SBF2 domain-containing protein

Overview
NameSBF2 domain-containing protein
Smed IDSMED30014318
Length (bp)1801
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SBF2 domain-containing protein (SMED30014318) t-SNE clustered cells

Violin plots show distribution of expression levels for SBF2 domain-containing protein (SMED30014318) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SBF2 domain-containing protein (SMED30014318) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SBF2 domain-containing protein (SMED30014318) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014318

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014318SMESG000078604.1 SmedASXL_010654SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30014318SMESG000078604.1 dd_Smed_v4_3628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014318SMESG000078604.1 dd_Smed_v4_3628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30014318SMESG000078604.1 dd_Smed_v6_3628_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30014318SMESG000078604.1 OX_Smed_1.0.19831ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neuronSMED30014318SMESG000078604.1 dd_Smed_v6_3628_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30014318SMESG000078604.1 dd_Smed_v6_3628_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SBF2 domain-containing protein vs. Ensembl Human
Match: KIAA0513 (KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058])

HSP 1 Score: 103.605 bits (257), Expect = 8.054e-25
Identity = 50/109 (45.87%), Postives = 73/109 (66.97%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKE-----FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT +    + Q++      F EN+ FGQL TFT NM+A GL++++  DFL+KQA + NL  E+ +L+  +I++
Sbjct:   87 YLYTHLKQQPIWHTLRFWNAAFFDAVHCERTKRS-PTTREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQAVIGNLDEEQYKLLSDHIEQ 194          
BLAST of SBF2 domain-containing protein vs. Ensembl Human
Match: KIAA0513 (KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058])

HSP 1 Score: 104.375 bits (259), Expect = 2.357e-23
Identity = 50/109 (45.87%), Postives = 73/109 (66.97%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKE-----FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT +    + Q++      F EN+ FGQL TFT NM+A GL++++  DFL+KQA + NL  E+ +L+  +I++
Sbjct:  290 YLYTHLKQQPIWHTLRFWNAAFFDAVHCERTKR-SPTTREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQAVIGNLDEEQYKLLSDHIEQ 397          

HSP 2 Score: 69.3218 bits (168), Expect = 7.067e-12
Identity = 49/160 (30.63%), Postives = 75/160 (46.88%), Query Frame = 1
Query:  598 DGDSSASEYGDGGDRPVYAETAGSE---GRRLSLDSVD------------------SLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            DGD S    GDG       E+A SE   G   S  S D                  S  ++ET   + FM   VE+IF     L + +K+ F  +C  ++  GR  FA+ +  ++ ++K V+     +LV  F +VL +C+  +DF PA+  M +CFT+Y
Sbjct:   33 DGDGS---LGDGASESETTESADSENDMGESPSHPSWDQDRRSSSNESFSSNQSTESTQDEETLALRDFMRGYVEKIFSGGEDLDQEEKAKFGEYCSSENGKGREWFARYVSAQRCNSKCVSEATFYRLVQSFAVVLFECHQMDDFGPAKNLMTMCFTYY 189          
BLAST of SBF2 domain-containing protein vs. Ensembl Human
Match: KIAA0513 (KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058])

HSP 1 Score: 98.5969 bits (244), Expect = 1.703e-21
Identity = 51/118 (43.22%), Postives = 71/118 (60.17%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDP-------EKALIQDKE-------FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW +LRFWNAAFF+++  ER K+   T  D        EK     +E       F EN+ FGQL TFT NM+A GL++++  DFL+KQA + NL  E+ +L+  +I++
Sbjct:  290 YLYTHLKQQPIWHTLRFWNAAFFDAVHCERTKRSPTTRGDAGEEEEKREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQAVIGNLDEEQYKLLSDHIEQ 407          

HSP 2 Score: 69.3218 bits (168), Expect = 6.772e-12
Identity = 49/160 (30.63%), Postives = 75/160 (46.88%), Query Frame = 1
Query:  598 DGDSSASEYGDGGDRPVYAETAGSE---GRRLSLDSVD------------------SLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            DGD S    GDG       E+A SE   G   S  S D                  S  ++ET   + FM   VE+IF     L + +K+ F  +C  ++  GR  FA+ +  ++ ++K V+     +LV  F +VL +C+  +DF PA+  M +CFT+Y
Sbjct:   33 DGDGS---LGDGASESETTESADSENDMGESPSHPSWDQDRRSSSNESFSSNQSTESTQDEETLALRDFMRGYVEKIFSGGEDLDQEEKAKFGEYCSSENGKGREWFARYVSAQRCNSKCVSEATFYRLVQSFAVVLFECHQMDDFGPAKNLMTMCFTYY 189          
BLAST of SBF2 domain-containing protein vs. Ensembl Human
Match: KIAA0513 (KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058])

HSP 1 Score: 98.5969 bits (244), Expect = 1.703e-21
Identity = 51/118 (43.22%), Postives = 71/118 (60.17%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDP-------EKALIQDKE-------FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW +LRFWNAAFF+++  ER K+   T  D        EK     +E       F EN+ FGQL TFT NM+A GL++++  DFL+KQA + NL  E+ +L+  +I++
Sbjct:  290 YLYTHLKQQPIWHTLRFWNAAFFDAVHCERTKRSPTTRGDAGEEEEKREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQAVIGNLDEEQYKLLSDHIEQ 407          

HSP 2 Score: 69.3218 bits (168), Expect = 6.772e-12
Identity = 49/160 (30.63%), Postives = 75/160 (46.88%), Query Frame = 1
Query:  598 DGDSSASEYGDGGDRPVYAETAGSE---GRRLSLDSVD------------------SLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            DGD S    GDG       E+A SE   G   S  S D                  S  ++ET   + FM   VE+IF     L + +K+ F  +C  ++  GR  FA+ +  ++ ++K V+     +LV  F +VL +C+  +DF PA+  M +CFT+Y
Sbjct:   33 DGDGS---LGDGASESETTESADSENDMGESPSHPSWDQDRRSSSNESFSSNQSTESTQDEETLALRDFMRGYVEKIFSGGEDLDQEEKAKFGEYCSSENGKGREWFARYVSAQRCNSKCVSEATFYRLVQSFAVVLFECHQMDDFGPAKNLMTMCFTYY 189          
BLAST of SBF2 domain-containing protein vs. Ensembl Human
Match: KIAA0513 (KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058])

HSP 1 Score: 65.4698 bits (158), Expect = 2.279e-12
Identity = 37/104 (35.58%), Postives = 55/104 (52.88%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKEFQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW+    W                  T  + + +L     F EN+ FGQL TFT NM+A GL++++  DFL+KQA + NL  E+ +L+  +I++
Sbjct:   28 YLYTHLKQQPIWEK---WCHM---------------TQEERDDSL----RFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQAVIGNLDEEQYKLLSDHIEQ 109          
BLAST of SBF2 domain-containing protein vs. Ensembl Fly
Match: CG17378 (gene:FBgn0031858 transcript:FBtr0079336)

HSP 1 Score: 90.1225 bits (222), Expect = 1.503e-18
Identity = 43/116 (37.07%), Postives = 61/116 (52.59%), Query Frame = 1
Query:  799 KSMFATFCKHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFYVEAVNDGC-PVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKK 1143
            KS F    +   GR  F + + +++  +K++       L   F + L +C+  ED+ PA + MNLCF FY E    GC P   YL+ SL  QPIWQ  RFWNA F + +  ER  +
Sbjct:  341 KSEFGVLLRLEIGRLWFTRFLTEQRHKSKRLDSVTFGSLAQYFALALFECSECEDYGPAAVLMNLCFLFYHEVEVPGCDPYREYLFSSLRQQPIWQQARFWNAIFHDGMQAEREHR 456          

HSP 2 Score: 56.6102 bits (135), Expect = 4.663e-8
Identity = 31/72 (43.06%), Postives = 42/72 (58.33%), Query Frame = 1
Query: 1150 PTTNDPEK-ALIQDKEF--QENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            P    P K +L Q      QE++AF QL   T NM +LG S+E+ LDFL+K     NL ++K +LIR NI +
Sbjct:  526 PANRRPSKTSLTQAHSLRDQEDIAFRQLGALTCNMHSLGTSQELCLDFLKKNVVAHNLSKDKAKLIRDNIYR 597          
BLAST of SBF2 domain-containing protein vs. Ensembl Fly
Match: CG17378 (gene:FBgn0031858 transcript:FBtr0332335)

