVAGNSALDLFNSIMGKTLSMFLKSMSTYVSDCYDSIAIFLCIHIILRFRAITAKRNIPALDKYWEALLELLWPRFELILEMNIHSVRNTDPGRLG-----VLDTRPHYITRRYAEFSSAIVSI-------NQTFPNERTNTL--------------------------LGQLLVEVENFVLKMAAEFPSRKDQLIFLINNYDMMLSVLMERAADDSKEVEGFQQLLLARTQEFIEEILSPPFGGMIAFVKEAEALMEKG-QLDRLKNEEARITQLVRGFSSTWKQSVESMSQDVMRSFTNFKNGTSIIQGALTQLIQYYHGFHKVLNQPTFRSLAVRSELINLHHLMVEVKKHKPNF 724          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Medaka
Match: vps52 (VPS52 subunit of GARP complex [Source:NCBI gene;Acc:101165569])

HSP 1 Score: 607.446 bits (1565), Expect = 0.000e+0
Identity = 312/710 (43.94%), Postives = 463/710 (65.21%), Query Frame = 2
Query:  239 LKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQAVLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF 2368
            L  GVDLR+YS+ V++EL  +E  SI+DY+K    +  LH QIT+ D+IL+RME +L  F  DL SIS++IQ+LQ +S+ M+  L+NRQ VR  L Q + E+VVP  MI+ ILD+PVTE+ FLEQLHEL+ K+ F KE SF+++ +  D+ DI+++LKIKA+ KIRE++LQKIY+FRKPMTN+Q+PQ+ +LKYRFF +FLLAN+R +A E+  EYVDT SKI+YSYFK+Y  +L K+Q+++ ADK+D +G ED        +    +F       +L  ++T+F++ QR +IL    LE PI++PHT    Q+ DS+      + YETLFRSQHYALLD  CRE+LFLCDFF+++  +  D FN +MGKTL++F K + T ++ C+D+I I +CI I+L ++ +  +R + ALD YW  LL LLWPR+  +++ ++ SVR     R        +D RP+ +TR+YAEF +A+ +I       + T      N+L                          L ++ VE+E  ++++    P+RK++LIF INN D++LSVL E    D  E   F+ L+  +  EF+EE+L P FG +I F+KE E+   K  + +   NEEA++ ++++GF+  WK S+E ++ +++ SF+NF  GT I Q  L+QLIQYY      +N   ++++ V++ELIN+HH+MVE+KK KPNF
Sbjct:   11 LDEGVDLRQYSKQVETELQRIEQASIKDYIKESQNIALLHNQITACDSILERMEGMLSGFQSDLSSISSEIQTLQQQSVSMNIRLKNRQAVRSHLSQLVDELVVPGAMISTILDSPVTEQEFLEQLHELNSKINFAKELSFRETLACSDIQDIVDRLKIKAVSKIREFILQKIYSFRKPMTNYQIPQNTLLKYRFFYQFLLANERTVAKEVRDEYVDTMSKIYYSYFKSYSGRLLKVQYEEVADKDDLMGVED-------TAKKDILF-------SLTFRNTIFTVGQRGAILSPAELEGPILVPHTA---QRGDSR------YPYETLFRSQHYALLDNGCREFLFLCDFFMVAGNSALDLFNSIMGKTLSMFLKSMSTYVSDCYDSIAIFLCIHIILRFRAITAKRNIPALDKYWEALLELLWPRFELILEMNIHSVRNTDPGRLG-----VLDTRPHYITRRYAEFSSAIVSI-------NQTFPNERTNTL--------------------------LGQLLVEVENFVLKMAAEFPSRKDQLIFLINNYDMMLSVLMERAADDSKEVEGFQQLLLARTQEFIEEILSPPFGGMIAFVKEAEALMEKG-QLDRLKNEEARITQLVRGFSSTWKQSVESMSQDVMRSFTNFKNGTSIIQGALTQLIQYYHGFHKVLNQPTFRSLAVRSELINLHHLMVEVKKHKPNF 658          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Planmine SMEST
Match: SMESG000066015.1 (SMESG000066015.1)

HSP 1 Score: 1369.37 bits (3543), Expect = 0.000e+0
Identity = 675/691 (97.68%), Postives = 675/691 (97.68%), Query Frame = 2
Query:  128 MSNDSFDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNF 2200
            MSNDSFDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAI ILICIRI L            ALDNYWGLLLNLLWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSF  F
Sbjct:    1 MSNDSFDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIAILICIRIFL------------ALDNYWGLLLNLLWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFFQF 679          

