Tubulin alpha chain

Overview
NameTubulin alpha chain
Smed IDSMED30014305
Length (bp)753
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tubulin alpha chain (SMED30014305) t-SNE clustered cells

Violin plots show distribution of expression levels for Tubulin alpha chain (SMED30014305) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tubulin alpha chain (SMED30014305) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tubulin alpha chain (SMED30014305) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014305

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30014305SMESG000039778.1 SmedASXL_010324SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30014305SMESG000039778.1 SmedASXL_010323SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30014305SMESG000009951.1 dd_Smed_v4_10947_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
testis primordiumSMED30014305SMESG000039778.1 PL05008B1A11_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1A (tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:20766])

HSP 1 Score: 360.918 bits (925), Expect = 2.248e-124
Identity = 164/207 (79.23%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  198 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 404          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA4A (tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:12407])

HSP 1 Score: 361.303 bits (926), Expect = 3.097e-124
Identity = 166/210 (79.05%), Postives = 186/210 (88.57%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEE 631
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+ E+
Sbjct:  218 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYED 427          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 361.688 bits (927), Expect = 3.376e-124
Identity = 165/207 (79.71%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA3D (tubulin alpha 3d [Source:HGNC Symbol;Acc:HGNC:24071])

HSP 1 Score: 361.688 bits (927), Expect = 3.376e-124
Identity = 165/207 (79.71%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA4A (tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:12407])

HSP 1 Score: 361.303 bits (926), Expect = 4.489e-124
Identity = 166/210 (79.05%), Postives = 186/210 (88.57%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEE 631
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+ E+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYED 442          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-4 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:G5EDD4])

HSP 1 Score: 357.066 bits (915), Expect = 8.202e-123
Identity = 161/214 (75.23%), Postives = 187/214 (87.38%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIEDN 643
            Q+VSSITASLRFDGALNVDLNEFQTNLVP+PRIHFPLASY PLIS +K  HE LSV++I N+CF+ +NQMVKCDPR GKYMA C+L+RGDVVPKDVN AI ++K+KRS++FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAW+RL+ +FDLM+ KRAFVHWYVGEGMEEGEF+EARED+  LE+DY EV  D+ E +E++
Sbjct:  231 QVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLASYTPLISAEKAYHEALSVNDITNSCFEPANQMVKCDPRNGKYMAVCLLYRGDVVPKDVNTAITAIKTKRSVQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADSNEGLEED 444          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: mec-12 (Tubulin alpha-3 chain Detyrosinated tubulin alpha-3 chain [Source:UniProtKB/Swiss-Prot;Acc:P91910])

HSP 1 Score: 355.14 bits (910), Expect = 5.509e-122
Identity = 163/210 (77.62%), Postives = 183/210 (87.14%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEE 631
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+++P+IS +K  HE LSV+EI N CF+  NQMVKCDPR GKYMA C+LFRGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+ E+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMCFEPHNQMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSMED 442          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 354.755 bits (909), Expect = 6.791e-122
Identity = 160/207 (77.29%), Postives = 183/207 (88.41%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            Q+VSSITASLRFDGALNVDLNEFQTNLVP+PRIHFPLA+Y PLIS +K  HE LSVS+I N+CF+ +NQMVKCDPR GKYMA C+L+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAW+RL+ +FDLM+ KRAFVHWYVGEGMEEGEF+EARED+  LE+DY EV  D+
Sbjct:  231 QVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADS 437          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 354.755 bits (909), Expect = 6.791e-122
Identity = 160/207 (77.29%), Postives = 183/207 (88.41%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            Q+VSSITASLRFDGALNVDLNEFQTNLVP+PRIHFPLA+Y PLIS +K  HE LSVS+I N+CF+ +NQMVKCDPR GKYMA C+L+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAW+RL+ +FDLM+ KRAFVHWYVGEGMEEGEF+EARED+  LE+DY EV  D+
Sbjct:  231 QVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADS 437          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 354.755 bits (909), Expect = 6.791e-122
Identity = 160/207 (77.29%), Postives = 183/207 (88.41%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            Q+VSSITASLRFDGALNVDLNEFQTNLVP+PRIHFPLA+Y PLIS +K  HE LSVS+I N+CF+ +NQMVKCDPR GKYMA C+L+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAW+RL+ +FDLM+ KRAFVHWYVGEGMEEGEF+EARED+  LE+DY EV  D+
Sbjct:  231 QVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADS 437          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub85E (gene:FBgn0003886 transcript:FBtr0082087)