HSP 1 Score: 89.7373 bits (221), Expect = 1.522e-18
Identity = 43/116 (37.07%), Postives = 61/116 (52.59%), Query Frame = 1
Query:  799 KSMFATFCKHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFYVEAVNDGC-PVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKK 1143
            KS F    +   GR  F + + +++  +K++       L   F + L +C+  ED+ PA + MNLCF FY E    GC P   YL+ SL  QPIWQ  RFWNA F + +  ER  +
Sbjct:  292 KSEFGVLLRLEIGRLWFTRFLTEQRHKSKRLDSVTFGSLAQYFALALFECSECEDYGPAAVLMNLCFLFYHEVEVPGCDPYREYLFSSLRQQPIWQQARFWNAIFHDGMQAEREHR 407          

HSP 2 Score: 56.6102 bits (135), Expect = 4.287e-8
Identity = 31/72 (43.06%), Postives = 42/72 (58.33%), Query Frame = 1
Query: 1150 PTTNDPEK-ALIQDKEF--QENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            P    P K +L Q      QE++AF QL   T NM +LG S+E+ LDFL+K     NL ++K +LIR NI +
Sbjct:  477 PANRRPSKTSLTQAHSLRDQEDIAFRQLGALTCNMHSLGTSQELCLDFLKKNVVAHNLSKDKAKLIRDNIYR 548          
BLAST of SBF2 domain-containing protein vs. Ensembl Fly
Match: CG17378 (gene:FBgn0031858 transcript:FBtr0079337)

HSP 1 Score: 89.7373 bits (221), Expect = 1.522e-18
Identity = 43/116 (37.07%), Postives = 61/116 (52.59%), Query Frame = 1
Query:  799 KSMFATFCKHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFYVEAVNDGC-PVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKK 1143
            KS F    +   GR  F + + +++  +K++       L   F + L +C+  ED+ PA + MNLCF FY E    GC P   YL+ SL  QPIWQ  RFWNA F + +  ER  +
Sbjct:  292 KSEFGVLLRLEIGRLWFTRFLTEQRHKSKRLDSVTFGSLAQYFALALFECSECEDYGPAAVLMNLCFLFYHEVEVPGCDPYREYLFSSLRQQPIWQQARFWNAIFHDGMQAEREHR 407          

HSP 2 Score: 56.6102 bits (135), Expect = 4.287e-8
Identity = 31/72 (43.06%), Postives = 42/72 (58.33%), Query Frame = 1
Query: 1150 PTTNDPEK-ALIQDKEF--QENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            P    P K +L Q      QE++AF QL   T NM +LG S+E+ LDFL+K     NL ++K +LIR NI +
Sbjct:  477 PANRRPSKTSLTQAHSLRDQEDIAFRQLGALTCNMHSLGTSQELCLDFLKKNVVAHNLSKDKAKLIRDNIYR 548          
BLAST of SBF2 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:91860 (zgc:91860 [Source:ZFIN;Acc:ZDB-GENE-040704-34])

HSP 1 Score: 106.301 bits (264), Expect = 3.505e-24
Identity = 52/109 (47.71%), Postives = 74/109 (67.89%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKE-----FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT +    + Q+++     F EN+ FGQL TFT NMVA GLS+++  DFL+KQA + NL  E+ +L+  +I++
Sbjct:  303 YLYTHLKQQPIWHTLRFWNAAFFDAVHSERNKR-SPTTREKWCHMTQEEKDDSSRFNENITFGQLGTFTHNMVAFGLSKKLCNDFLKKQAVIGNLNEEQYKLLCDHIEQ 410          

HSP 2 Score: 59.6918 bits (143), Expect = 4.660e-9
Identity = 42/157 (26.75%), Postives = 74/157 (47.13%), Query Frame = 1
Query:  544 NLTPFNEEPKKKSFGKEDDGDSSASEYGDGGDRPVYAETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFCK--HHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
             + P   EP   +     + DS A+E  D  +    + +  S  RR S  S  S  + E  + ++FM   V ++F         +K+ F   C   +  GR  F+K +  ++  +K V+ +   +LV  F +VL +C+  +D+ PA+  M +CFT+Y
Sbjct:   47 TMEPLLPEPMAPTHTPRREEDSDATESADSENEGTESPSHPSSTRRSSSCSSHSAEDAEETEIRAFMKTYVAKLFHGGEDFDHEEKARFGELCTGDNGKGREWFSKYVSAQRCHSKCVSEQTFYRLVQSFAVVLFECHQVDDYCPAKHLMTMCFTYY 203          
BLAST of SBF2 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:91860 (zgc:91860 [Source:ZFIN;Acc:ZDB-GENE-040704-34])

HSP 1 Score: 100.523 bits (249), Expect = 3.167e-22
Identity = 54/119 (45.38%), Postives = 74/119 (62.18%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTT--------NDPEKALIQDKE-------FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT        ++ EK     +E       F EN+ FGQL TFT NMVA GLS+++  DFL+KQA + NL  E+ +L+  +I++
Sbjct:  303 YLYTHLKQQPIWHTLRFWNAAFFDAVHSERNKR-SPTTRRTAEEEKDEREKWCHMTQEEKDDSSRFNENITFGQLGTFTHNMVAFGLSKKLCNDFLKKQAVIGNLNEEQYKLLCDHIEQ 420          

HSP 2 Score: 59.6918 bits (143), Expect = 5.820e-9
Identity = 42/157 (26.75%), Postives = 74/157 (47.13%), Query Frame = 1
Query:  544 NLTPFNEEPKKKSFGKEDDGDSSASEYGDGGDRPVYAETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFCK--HHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
             + P   EP   +     + DS A+E  D  +    + +  S  RR S  S  S  + E  + ++FM   V ++F         +K+ F   C   +  GR  F+K +  ++  +K V+ +   +LV  F +VL +C+  +D+ PA+  M +CFT+Y
Sbjct:   47 TMEPLLPEPMAPTHTPRREEDSDATESADSENEGTESPSHPSSTRRSSSCSSHSAEDAEETEIRAFMKTYVAKLFHGGEDFDHEEKARFGELCTGDNGKGREWFSKYVSAQRCHSKCVSEQTFYRLVQSFAVVLFECHQVDDYCPAKHLMTMCFTYY 203          
BLAST of SBF2 domain-containing protein vs. Ensembl Zebrafish
Match: zgc:91860 (zgc:91860 [Source:ZFIN;Acc:ZDB-GENE-040704-34])

HSP 1 Score: 100.523 bits (249), Expect = 3.167e-22
Identity = 54/119 (45.38%), Postives = 74/119 (62.18%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTT--------NDPEKALIQDKE-------FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT        ++ EK     +E       F EN+ FGQL TFT NMVA GLS+++  DFL+KQA + NL  E+ +L+  +I++
Sbjct:  303 YLYTHLKQQPIWHTLRFWNAAFFDAVHSERNKR-SPTTRRTAEEEKDEREKWCHMTQEEKDDSSRFNENITFGQLGTFTHNMVAFGLSKKLCNDFLKKQAVIGNLNEEQYKLLCDHIEQ 420          

HSP 2 Score: 59.6918 bits (143), Expect = 5.820e-9
Identity = 42/157 (26.75%), Postives = 74/157 (47.13%), Query Frame = 1
Query:  544 NLTPFNEEPKKKSFGKEDDGDSSASEYGDGGDRPVYAETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFCK--HHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
             + P   EP   +     + DS A+E  D  +    + +  S  RR S  S  S  + E  + ++FM   V ++F         +K+ F   C   +  GR  F+K +  ++  +K V+ +   +LV  F +VL +C+  +D+ PA+  M +CFT+Y
Sbjct:   47 TMEPLLPEPMAPTHTPRREEDSDATESADSENEGTESPSHPSSTRRSSSCSSHSAEDAEETEIRAFMKTYVAKLFHGGEDFDHEEKARFGELCTGDNGKGREWFSKYVSAQRCHSKCVSEQTFYRLVQSFAVVLFECHQVDDYCPAKHLMTMCFTYY 203          
BLAST of SBF2 domain-containing protein vs. Ensembl Xenopus
Match: kiaa0513 (KIAA0513 [Source:NCBI gene;Acc:100125070])