HSP 2 Score: 72.0182 bits (175), Expect = 1.238e-12
Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 1
Query: 2191 FQFLYRNSNIPGRSFSTDPILQAIASLYEYVAL 2289
            FQFLYRNSNIPGRSFSTDPILQAIASLYEYVAL
Sbjct:  677 FQFLYRNSNIPGRSFSTDPILQAIASLYEYVAL 709          
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Planmine SMEST
Match: SMESG000066015.1 (SMESG000066015.1)

HSP 1 Score: 1355.89 bits (3508), Expect = 0.000e+0
Identity = 669/691 (96.82%), Postives = 670/691 (96.96%), Query Frame = 2
Query:  128 MSNDSFDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFALDNYWGXXXXXXWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNF 2200
            MSNDSFDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAI ILI                  +LDNYWGLLLNLLWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSF  F
Sbjct:    1 MSNDSFDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEMVKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKDLGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHILDTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIMKIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISREYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNSTSGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQKSDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFFNQVMGKTLNIFQKQIETSIAACFDAIAILI------------------SLDNYWGLLLNLLWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVTRKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVNMDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTECEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNPKSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFFQF 673          

HSP 2 Score: 72.0182 bits (175), Expect = 1.091e-12
Identity = 33/33 (100.00%), Postives = 33/33 (100.00%), Query Frame = 1
Query: 2191 FQFLYRNSNIPGRSFSTDPILQAIASLYEYVAL 2289
            FQFLYRNSNIPGRSFSTDPILQAIASLYEYVAL
Sbjct:  671 FQFLYRNSNIPGRSFSTDPILQAIASLYEYVAL 703          
The following BLAST results are available for this feature:
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VPS520.000e+042.45VPS52 subunit of GARP complex [Source:HGNC Symbol;... [more]
VPS520.000e+042.45VPS52 subunit of GARP complex [Source:HGNC Symbol;... [more]
VPS520.000e+042.45VPS52 subunit of GARP complex [Source:HGNC Symbol;... [more]
VPS520.000e+042.45VPS52 subunit of GARP complex [Source:HGNC Symbol;... [more]
VPS520.000e+042.45VPS52 subunit of GARP complex [Source:HGNC Symbol;... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps-524.482e-13334.41Vacuolar protein sorting-associated protein 52 hom... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Vps520.000e+041.19gene:FBgn0031710 transcript:FBtr0079129[more]
back to top
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps520.000e+043.68VPS52 subunit of GARP complex [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
VPS520.000e+043.65VPS52, GARP complex subunit [Source:NCBI gene;Acc:... [more]
VPS520.000e+043.42VPS52, GARP complex subunit [Source:NCBI gene;Acc:... [more]
VPS520.000e+042.94VPS52, GARP complex subunit [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Vps520.000e+042.59VPS52 GARP complex subunit [Source:MGI Symbol;Acc:... [more]
Vps522.585e-13940.29VPS52 GARP complex subunit [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N1B4|VPS52_HUMAN0.000e+042.45Vacuolar protein sorting-associated protein 52 hom... [more]
sp|Q8C754|VPS52_MOUSE0.000e+042.59Vacuolar protein sorting-associated protein 52 hom... [more]
sp|O55166|VPS52_RAT0.000e+042.32Vacuolar protein sorting-associated protein 52 hom... [more]
sp|Q5TJF0|VPS52_CANLF0.000e+042.45Vacuolar protein sorting-associated protein 52 hom... [more]
sp|G5EFV8|VPS52_CAEEL5.701e-13234.41Vacuolar protein sorting-associated protein 52 hom... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JRM50.000e+049.80vacuolar protein sorting-associated protein 52 hom... [more]
K1QC550.000e+048.29Vacuolar protein sorting-associated protein 52-lik... [more]