HSP 1 Score: 362.073 bits (928), Expect = 1.155e-124
Identity = 165/214 (77.10%), Postives = 189/214 (88.32%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIEDN 643
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE L+V+EI NACF+ +NQMVKCDPR+GKYMACCML+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEF+EARED+  LE+DY EV  D+  E+ ++
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISVEKAYHEQLTVAEITNACFEPANQMVKCDPRRGKYMACCMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFAEAREDLAALEKDYEEVGIDSTTELGED 446          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84B (gene:FBgn0003884 transcript:FBtr0081639)

HSP 1 Score: 360.147 bits (923), Expect = 7.042e-124
Identity = 164/207 (79.23%), Postives = 183/207 (88.41%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPL +YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84D (gene:FBgn0003885 transcript:FBtr0081538)

HSP 1 Score: 356.681 bits (914), Expect = 1.696e-122
Identity = 163/207 (78.74%), Postives = 182/207 (87.92%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPL +YAP+IS +K  HE LSV+EI NACF+ +NQMVK DPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub67C (gene:FBgn0087040 transcript:FBtr0076393)

HSP 1 Score: 333.569 bits (854), Expect = 2.945e-113
Identity = 151/213 (70.89%), Postives = 178/213 (83.57%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIED 640
            QIVSS TASLRF G++NVDLNEFQTNLVPFPRIHFPL +YAPL+S ++  HE  +++ + NACF+ SN MVKCDPR GK+MACCML+RGDVVPKDVN A++++KSKR I+FVDWCPTGFK+GINY+ P  VPD DL K SRA CMLSNTTAI  A++ L+ +FDLMFKKRAFVHWYVGEGMEEGEF+EARE+I  LERD+ EV  D  EE  D
Sbjct:  244 QIVSSTTASLRFSGSMNVDLNEFQTNLVPFPRIHFPLVAYAPLMSAERSAHEQHAITTLTNACFESSNMMVKCDPRAGKFMACCMLYRGDVVPKDVNAAVSAIKSKRHIQFVDWCPTGFKIGINYEKPAFVPDGDLAKTSRACCMLSNTTAISVAFSNLSYKFDLMFKKRAFVHWYVGEGMEEGEFTEARENIAVLERDFEEVGLDNAEEGGD 456          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: CG7794 (gene:FBgn0038565 transcript:FBtr0083540)

HSP 1 Score: 231.491 bits (589), Expect = 1.735e-73
Identity = 104/203 (51.23%), Postives = 139/203 (68.47%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEV 610
            Q+VSS TAS RF G   V   E QTNLVP+PRIH+PL +YAPL+     Q  N+S +++   CF +SNQMV+C+P  GKYMA  +L+RGD+ P ++N A+ ++K  RS  FVDW PTGFK+G++   P  VP  DL   +RA   +SN T I  AW RL  +FD ++++RAFV+ YVGEG+EEG F+EA E+I  L  DY+EV
Sbjct:  234 QVVSSFTASQRFGGGSTVSFQELQTNLVPYPRIHYPLINYAPLVPISHSQFVNMSTAQLTGQCFQMSNQMVRCNPSHGKYMASVLLYRGDIAPNEINTALENIKRNRSFRFVDWSPTGFKIGVSPMPPYYVPGGDLAPTNRACVAISNNTNIRIAWCRLVNKFDKLYQRRAFVYHYVGEGLEEGNFNEASENICQLVHDYLEV 436          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l4 (tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-040426-860])

HSP 1 Score: 360.918 bits (925), Expect = 2.903e-126
Identity = 164/207 (79.23%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV++I NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:   80 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDS 286          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l (tubulin, alpha 8 like [Source:ZFIN;Acc:ZDB-GENE-030131-9167])

HSP 1 Score: 363.999 bits (933), Expect = 2.990e-125
Identity = 167/214 (78.04%), Postives = 187/214 (87.38%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIEDN 643
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPL +Y+P+IS +K  HE LSVSEI +ACF+ SNQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+ E+ E+ 
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVSEITSACFEPSNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIANIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGADSTEDGEEG 446          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: si:ch73-199e17.1 (si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-8])

HSP 1 Score: 362.073 bits (928), Expect = 1.691e-124
Identity = 166/214 (77.57%), Postives = 187/214 (87.38%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIEDN 643
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV++I NACF+ SNQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+  + ED 
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDSIGDDEDG 446          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba1b (tubulin, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030822-1])

HSP 1 Score: 361.303 bits (926), Expect = 3.587e-124
Identity = 165/209 (78.95%), Postives = 185/209 (88.52%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKE 628
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSVSEI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  ++ E
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGAESVE 441          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba1b (tubulin, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030822-1])