HSP 1 Score: 107.842 bits (268), Expect = 1.546e-24
Identity = 52/109 (47.71%), Postives = 72/109 (66.06%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDK-----EFQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT D    + Q++     +F EN+ FGQL TFT NM+A GLS+++  DFL+KQA + NL  EK + +  +I +
Sbjct:  298 YLYTHLKQQPIWHTLRFWNAAFFDAVHCERRKRS-PTTRDKWSHMTQEERDDSLQFNENITFGQLGTFTHNMLAFGLSKKLCYDFLKKQAVIGNLDEEKFKQLTDHIDQ 405          

HSP 2 Score: 63.5438 bits (153), Expect = 4.720e-10
Identity = 29/94 (30.85%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  733 KSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            + F+ + VE+IF+    + + +K+ F   C  ++  GR  FA+ +  ++ ++K V+ +   +LV  F +VL +C+  +DF PA+  M +CFT+Y
Sbjct:  103 REFVRKYVEKIFEGGEDMDQEEKARFGELCSTENGKGREWFARFVSAQRCNSKCVSEQTFYRLVQSFAVVLFECHQMDDFGPAKSLMTMCFTYY 196          
BLAST of SBF2 domain-containing protein vs. Ensembl Xenopus
Match: kiaa0513 (KIAA0513 [Source:NCBI gene;Acc:100125070])

HSP 1 Score: 100.523 bits (249), Expect = 4.336e-22
Identity = 54/119 (45.38%), Postives = 73/119 (61.34%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTT--NDPEKALIQDK-------------EFQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT  N  E+   +DK             +F EN+ FGQL TFT NM+A GLS+++  DFL+KQA + NL  EK + +  +I +
Sbjct:  298 YLYTHLKQQPIWHTLRFWNAAFFDAVHCERRKRS-PTTRENAGEEKEERDKWSHMTQEERDDSLQFNENITFGQLGTFTHNMLAFGLSKKLCYDFLKKQAVIGNLDEEKFKQLTDHIDQ 415          

HSP 2 Score: 63.5438 bits (153), Expect = 4.396e-10
Identity = 29/94 (30.85%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  733 KSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            + F+ + VE+IF+    + + +K+ F   C  ++  GR  FA+ +  ++ ++K V+ +   +LV  F +VL +C+  +DF PA+  M +CFT+Y
Sbjct:  103 REFVRKYVEKIFEGGEDMDQEEKARFGELCSTENGKGREWFARFVSAQRCNSKCVSEQTFYRLVQSFAVVLFECHQMDDFGPAKSLMTMCFTYY 196          
BLAST of SBF2 domain-containing protein vs. Ensembl Xenopus
Match: kiaa0513 (KIAA0513 [Source:NCBI gene;Acc:100125070])

HSP 1 Score: 100.138 bits (248), Expect = 4.655e-22
Identity = 54/119 (45.38%), Postives = 73/119 (61.34%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTT--NDPEKALIQDK-------------EFQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT  N  E+   +DK             +F EN+ FGQL TFT NM+A GLS+++  DFL+KQA + NL  EK + +  +I +
Sbjct:  287 YLYTHLKQQPIWHTLRFWNAAFFDAVHCERRKR-SPTTRENAGEEKEERDKWSHMTQEERDDSLQFNENITFGQLGTFTHNMLAFGLSKKLCYDFLKKQAVIGNLDEEKFKQLTDHIDQ 404          

HSP 2 Score: 63.5438 bits (153), Expect = 3.941e-10
Identity = 29/94 (30.85%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  733 KSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            + F+ + VE+IF+    + + +K+ F   C  ++  GR  FA+ +  ++ ++K V+ +   +LV  F +VL +C+  +DF PA+  M +CFT+Y
Sbjct:  103 REFVRKYVEKIFEGGEDMDQEEKARFGELCSTENGKGREWFARFVSAQRCNSKCVSEQTFYRLVQSFAVVLFECHQMDDFGPAKSLMTMCFTYY 196          
BLAST of SBF2 domain-containing protein vs. Ensembl Mouse
Match: 6430548M08Rik (RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:MGI:2443793])

HSP 1 Score: 103.99 bits (258), Expect = 1.910e-23
Identity = 50/110 (45.45%), Postives = 73/110 (66.36%), Query Frame = 1
Query: 1042 TYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKE-----FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
             YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT +    + Q++      F EN+ FGQL TFT NM+A GL++++  DFL+KQA + NL  E+ +L+  +I++
Sbjct:  285 VYLYTHLRQQPIWHTLRFWNAAFFDAVHCERRKR-SPTTREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCSDFLKKQAVIGNLDEEQYKLLSDHIEQ 393          

HSP 2 Score: 72.7886 bits (177), Expect = 3.207e-13
Identity = 36/106 (33.96%), Postives = 59/106 (55.66%), Query Frame = 1
Query:  697 VDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
             DS P++ET   + FM   VE+IF     L + +K+ F  +C  +   GR  FA+ +  ++  +K V+     +LV  F +VL +C+  +DF PA+  M +CFT+Y
Sbjct:   84 ADSAPDEETLALREFMRSYVEKIFSGGEDLDQEEKAKFGEYCSGEDGKGREWFARFVSAQRCKSKCVSEPTFYRLVQSFAVVLFECHQMDDFGPAKNLMTMCFTYY 189          
BLAST of SBF2 domain-containing protein vs. Ensembl Mouse
Match: 6430548M08Rik (RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:MGI:2443793])

HSP 1 Score: 98.2117 bits (243), Expect = 1.577e-21
Identity = 51/119 (42.86%), Postives = 71/119 (59.66%), Query Frame = 1
Query: 1042 TYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDP-------EKALIQDKE-------FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
             YLY  L  QPIW +LRFWNAAFF+++  ER K+   T  D        EK     +E       F EN+ FGQL TFT NM+A GL++++  DFL+KQA + NL  E+ +L+  +I++
Sbjct:  285 VYLYTHLRQQPIWHTLRFWNAAFFDAVHCERRKRSPTTRGDAGEQEEKREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCSDFLKKQAVIGNLDEEQYKLLSDHIEQ 403          

HSP 2 Score: 73.1738 bits (178), Expect = 2.908e-13
Identity = 36/106 (33.96%), Postives = 59/106 (55.66%), Query Frame = 1
Query:  697 VDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
             DS P++ET   + FM   VE+IF     L + +K+ F  +C  +   GR  FA+ +  ++  +K V+     +LV  F +VL +C+  +DF PA+  M +CFT+Y
Sbjct:   84 ADSAPDEETLALREFMRSYVEKIFSGGEDLDQEEKAKFGEYCSGEDGKGREWFARFVSAQRCKSKCVSEPTFYRLVQSFAVVLFECHQMDDFGPAKNLMTMCFTYY 189          
BLAST of SBF2 domain-containing protein vs. Ensembl Mouse
Match: 6430548M08Rik (RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:MGI:2443793])

HSP 1 Score: 98.2117 bits (243), Expect = 1.577e-21
Identity = 51/119 (42.86%), Postives = 71/119 (59.66%), Query Frame = 1
Query: 1042 TYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDP-------EKALIQDKE-------FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
             YLY  L  QPIW +LRFWNAAFF+++  ER K+   T  D        EK     +E       F EN+ FGQL TFT NM+A GL++++  DFL+KQA + NL  E+ +L+  +I++
Sbjct:  285 VYLYTHLRQQPIWHTLRFWNAAFFDAVHCERRKRSPTTRGDAGEQEEKREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCSDFLKKQAVIGNLDEEQYKLLSDHIEQ 403          

HSP 2 Score: 73.1738 bits (178), Expect = 2.908e-13
Identity = 36/106 (33.96%), Postives = 59/106 (55.66%), Query Frame = 1
Query:  697 VDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
             DS P++ET   + FM   VE+IF     L + +K+ F  +C  +   GR  FA+ +  ++  +K V+     +LV  F +VL +C+  +DF PA+  M +CFT+Y
Sbjct:   84 ADSAPDEETLALREFMRSYVEKIFSGGEDLDQEEKAKFGEYCSGEDGKGREWFARFVSAQRCKSKCVSEPTFYRLVQSFAVVLFECHQMDDFGPAKNLMTMCFTYY 189          
BLAST of SBF2 domain-containing protein vs. Ensembl Mouse
Match: 6430548M08Rik (RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:MGI:2443793])