R7TK940.000e+048.99Uncharacterized protein OS=Capitella teleta OX=283... [more]
C3Y4K00.000e+047.35Uncharacterized protein OS=Branchiostoma floridae ... [more]
A7RMV50.000e+048.16Predicted protein (Fragment) OS=Nematostella vecte... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000008133.26.469e-17238.96pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
vps524.027e-9231.76VPS52 subunit of GARP complex [Source:ZFIN;Acc:ZDB... [more]
vps521.159e-8836.11VPS52 subunit of GARP complex [Source:ZFIN;Acc:ZDB... [more]
ENSAMXT00000036953.13.849e-7235.31pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
vps526.833e-2334.46VPS52 subunit of GARP complex [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VPS529.430e-1823.14Component of the GARP (Golgi-associated retrograde... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO471670.000e+048.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vps520.000e+044.52VPS52 subunit of GARP complex [Source:NCBI gene;Ac... [more]
vps520.000e+043.94VPS52 subunit of GARP complex [Source:NCBI gene;Ac... [more]
back to top
BLAST of Vacuolar protein sorting-associated protein 52-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000066015.11.238e-1297.68SMESG000066015.1[more]
SMESG000066015.11.091e-1296.82SMESG000066015.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014331 ID=SMED30014331|Name=Vacuolar protein sorting-associated protein 52-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2443bp
ATCATTTGATATTTTAAATTATTTAATTTGAGAATATATTTCATTTATTT
TTGACTTTATTAACTATATAATTATCATTTCTTAACAAAAATAATTTTTA
TTATTAAAACTTTCAACATATTTTCAAATGTCGAATGATTCTTTTGATAA
TTTTGATATTTTATCCGATGATATTTTGATTGAAGAAGTTGGAGATCACA
TACAAGCAAATCTTCAAGATGAAATAGTTCGAGAAGCTTTGAAATCAGGT
GTTGATTTACGTGAATATTCAGAGATGGTTAAGTCAGAACTAATTACTGT
CGAGAATCAATCTATTGAAGATTACGTGAAATCTCGAGACAAAGTAATTG
AACTTCACAAACAAATTACATCATCTGATGCAATATTAAAAAGAATGGAA
GAAATTTTATTCAATTTCCACAAAGACCTTGGTTCAATTAGCACCGACAT
TCAGTCTCTGCAAACCAAATCGTTGCGCATGCACCAATGCTTACAGAATC
GGCAGATTGTACGCGGGGAATTATGCCAATTCATGGCGGAAATGGTGGTT
CCGGAACAAATGATCAACCATATTCTTGACACTCCAGTAACTGAGCGACA
TTTTCTGGAACAATTACACGAACTAGATCACAAATTAAAGTTTGTAAAGG
AGCAGTCATTCAAGGATTCTAAATCAGCACATGATGTGTCAGATATTCTG
GAACAATTGAAAATCAAAGCAATAATGAAGATTCGAGAATATCTTTTACA
GAAAATATATGCCTTCAGAAAACCGATGACAAATTTCCAAGTACCTCAAG
ATATGATGCTTAAGTACAGATTTTTCAATGAATTTCTATTGGCTAACGAT
CGGGCTATTGCTAACGAAATAAGTCGAGAATATGTTGATACTACCAGCAA
GATTCATTATTCATATTTTAAGGCATATATTACTAAATTGGCTAAATTAC
AATTTGACAAAAATGCAGACAAAGAAGATTTTTTAGGAAAAGAAGATTTT
AATAGTTTTCGTCGCAATAATAGTACAAGTGGATCAATTTTTCTCCAGTC
TTCATTATCTGCTAATTTGAAAAATAAATCGACAGTTTTCTCGCTCGCTC
AACGAGATTCAATTTTATATAATAATGCTCTCGAAGCACCTATTATTCTT
CCACACACAGTAATTGCTAATCAGAAGTCGGATAGTAAGATTGGGTCTGT
GACAAAGTTTACATATGAAACTTTGTTTCGATCTCAACATTATGCTCTTC
TCGATACTTGCTGTCGAGAATATTTATTTCTTTGTGACTTTTTTATTCTT
TCATCTCAAGCTGGACAAGATTTTTTCAATCAAGTTATGGGTAAAACTCT
CAATATTTTTCAAAAACAAATTGAAACTTCTATTGCTGCGTGTTTTGATG
CCATTGGAATTCTAATTTGTATTCGCATTGTTTTGTGGTATAAAGATTTA
TGCACAGAACGAGGAGTTTTTGCATTGGACAATTATTGGGGATTACTTCT
CAATCTTCTTTGGCCACGTTGGTTTGAATTAATGGACACTCACGTTTCGT
CTGTTCGTCAACACGCGGCAACTCGACCTTCAAATAGCCAAAATATTCAA
ATTGATTTTAGACCGTATAGTGTCACTAGAAAATATGCAGAATTTTGTGC
TGCTTTACACACTATTCTCAGACGTCGAATTGAGAATTCAAATACTGCTT
CCGGTACAAGTGTAAATTCTTTGCCTGTTAGTACCGGTGCAATACCAGCT
ATTGATAGTGGAATGAAGTCAGTTAATATGGATGCTCAGGTCGCCAGTCG
ATTAATGAGAATGCAAGTAGAAATTGAAGCTATGCTAATGAGGTTGATGG
ATTATTTACCGAATCGAAAGGAAAAGTTGATATTTTCCATAAACAATTGT
GATCTGATTTTATCAGTACTTACAGAATGTGAGGTTTCCGACTGCATTGA
AGGATTGAAATTCAAAGATTTGATGGGCGATAAAATAAATGAATTTGTTG
AAGAAGTTCTTCTTCCCTATTTTGGTTCTTTGATTAATTTTATAAAAGAA
ACAGAATCCAATAAAAATAAAAATCCAAAATCTGAATACACACCAAATGA
AGAAGCTAAAGTTCAAAAAATCATTAAAGGATTTAATATTGATTGGAAAA
CGTCAATCGAGAAAATTAACAGTGAGATCTTGACATCGTTTTCCAATTTT
TGTATAGGAACTCAAATATTCCAGGCCGTTCTTTCTCAACTGATCCAATA
TTACAGGCGATTGCAAGCTTGTATGAATATGTTGCCCTATAAAAACATGC
CTGTGAAAAACGAATTGATTAATATTCATCATATAATGGTTGAAATGAAG
AAATTCAAACCCAATTTTTGATTCGGGATTTGTTTTTAGACTTTAAACAA
TTTTGTGATAGTTTTTTTGTTTAAATATACCATTTGAAAGAGT
back to top