HSP 1 Score: 73.559 bits (179), Expect = 3.272e-14
Identity = 36/106 (33.96%), Postives = 58/106 (54.72%), Query Frame = 1
Query:  697 VDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFCKHH--TGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
             DS P++ET   + FM   VE+IF     L + +K+ F  +C      GR  FA+ +  ++  +K V+     +LV  F +VL +C+  +DF PA+  M +CFT+Y
Sbjct:   84 ADSAPDEETLALREFMRSYVEKIFSGGEDLDQEEKAKFGEYCSGEDGKGREWFARFVSAQRCKSKCVSEPTFYRLVQSFAVVLFECHQMDDFGPAKNLMTMCFTYY 189          
BLAST of SBF2 domain-containing protein vs. Ensembl Mouse
Match: 6430548M08Rik (RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:MGI:2443793])

HSP 1 Score: 73.1738 bits (178), Expect = 1.167e-13
Identity = 36/106 (33.96%), Postives = 59/106 (55.66%), Query Frame = 1
Query:  697 VDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
             DS P++ET   + FM   VE+IF     L + +K+ F  +C  +   GR  FA+ +  ++  +K V+     +LV  F +VL +C+  +DF PA+  M +CFT+Y
Sbjct:   84 ADSAPDEETLALREFMRSYVEKIFSGGEDLDQEEKAKFGEYCSGEDGKGREWFARFVSAQRCKSKCVSEPTFYRLVQSFAVVLFECHQMDDFGPAKNLMTMCFTYY 189          
BLAST of SBF2 domain-containing protein vs. UniProt/SwissProt
Match: sp|O60268|K0513_HUMAN (Uncharacterized protein KIAA0513 OS=Homo sapiens OX=9606 GN=KIAA0513 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 8.178e-21
Identity = 51/118 (43.22%), Postives = 71/118 (60.17%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDP-------EKALIQDKE-------FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW +LRFWNAAFF+++  ER K+   T  D        EK     +E       F EN+ FGQL TFT NM+A GL++++  DFL+KQA + NL  E+ +L+  +I++
Sbjct:  290 YLYTHLKQQPIWHTLRFWNAAFFDAVHCERTKRSPTTRGDAGEEEEKREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCNDFLKKQAVIGNLDEEQYKLLSDHIEQ 407          

HSP 2 Score: 69.3218 bits (168), Expect = 3.252e-11
Identity = 49/160 (30.63%), Postives = 75/160 (46.88%), Query Frame = 1
Query:  598 DGDSSASEYGDGGDRPVYAETAGSE---GRRLSLDSVD------------------SLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            DGD S    GDG       E+A SE   G   S  S D                  S  ++ET   + FM   VE+IF     L + +K+ F  +C  ++  GR  FA+ +  ++ ++K V+     +LV  F +VL +C+  +DF PA+  M +CFT+Y
Sbjct:   33 DGDGS---LGDGASESETTESADSENDMGESPSHPSWDQDRRSSSNESFSSNQSTESTQDEETLALRDFMRGYVEKIFSGGEDLDQEEKAKFGEYCSSENGKGREWFARYVSAQRCNSKCVSEATFYRLVQSFAVVLFECHQMDDFGPAKNLMTMCFTYY 189          
BLAST of SBF2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R0A7|K0513_MOUSE (Uncharacterized protein KIAA0513 OS=Mus musculus OX=10090 GN=Kiaa0513 PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.103e-20
Identity = 51/119 (42.86%), Postives = 71/119 (59.66%), Query Frame = 1
Query: 1042 TYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDP-------EKALIQDKE-------FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
             YLY  L  QPIW +LRFWNAAFF+++  ER K+   T  D        EK     +E       F EN+ FGQL TFT NM+A GL++++  DFL+KQA + NL  E+ +L+  +I++
Sbjct:  285 VYLYTHLRQQPIWHTLRFWNAAFFDAVHCERRKRSPTTRGDAGEQEEKREKWCHMTQEERDDSLRFNENITFGQLGTFTHNMLAFGLNKKLCSDFLKKQAVIGNLDEEQYKLLSDHIEQ 403          

HSP 2 Score: 73.1738 bits (178), Expect = 2.034e-12
Identity = 36/106 (33.96%), Postives = 59/106 (55.66%), Query Frame = 1
Query:  697 VDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
             DS P++ET   + FM   VE+IF     L + +K+ F  +C  +   GR  FA+ +  ++  +K V+     +LV  F +VL +C+  +DF PA+  M +CFT+Y
Sbjct:   84 ADSAPDEETLALREFMRSYVEKIFSGGEDLDQEEKAKFGEYCSGEDGKGREWFARFVSAQRCKSKCVSEPTFYRLVQSFAVVLFECHQMDDFGPAKNLMTMCFTYY 189          
BLAST of SBF2 domain-containing protein vs. TrEMBL
Match: G7YCD6 (SBF2 domain-containing protein OS=Clonorchis sinensis OX=79923 GN=CLF_104804 PE=4 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 3.065e-71
Identity = 143/346 (41.33%), Postives = 203/346 (58.67%), Query Frame = 1
Query:  364 IRGLFKQVAGDEXXXXXXXXX----XXXXXXKGMSGFLAGTTNFFNSVQAKKDDLMSDLTNKLGNLT-PFNE-----EPKKKSFGKEDDGD--SSASEYGDGGDRPVYAETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFCKHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY--VEAVN-DGCPVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKEFQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            +RG FK V   E     +       ++     GMSGFL+GTT F ++VQ KK+ L++DL+ K G +  P ++     + KK S   E++GD  SSASEYGD GD+P+YAE A  E +  S+DSVDSLPE E ++ K+ +  ++  I   NS   E + + F  +  HHTGRS FAK + ++    K++   ++ +L    + VL  CN ++DF PA   M   FT Y  V A++ D      YL+  L  QPIWQS+RFWNAAFF +L  ER  +  PT    ++ L+ +KE QEN AF Q+S F W M A G+ RE  ++FLRKQA   NL +E+CR++  N+QK
Sbjct:    3 VRGFFKNVLNSEQTQDASATPPDDPNSATLGSGMSGFLSGTTRFLDTVQNKKNGLLNDLSTKFGGIKLPGDQSGGLTKGKKTSRIHENEGDEESSASEYGDEGDKPMYAEQAPLESQE-SVDSVDSLPEQEAEQCKAEIRTIISSILQQNSISPELEAN-FQNYSMHHTGRSAFAKELKRQTNQTKELPASVLNQLGQYASHVLVHCNENDDFAPATQIMQRSFTLYHEVRALSMDEHGEQQYLFTLLRDQPIWQSMRFWNAAFFIALQAERRNQTVPTGLRDDETLLAEKEQQENAAFIQISKFVWRMHAFGIPRESCVEFLRKQANAENLSKERCRILHTNLQK 346          
BLAST of SBF2 domain-containing protein vs. TrEMBL
Match: A0A4S2LEA4 (SBF2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007808 PE=4 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 2.134e-69
Identity = 142/346 (41.04%), Postives = 204/346 (58.96%), Query Frame = 1
Query:  364 IRGLFKQVAGDEXXXXXXXXX----XXXXXXKGMSGFLAGTTNFFNSVQAKKDDLMSDLTNKL-GNLTPFNE-----EPKKKSFGKEDDGD--SSASEYGDGGDRPVYAETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFCKHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY--VEAVN-DGCPVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKEFQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            +RG FK V   E     +       ++     GMSGFL+GTT F ++VQ KK+ L++DLT K  G + P ++     + KK S   E++GD  SSASEYGD GD+P+YAE A  E +  S+DSVDSLPE E ++ K+ +  +V  I   N+   E + + F  +  HHTGRS FAK + ++    K++   ++ +L    + VL  CN ++DF PA   M   FT Y  V+A++ D      YL+  L  QPIWQS+RFWNAAFF +L  ER  +  P     ++AL+ +KE QE+ AF Q+S F W M A G+ RE  ++FLRKQA   NL +++CR++  N+QK
Sbjct:    3 VRGFFKNVLNSEQPQDTSAIPPDDPNSATLGSGMSGFLSGTTRFLDTVQNKKNGLLNDLTTKFSGIILPGDQSGGRTKRKKTSRVHENEGDEESSASEYGDEGDKPMYAEQAPLESQE-SVDSVDSLPEQEAEQCKAEIRTIVSSILQQNAISPELEAN-FQNYSMHHTGRSAFAKELKRQTNQTKELPASVLNQLGQYASHVLVHCNENDDFAPATQIMQRSFTLYHEVKALSMDEHGEQHYLFTLLRDQPIWQSMRFWNAAFFIALQAERRNQTVPAGLRDDEALLAEKEQQESAAFIQISKFVWRMHAFGIPRESCVEFLRKQANAENLSKDRCRILHTNLQK 346          
BLAST of SBF2 domain-containing protein vs. TrEMBL
Match: A0A074ZSV1 (SBF2 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_03406 PE=4 SV=1)

HSP 1 Score: 233.417 bits (594), Expect = 1.445e-67
Identity = 138/346 (39.88%), Postives = 201/346 (58.09%), Query Frame = 1
Query:  364 IRGLFKQVAGDEXXXXXXXXX----XXXXXXKGMSGFLAGTTNFFNSVQAKKDDLMSDLTNKL------GNLTPFNEEPKKKSFGKEDDGD--SSASEYGDGGDRPVYAETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFCKHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY--VEAVN-DGCPVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKEFQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            +RG FK V   E     +       ++     G+SGFL+GTT F ++VQ KK+ L++DLT K       G+ +    + KK S  +E++GD  SSASEYGD GD+P+YAE A  E +  S+DSVDSLPE E ++ K+ +  ++  I   N+ +    ++ F  +  HHTGRS FAK + ++    K++   ++ +L    + VL  CN ++DF PA   M   FT Y  V A++ D      YL+  L  QPIWQS+RFWNAAFF +L  ER  +  P     ++ L+ +KE QEN AF Q+S F W M A G+ RE  ++FLRKQA   NL +++CR++  N+QK
Sbjct:    3 VRGFFKNVLNSEQAQDTSAIPPDDPNSGTLGSGVSGFLSGTTRFLDTVQNKKNGLLNDLTTKFSGIKLPGDQSGGRTKRKKTSRVQENEGDEESSASEYGDEGDKPMYAEQAPLESQE-SVDSVDSLPEQEAEQCKAEIRTIISTILQQNA-ISPDLEANFQNYSMHHTGRSAFAKELKRQTNQTKELPASVLNQLGQYASHVLVHCNENDDFAPATQIMQRSFTLYHEVRALSMDEHGEQHYLFTLLRDQPIWQSMRFWNAAFFIALQTERRNQTIPAGLRDDETLLAEKEQQENAAFIQISKFVWRMHAFGIPRESCVEFLRKQANGENLSKDRCRILHTNLQK 346          
BLAST of SBF2 domain-containing protein vs. TrEMBL
Match: A0A5J4NV63 (SBF2 domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0008948 PE=4 SV=1)

HSP 1 Score: 232.261 bits (591), Expect = 4.562e-67
Identity = 148/350 (42.29%), Postives = 203/350 (58.00%), Query Frame = 1
Query:  364 IRGLFKQVAGDEXXXXXXXXXXXXXXXKGMSG---FLAGTTNFFNSVQAKKDDLMSDLTNKL------GNLTPFNEEPKKK-----SFGKEDDGD--SSASEYGDGGDRPVYAETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFCKHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFYVEAVN---DGCPVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKEFQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            +RG FK V   E ++ N+  +       G SG   FL+GT+ F +SVQ KK+ L+SDL+NKL      G+ +    + KK+     S G+ED GD  SSASEYGD GDRP+YAE    E RR+S+DSV SLPEDE  ++KS +++LV  IF+      E K + F  F   HTGRS FAK +  +  + K V   ++ +L    + VL +CN ++DF PA   +   FT Y E      +      YL+  L  QPIWQS+RFWNAAFF +L  ER K+  PT    E+AL  +KE Q+N  + QLS F W M   G+ +E  LDFLRKQA+  NL ++K   ++ N+Q+
Sbjct:    3 VRGFFKNVLSSEPDAANSQTTTEVPKTGGASGMTSFLSGTSRFLDSVQTKKNGLISDLSNKLSSIKLPGDQSGTGTQGKKRKKRLASNGQEDSGDEESSASEYGDDGDRPMYAEQPPME-RRVSVDSVASLPEDEVDQWKSEISKLVSYIFEQKPIGSEMKAN-FQNFVTQHTGRSLFAKELRHQMNTKKAVAMPVLTELSQYVSHVLVNCNETDDFGPATQILQATFTIYHEITALSLEDHSQQHYLFTLLRDQPIWQSMRFWNAAFFIALQAERRKQTIPTELHGEEALEAEKEAQDNAVYIQLSKFIWRMCMFGIPKEACLDFLRKQASAENLSQDKYHTLQMNVQQ 350          
BLAST of SBF2 domain-containing protein vs. TrEMBL
Match: A0A504YX16 (SBF2 domain-containing protein OS=Fasciola gigantica OX=46835 GN=FGIG_07781 PE=4 SV=1)

HSP 1 Score: 229.565 bits (584), Expect = 7.883e-66
Identity = 125/309 (40.45%), Postives = 184/309 (59.55%), Query Frame = 1
Query:  448 GMSGFLAGTTNFFNSVQAKKDDLMSDLTNKLGNLTPFNEEPKKKSFGKE------------DDGDSSASEYGDGGDRPVYAETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFCKHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFYVEA----VNDGCPVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKEFQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREK 1326
            GMS FL+GT+ F +SVQ KK+ L++D+++KL  +    ++    S  KE            DDGDSSASEYG+ GDRP+YAE    E R++S++SVDSLPE+E  +++  +  ++ E+    S   E++ SM   +   HTGRS FAK +  +  S K+V   ++  L  +   +L  CN ++DF PA   M + FT Y E     +ND    L YLY  L  Q IWQS+RFWNAAFF +L  +R+++  P   + E+AL  ++E  +N  + +LS F W M ALG+++E  +DFLRKQ+  ANL + K
Sbjct:   35 GMSSFLSGTSRFLDSVQTKKNGLINDISHKLSAIKLPGDQSTGDSVNKEENLRTKRPAVDEDDGDSSASEYGNEGDRPMYAEETPME-RQVSVESVDSLPENEANQWRGNIRAIIREVLCQKSVSSEAQSSM-ENYAMRHTGRSGFAKELKVQVGSEKKVPLPVLNGLAQLMKPILTQCNETDDFLPATHLMQISFTLYHETPAANMNDRGQ-LHYLYSLLRDQTIWQSMRFWNAAFFTTLQRKRSRQTIPAGFEGEEALRMEREMHDNTTYMELSKFVWRMFALGINKESCMDFLRKQSNTANLSKGK 340          
BLAST of SBF2 domain-containing protein vs. Ensembl Cavefish
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:103043002])

HSP 1 Score: 100.523 bits (249), Expect = 2.403e-22
Identity = 48/109 (44.04%), Postives = 73/109 (66.97%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKE-----FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT +    + Q+++       EN+ FGQL TFT NM+A GL++++  DFL+KQA + +L  E+ +L+  +I++
Sbjct:  289 YLYTHLKQQPIWHTLRFWNAAFFDAVHCERNKR-SPTTREKWCHMTQEEKDDSSRIDENITFGQLGTFTHNMLAFGLTKKLCNDFLKKQAVIGHLNEEQYKLLSDHIEQ 396          

HSP 2 Score: 60.8474 bits (146), Expect = 1.915e-9
Identity = 29/94 (30.85%), Postives = 52/94 (55.32%), Query Frame = 1
Query:  733 KSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            + FM   VE++F       + +K+ F   C  ++  GR  FAK +  ++ ++K V+ +   +LV  F +VL +C   +D+ PA+  M +CFT+Y
Sbjct:  113 REFMKAYVEKLFHGKEDFDQEEKARFGELCSGENGKGREWFAKYVSVQRCNSKCVSEQTFYRLVQSFAVVLFECYQMDDYVPAKHLMTMCFTYY 206          
BLAST of SBF2 domain-containing protein vs. Ensembl Cavefish
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:103043002])