protein sequence of SMED30014331-orf-1

>SMED30014331-orf-1 ID=SMED30014331-orf-1|Name=SMED30014331-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=748bp
MSNDSFDNFDILSDDILIEEVGDHIQANLQDEIVREALKSGVDLREYSEM
VKSELITVENQSIEDYVKSRDKVIELHKQITSSDAILKRMEEILFNFHKD
LGSISTDIQSLQTKSLRMHQCLQNRQIVRGELCQFMAEMVVPEQMINHIL
DTPVTERHFLEQLHELDHKLKFVKEQSFKDSKSAHDVSDILEQLKIKAIM
KIREYLLQKIYAFRKPMTNFQVPQDMMLKYRFFNEFLLANDRAIANEISR
EYVDTTSKIHYSYFKAYITKLAKLQFDKNADKEDFLGKEDFNSFRRNNST
SGSIFLQSSLSANLKNKSTVFSLAQRDSILYNNALEAPIILPHTVIANQK
SDSKIGSVTKFTYETLFRSQHYALLDTCCREYLFLCDFFILSSQAGQDFF
NQVMGKTLNIFQKQIETSIAACFDAIGILICIRIVLWYKDLCTERGVFAL
DNYWGLLLNLLWPRWFELMDTHVSSVRQHAATRPSNSQNIQIDFRPYSVT
RKYAEFCAALHTILRRRIENSNTASGTSVNSLPVSTGAIPAIDSGMKSVN
MDAQVASRLMRMQVEIEAMLMRLMDYLPNRKEKLIFSINNCDLILSVLTE
CEVSDCIEGLKFKDLMGDKINEFVEEVLLPYFGSLINFIKETESNKNKNP
KSEYTPNEEAKVQKIIKGFNIDWKTSIEKINSEILTSFSNFCIGTQIFQA
VLSQLIQYYRRLQACMNMLPYKNMPVKNELINIHHIMVEMKKFKPNF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR007258Vps52
Vocabulary: cellular component
TermDefinition
GO:0000938GARP complex
GO:0005768endosome
GO:0005794Golgi apparatus
GO:0005829cytosol
GO:0010008endosome membrane
GO:0016020membrane
GO:0032588trans-Golgi network membrane
GO:0048471perinuclear region of cytoplasm
GO:0055037recycling endosome
GO:1990745EARP complex
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0017137Rab GTPase binding
GO:0019905syntaxin binding
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006896Golgi to vacuole transport
GO:0007041lysosomal transport
GO:0010668ectodermal cell differentiation
GO:0015031protein transport
GO:0032456endocytic recycling
GO:0042147retrograde transport, endosome to Golgi
GO:0048611embryonic ectodermal digestive tract development