HSP 1 Score: 100.138 bits (248), Expect = 3.180e-22
Identity = 48/109 (44.04%), Postives = 73/109 (66.97%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKE-----FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT +    + Q+++       EN+ FGQL TFT NM+A GL++++  DFL+KQA + +L  E+ +L+  +I++
Sbjct:  306 YLYTHLKQQPIWHTLRFWNAAFFDAVHCERNKR-SPTTREKWCHMTQEEKDDSSRIDENITFGQLGTFTHNMLAFGLTKKLCNDFLKKQAVIGHLNEEQYKLLSDHIEQ 413          

HSP 2 Score: 60.4622 bits (145), Expect = 2.413e-9
Identity = 29/94 (30.85%), Postives = 52/94 (55.32%), Query Frame = 1
Query:  733 KSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            + FM   VE++F       + +K+ F   C  ++  GR  FAK +  ++ ++K V+ +   +LV  F +VL +C   +D+ PA+  M +CFT+Y
Sbjct:  113 REFMKAYVEKLFHGKEDFDQEEKARFGELCSGENGKGREWFAKYVSVQRCNSKCVSEQTFYRLVQSFAVVLFECYQMDDYVPAKHLMTMCFTYY 206          
BLAST of SBF2 domain-containing protein vs. Ensembl Cavefish
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:103043002])

HSP 1 Score: 94.3597 bits (233), Expect = 3.016e-20
Identity = 50/119 (42.02%), Postives = 73/119 (61.34%), Query Frame = 1
Query: 1045 YLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTT--------NDPEKALIQDKE-------FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT        ++ EK     +E         EN+ FGQL TFT NM+A GL++++  DFL+KQA + +L  E+ +L+  +I++
Sbjct:  306 YLYTHLKQQPIWHTLRFWNAAFFDAVHCERNKR-SPTTRRTAEEEKDEREKWCHMTQEEKDDSSRIDENITFGQLGTFTHNMLAFGLTKKLCNDFLKKQAVIGHLNEEQYKLLSDHIEQ 423          

HSP 2 Score: 60.4622 bits (145), Expect = 2.337e-9
Identity = 29/94 (30.85%), Postives = 52/94 (55.32%), Query Frame = 1
Query:  733 KSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            + FM   VE++F       + +K+ F   C  ++  GR  FAK +  ++ ++K V+ +   +LV  F +VL +C   +D+ PA+  M +CFT+Y
Sbjct:  113 REFMKAYVEKLFHGKEDFDQEEKARFGELCSGENGKGREWFAKYVSVQRCNSKCVSEQTFYRLVQSFAVVLFECYQMDDYVPAKHLMTMCFTYY 206          
BLAST of SBF2 domain-containing protein vs. Ensembl Nematostella
Match: EDO34916 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMZ6])

HSP 1 Score: 49.2914 bits (116), Expect = 1.326e-7
Identity = 20/37 (54.05%), Postives = 28/37 (75.68%), Query Frame = 1
Query: 1024 DGCPVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHER 1134
            D  P   +L + L +QPIWQS+R+WNAAFFES+ ++R
Sbjct:   17 DQTPQKEFLSVYLKNQPIWQSMRYWNAAFFESIHNDR 53          
BLAST of SBF2 domain-containing protein vs. Ensembl Medaka
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:101158761])

HSP 1 Score: 107.071 bits (266), Expect = 8.384e-25
Identity = 58/135 (42.96%), Postives = 80/135 (59.26%), Query Frame = 1
Query:  988 NLCFTFYVEAVNDGCPVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKA------LIQDKE------FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
            NL F+ + EA  +      YLY  L  QPIW +LRFWNAAFF+++  ER K+   T +D EK        +  KE        EN+AFGQL TFT NM+A GLS+++ +DFL+KQA + NL  E+ + +   I+K
Sbjct:  235 NLFFSSFSEAPEEKKEEKVYLYTHLRQQPIWHTLRFWNAAFFDAVHCERTKRSPTTRSDEEKDKREKWDHMSQKERDDTSKIDENIAFGQLGTFTHNMLAFGLSKKLCMDFLKKQAVIGNLNEEQYKQLSDYIEK 369          

HSP 2 Score: 62.003 bits (149), Expect = 7.171e-10
Identity = 32/99 (32.32%), Postives = 54/99 (54.55%), Query Frame = 1
Query:  718 ETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            ET + + FM   V +IF+ N    + +K+ F   C  ++  GR  FAK +  ++  +K V+     +LV  F +VL +C   +D+ PA+  M +CFT+Y
Sbjct:   69 ETVEMRQFMKVYVGKIFNGNEDFDQEEKARFGELCSGENGKGREWFAKYVTAQRCHSKCVSEGTFYRLVQSFAVVLFECFQLDDYSPAKNLMTMCFTYY 167          
BLAST of SBF2 domain-containing protein vs. Ensembl Medaka
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:101158761])

HSP 1 Score: 103.99 bits (258), Expect = 1.486e-23
Identity = 51/110 (46.36%), Postives = 72/110 (65.45%), Query Frame = 1
Query: 1042 TYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDK-----EFQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
             YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT +    + Q +     +  EN+AFGQL TFT NM+A GLS+++ +DFL+KQA + NL  E+ + +   I+K
Sbjct:  300 VYLYTHLRQQPIWHTLRFWNAAFFDAVHCERTKR-SPTTREKWDHMSQKERDDTSKIDENIAFGQLGTFTHNMLAFGLSKKLCMDFLKKQAVIGNLNEEQYKQLSDYIEK 408          

HSP 2 Score: 62.003 bits (149), Expect = 8.349e-10
Identity = 32/99 (32.32%), Postives = 54/99 (54.55%), Query Frame = 1
Query:  718 ETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            ET + + FM   V +IF+ N    + +K+ F   C  ++  GR  FAK +  ++  +K V+     +LV  F +VL +C   +D+ PA+  M +CFT+Y
Sbjct:  110 ETVEMRQFMKVYVGKIFNGNEDFDQEEKARFGELCSGENGKGREWFAKYVTAQRCHSKCVSEGTFYRLVQSFAVVLFECFQLDDYSPAKNLMTMCFTYY 208          
BLAST of SBF2 domain-containing protein vs. Ensembl Medaka
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:101158761])

HSP 1 Score: 100.908 bits (250), Expect = 1.566e-22
Identity = 48/96 (50.00%), Postives = 65/96 (67.71%), Query Frame = 1
Query: 1042 TYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDK-----EFQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANL 1314
             YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT +    + Q +     +  EN+AFGQL TFT NM+A GLS+++ +DFL+KQA + NL
Sbjct:  300 VYLYTHLRQQPIWHTLRFWNAAFFDAVHCERTKR-SPTTREKWDHMSQKERDDTSKIDENIAFGQLGTFTHNMLAFGLSKKLCMDFLKKQAVIGNL 394          

HSP 2 Score: 62.003 bits (149), Expect = 8.429e-10
Identity = 32/99 (32.32%), Postives = 54/99 (54.55%), Query Frame = 1
Query:  718 ETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            ET + + FM   V +IF+ N    + +K+ F   C  ++  GR  FAK +  ++  +K V+     +LV  F +VL +C   +D+ PA+  M +CFT+Y
Sbjct:  110 ETVEMRQFMKVYVGKIFNGNEDFDQEEKARFGELCSGENGKGREWFAKYVTAQRCHSKCVSEGTFYRLVQSFAVVLFECFQLDDYSPAKNLMTMCFTYY 208          
BLAST of SBF2 domain-containing protein vs. Ensembl Medaka
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:101158761])

HSP 1 Score: 99.7525 bits (247), Expect = 4.177e-22
Identity = 55/120 (45.83%), Postives = 74/120 (61.67%), Query Frame = 1
Query: 1042 TYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTN---DPEKA------LIQDKE------FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQK 1356
             YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT+   D EK        +  KE        EN+AFGQL TFT NM+A GLS+++ +DFL+KQA + NL  E+ + +   I+K
Sbjct:  300 VYLYTHLRQQPIWHTLRFWNAAFFDAVHCERTKR-SPTTSGAQDEEKDKREKWDHMSQKERDDTSKIDENIAFGQLGTFTHNMLAFGLSKKLCMDFLKKQAVIGNLNEEQYKQLSDYIEK 418          

HSP 2 Score: 62.003 bits (149), Expect = 8.035e-10
Identity = 32/99 (32.32%), Postives = 54/99 (54.55%), Query Frame = 1
Query:  718 ETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            ET + + FM   V +IF+ N    + +K+ F   C  ++  GR  FAK +  ++  +K V+     +LV  F +VL +C   +D+ PA+  M +CFT+Y
Sbjct:  110 ETVEMRQFMKVYVGKIFNGNEDFDQEEKARFGELCSGENGKGREWFAKYVTAQRCHSKCVSEGTFYRLVQSFAVVLFECFQLDDYSPAKNLMTMCFTYY 208          
BLAST of SBF2 domain-containing protein vs. Ensembl Medaka
Match: zgc:91860 (KIAA0513 ortholog [Source:NCBI gene;Acc:101158761])

HSP 1 Score: 96.6709 bits (239), Expect = 5.126e-21
Identity = 52/106 (49.06%), Postives = 67/106 (63.21%), Query Frame = 1
Query: 1042 TYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTN---DPEKA------LIQDKE------FQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANL 1314
             YLY  L  QPIW +LRFWNAAFF+++  ER K+  PTT+   D EK        +  KE        EN+AFGQL TFT NM+A GLS+++ +DFL+KQA + NL
Sbjct:  300 VYLYTHLRQQPIWHTLRFWNAAFFDAVHCERTKR-SPTTSGAQDEEKDKREKWDHMSQKERDDTSKIDENIAFGQLGTFTHNMLAFGLSKKLCMDFLKKQAVIGNL 404          

HSP 2 Score: 62.003 bits (149), Expect = 8.152e-10
Identity = 32/99 (32.32%), Postives = 54/99 (54.55%), Query Frame = 1
Query:  718 ETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFC--KHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY 1008
            ET + + FM   V +IF+ N    + +K+ F   C  ++  GR  FAK +  ++  +K V+     +LV  F +VL +C   +D+ PA+  M +CFT+Y
Sbjct:  110 ETVEMRQFMKVYVGKIFNGNEDFDQEEKARFGELCSGENGKGREWFAKYVTAQRCHSKCVSEGTFYRLVQSFAVVLFECFQLDDYSPAKNLMTMCFTYY 208          
BLAST of SBF2 domain-containing protein vs. Planmine SMEST
Match: SMESG000078604.1 (SMESG000078604.1)

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 335/337 (99.41%), Postives = 336/337 (99.70%), Query Frame = 1
Query:  355 MSAIRGLFKQVAGDEXXXXXXXXXXXXXXXKGMSGFLAGTTNFFNSVQAKKDDLMSDLTNKLGNLTPFNEEPKKKSFGKEDDGDSSASEYGDGGDRPVYAETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFCKHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFYVEAVNDGCPVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKEFQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQKWTS 1365
            MSAIRGLFKQVAGDESNSTNNNNSDNCNSNKGMSGFLAGTTNFFNSVQAKKDDLMSDLTNKLGNLTPFNEEPKKKSFGKEDDGDSSASEYGDGGDRPVYAETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFCKHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFYVEAVNDGCPVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTT+DPEKALIQDKEFQENVAF QLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQKWTS
Sbjct:    1 MSAIRGLFKQVAGDESNSTNNNNSDNCNSNKGMSGFLAGTTNFFNSVQAKKDDLMSDLTNKLGNLTPFNEEPKKKSFGKEDDGDSSASEYGDGGDRPVYAETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFCKHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFYVEAVNDGCPVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTDDPEKALIQDKEFQENVAFSQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQKWTS 337          
BLAST of SBF2 domain-containing protein vs. Planmine SMEST
Match: SMESG000055799.1 (SMESG000055799.1)

HSP 1 Score: 109.768 bits (273), Expect = 2.905e-25
Identity = 74/257 (28.79%), Postives = 127/257 (49.42%), Query Frame = 1
Query:  598 DGDSSASEYGDGGDRPVYAETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFCKHHTGRSNFAKAIDQ-KKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY--VEAVNDGCPVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKEFQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQKW 1359
            D +SS SEYGD GD+P+Y +  G + RR+               ++SF   +     D +S   E   + F  + +  +G+    K +++ +   +K+V+  +  +L+ +F  VL +C  +E+F PAR  M + F+ Y  V A ++      YL   +S  PIW+S++FWN  FF ++   R+K+     N    A   D    + VAF QL      M +LG+  E+  +F+RKQ  + NL  ++   ++  I+ W
Sbjct:  240 DDNSSPSEYGDRGDQPIYGD-HGQKIRRI---------------FRSFCGNIY---IDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRN---SANTTDA---DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIESW 471          
BLAST of SBF2 domain-containing protein vs. Planmine SMEST
Match: SMESG000055799.1 (SMESG000055799.1)

HSP 1 Score: 107.071 bits (266), Expect = 2.330e-24
Identity = 73/257 (28.40%), Postives = 125/257 (48.64%), Query Frame = 1
Query:  598 DGDSSASEYGDGGDRPVYAETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKSMFATFCKHHTGRSNFAKAIDQ-KKFSNKQVTPKIMQKLVDIFNIVLPDCNSSEDFRPARIFMNLCFTFY--VEAVNDGCPVLTYLYMSLSHQPIWQSLRFWNAAFFESLGHERAKKPEPTTNDPEKALIQDKEFQENVAFGQLSTFTWNMVALGLSREIVLDFLRKQATVANLPREKCRLIRANIQKW 1359
            D +SS SEYGD GD+P+Y    G  G+++                +SF   +     D +S   E   + F  + +  +G+    K +++ +   +K+V+  +  +L+ +F  VL +C  +E+F PAR  M + F+ Y  V A ++      YL   +S  PIW+S++FWN  FF ++   R+K+     N    A   D    + VAF QL      M +LG+  E+  +F+RKQ  + NL  ++   ++  I+ W
Sbjct:  240 DDNSSPSEYGDRGDQPIY----GDHGQKIR---------------RSFCGNIY---IDGHSLNDEETFNKFKKYIQSQSGKCWLGKLVEKYQSIHSKKVSEVVFYRLLQLFTFVLLECYENEEFLPARDLMLVAFSCYTVVHAGSNQIAHNFYLSSFISCHPIWKSIQFWNVCFFNAVQEVRSKRATMRRN---SANTTDA---DGVAFHQLQVHLNYMRSLGIPIELCSEFVRKQVNIVNLTEDEMNRLKEVIESW 468          
The following BLAST results are available for this feature:
BLAST of SBF2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KIAA05138.054e-2545.87KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058][more]
KIAA05132.357e-2345.87KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058][more]
KIAA05131.703e-2143.22KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058][more]
KIAA05131.703e-2143.22KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058][more]
KIAA05132.279e-1235.58KIAA0513 [Source:HGNC Symbol;Acc:HGNC:29058][more]
back to top
BLAST of SBF2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SBF2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG173781.503e-1837.07gene:FBgn0031858 transcript:FBtr0079336[more]
CG173781.522e-1837.07gene:FBgn0031858 transcript:FBtr0332335[more]
CG173781.522e-1837.07gene:FBgn0031858 transcript:FBtr0079337[more]
back to top
BLAST of SBF2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:918603.505e-2447.71zgc:91860 [Source:ZFIN;Acc:ZDB-GENE-040704-34][more]
zgc:918603.167e-2245.38zgc:91860 [Source:ZFIN;Acc:ZDB-GENE-040704-34][more]
zgc:918603.167e-2245.38zgc:91860 [Source:ZFIN;Acc:ZDB-GENE-040704-34][more]
back to top
BLAST of SBF2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
kiaa05131.546e-2447.71KIAA0513 [Source:NCBI gene;Acc:100125070][more]
kiaa05134.336e-2245.38KIAA0513 [Source:NCBI gene;Acc:100125070][more]
kiaa05134.655e-2245.38KIAA0513 [Source:NCBI gene;Acc:100125070][more]
back to top
BLAST of SBF2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
6430548M08Rik1.910e-2345.45RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:... [more]
6430548M08Rik1.577e-2142.86RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:... [more]
6430548M08Rik1.577e-2142.86RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:... [more]
6430548M08Rik3.272e-1433.96RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:... [more]
6430548M08Rik1.167e-1333.96RIKEN cDNA 6430548M08 gene [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of SBF2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|O60268|K0513_HUMAN8.178e-2143.22Uncharacterized protein KIAA0513 OS=Homo sapiens O... [more]
sp|Q8R0A7|K0513_MOUSE1.103e-2042.86Uncharacterized protein KIAA0513 OS=Mus musculus O... [more]
back to top
BLAST of SBF2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7YCD63.065e-7141.33SBF2 domain-containing protein OS=Clonorchis sinen... [more]
A0A4S2LEA42.134e-6941.04SBF2 domain-containing protein OS=Opisthorchis fel... [more]
A0A074ZSV11.445e-6739.88SBF2 domain-containing protein OS=Opisthorchis viv... [more]
A0A5J4NV634.562e-6742.29SBF2 domain-containing protein OS=Paragonimus west... [more]
A0A504YX167.883e-6640.45SBF2 domain-containing protein OS=Fasciola giganti... [more]
back to top
BLAST of SBF2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
zgc:918602.403e-2244.04KIAA0513 ortholog [Source:NCBI gene;Acc:103043002][more]
zgc:918603.180e-2244.04KIAA0513 ortholog [Source:NCBI gene;Acc:103043002][more]
zgc:918603.016e-2042.02KIAA0513 ortholog [Source:NCBI gene;Acc:103043002][more]
back to top
BLAST of SBF2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SBF2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SBF2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO349161.326e-754.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SBF2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:918608.384e-2542.96KIAA0513 ortholog [Source:NCBI gene;Acc:101158761][more]
zgc:918601.486e-2346.36KIAA0513 ortholog [Source:NCBI gene;Acc:101158761][more]
zgc:918601.566e-2250.00KIAA0513 ortholog [Source:NCBI gene;Acc:101158761][more]
zgc:918604.177e-2245.83KIAA0513 ortholog [Source:NCBI gene;Acc:101158761][more]
zgc:918605.126e-2149.06KIAA0513 ortholog [Source:NCBI gene;Acc:101158761][more]
back to top
BLAST of SBF2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000078604.10.000e+099.41SMESG000078604.1[more]
SMESG000055799.12.905e-2528.79SMESG000055799.1[more]
SMESG000055799.12.330e-2428.40SMESG000055799.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014318 ID=SMED30014318|Name=SBF2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1801bp
CTTCAAGGGATGCAAAAAATTATTTTCTCTCCAATACATACTGAAATTAA
AGAATGCTTAAACAATAAACGCGTACACAGCGGTTTAATTTATTTTAGAC
TTTACAAATACACACACAATAAATCTGAGAAGCAGCATTTCAGAGTTATC
GATTAAATTTCCTCACCAAGTCTTCTGCACAAGTTCCTATTGGATAATTA
ATACTTCTCAAACAATGTCTTATCAAATCGAGATTTGTTGACAAAGAATC
GTTTGAATTTTGTTCCCTAAGCTAATATATAGTATAACAAATATTATTAA
ATTTATCATCAATCGATTGCATATTTACAATTCGCTCTAAATTATCTAAA
TAAAATGAGCGCTATCAGAGGCTTATTCAAACAAGTGGCGGGCGATGAAT
CAAATTCTACCAACAATAACAATTCAGATAACTGTAACTCAAACAAAGGA
ATGTCTGGATTTCTCGCTGGAACTACAAACTTTTTCAATTCTGTCCAGGC
CAAGAAAGATGATTTAATGAGCGATTTGACAAACAAACTTGGCAATTTAA
CACCGTTCAATGAAGAACCGAAAAAGAAATCATTCGGAAAAGAAGACGAC
GGAGATAGTTCTGCTTCTGAATATGGAGATGGGGGTGATAGGCCGGTTTA
TGCGGAAACTGCTGGAAGCGAGGGTAGGAGATTATCTTTGGATAGCGTTG
ACAGTTTACCAGAAGATGAAACAAAAAAATACAAAAGCTTTATGAATCAA
TTGGTGGAAGAAATTTTTGATACAAACTCGTTTTTGCAAGAATCAAAGAA
ATCCATGTTTGCCACATTTTGTAAGCATCACACTGGACGATCAAATTTCG
CAAAGGCAATCGATCAGAAGAAATTTTCAAACAAACAAGTCACCCCTAAA
ATAATGCAAAAGTTGGTTGACATCTTCAATATTGTCTTACCCGACTGTAA
TAGCTCTGAAGACTTCAGGCCTGCCAGAATTTTTATGAATTTGTGTTTTA
CATTTTATGTAGAAGCTGTCAATGACGGATGTCCTGTTTTGACATATCTC
TATATGAGCCTCAGTCATCAACCGATTTGGCAGTCTCTTAGGTTTTGGAA
TGCAGCTTTTTTTGAATCCCTAGGTCACGAAAGAGCAAAAAAGCCTGAAC
CTACTACAAACGATCCTGAAAAAGCACTGATTCAAGATAAAGAATTTCAG
GAAAATGTCGCGTTTGGTCAATTAAGCACCTTTACATGGAACATGGTAGC
TCTTGGATTAAGCAGAGAAATCGTACTTGATTTTCTTAGGAAGCAAGCCA
CTGTTGCAAATCTACCACGAGAAAAATGCAGACTCATTAGAGCGAATATT
CAAAAATGGACCTCTTAACTGGTCAAAGACTCATCGGATGAATCGTGATT
GATGTAGACATTTCCACAGACCTTTTCATGGGATACTTCTGGTTTTTGTT
TCTGATTGAGATTCTTGTCCTATTCGTATTATAGTTATGACATCGTTCAG
TAGTGGAAAATTTGCAGCTTCATGTTCCTCGATTATCAAATCTTTTAGAA
CGAGTAAATTTATTTGAAATTTTCTTTTTCTTTTCTCTGACATATGTGAA
TGAACTTTTTCCACTTTTTCGGCAGAATGGAGTGTTTTAGCGAAATCATT
CATTTTTAAAGGAGTTTTACAGGTGTTTTATTCGTTTAATAATTGTTTGT
GAATTTTTGGATGTTTGATCTGTATTGTGATGTGTTACAACTTGTCGTGT
AATCTATACTTAGATTTAATTTTAATAAATTATGTAGACTTCAAAAAAAA
A
back to top

protein sequence of SMED30014318-orf-1

>SMED30014318-orf-1 ID=SMED30014318-orf-1|Name=SMED30014318-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=338bp
MSAIRGLFKQVAGDESNSTNNNNSDNCNSNKGMSGFLAGTTNFFNSVQAK
KDDLMSDLTNKLGNLTPFNEEPKKKSFGKEDDGDSSASEYGDGGDRPVYA
ETAGSEGRRLSLDSVDSLPEDETKKYKSFMNQLVEEIFDTNSFLQESKKS
MFATFCKHHTGRSNFAKAIDQKKFSNKQVTPKIMQKLVDIFNIVLPDCNS
SEDFRPARIFMNLCFTFYVEAVNDGCPVLTYLYMSLSHQPIWQSLRFWNA
AFFESLGHERAKKPEPTTNDPEKALIQDKEFQENVAFGQLSTFTWNMVAL
GLSREIVLDFLRKQATVANLPREKCRLIRANIQKWTS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000463cholinergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR039872KIAA0513
IPR022096SBF1/SBF2
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
Vocabulary: biological process
TermDefinition
GO:0005975carbohydrate metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022096SBF1/SBF2 domainPFAMPF12335SBF2coord: 133..278
e-value: 9.5E-9
score: 35.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 12..28
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 63..117
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 72..86
IPR039872Uncharacterized protein KIAA0513PANTHERPTHR13663UNCHARACTERIZEDcoord: 230..336
coord: 119..228