HSP 1 Score: 361.303 bits (926), Expect = 3.587e-124
Identity = 165/209 (78.95%), Postives = 185/209 (88.52%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKE 628
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSVSEI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  ++ E
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGAESVE 441          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: faah.3 (fatty acid amide hydrolase, gene 3 [Source:Xenbase;Acc:XB-GENE-997956])

HSP 1 Score: 363.229 bits (931), Expect = 8.550e-125
Identity = 167/209 (79.90%), Postives = 184/209 (88.04%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKE 628
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPL +Y+P+IS +K  HE LSVSEI NACF+ SNQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+ E
Sbjct:  234 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVSEITNACFEPSNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTAVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDSIE 442          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: jmjd8 (jumonji domain containing 8 [Source:Xenbase;Acc:XB-GENE-6070939])

HSP 1 Score: 361.303 bits (926), Expect = 9.200e-125
Identity = 165/207 (79.71%), Postives = 181/207 (87.44%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPL +YAP+IS  K  HE LSV++I NACF+  NQMVKCDPR GKYMACCML+RGDVVPKDVN AIAS+K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLMF KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  182 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPIISANKAYHEQLSVADITNACFEPCNQMVKCDPRHGKYMACCMLYRGDVVPKDVNVAIASIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMFAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 388          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415])

HSP 1 Score: 362.844 bits (930), Expect = 9.951e-125
Identity = 166/207 (80.19%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSVSEI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415])

HSP 1 Score: 362.844 bits (930), Expect = 1.063e-124
Identity = 166/207 (80.19%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSVSEI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  232 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDS 438          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415])

HSP 1 Score: 362.844 bits (930), Expect = 1.795e-124
Identity = 166/207 (80.19%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSVSEI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  243 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDS 449          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba3a (tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:1095406])

HSP 1 Score: 361.688 bits (927), Expect = 2.318e-124
Identity = 165/207 (79.71%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba3b (tubulin, alpha 3B [Source:MGI Symbol;Acc:MGI:1095408])

HSP 1 Score: 361.688 bits (927), Expect = 2.318e-124
Identity = 165/207 (79.71%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba4a (tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:1095410])

HSP 1 Score: 361.303 bits (926), Expect = 3.082e-124
Identity = 166/210 (79.05%), Postives = 186/210 (88.57%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEE 631
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+ E+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYED 442          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1c (tubulin, alpha 1C [Source:MGI Symbol;Acc:MGI:1095409])

HSP 1 Score: 361.303 bits (926), Expect = 3.324e-124
Identity = 164/209 (78.47%), Postives = 185/209 (88.52%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKE 628
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE L+V+EI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+ E
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSAE 441          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1b (tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:107804])

HSP 1 Score: 360.918 bits (925), Expect = 4.502e-124
Identity = 165/207 (79.71%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P09645|TBA8_CHICK (Tubulin alpha-8 chain (Fragment) OS=Gallus gallus OX=9031 PE=3 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 2.004e-125
Identity = 165/207 (79.71%), Postives = 183/207 (88.41%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPL +Y+P+IS +K  HE LSVSEI NACF+ SNQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  108 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVSEITNACFEPSNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDS 314          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P02552|TBA1_CHICK (Tubulin alpha-1 chain (Fragment) OS=Gallus gallus OX=9031 PE=1 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 6.685e-124
Identity = 164/207 (79.23%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  194 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 400          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P06604|TBA2_DROME (Tubulin alpha-2 chain OS=Drosophila melanogaster OX=7227 GN=alphaTub85E PE=1 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 1.157e-123
Identity = 165/214 (77.10%), Postives = 189/214 (88.32%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIEDN 643
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE L+V+EI NACF+ +NQMVKCDPR+GKYMACCML+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEF+EARED+  LE+DY EV  D+  E+ ++
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISVEKAYHEQLTVAEITNACFEPANQMVKCDPRRGKYMACCMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFAEAREDLAALEKDYEEVGIDSTTELGED 446          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q3ZCJ7|TBA1C_BOVIN (Tubulin alpha-1C chain OS=Bos taurus OX=9913 GN=TUBA1C PE=1 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 1.236e-123
Identity = 164/209 (78.47%), Postives = 185/209 (88.52%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKE 628
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTA+ EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+ E
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSAE 441          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P36220|TBA_TORMA (Tubulin alpha chain OS=Torpedo marmorata OX=7788 PE=2 SV=1)

HSP 1 Score: 362.073 bits (928), Expect = 1.361e-123
Identity = 166/207 (80.19%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSVSEI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A4UUE3 (Tubulin A (Fragment) OS=Hyriopsis cumingii OX=165450 PE=2 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 2.371e-124
Identity = 165/207 (79.71%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:    6 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 212          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A2G8LFY3 (Tubulin A OS=Stichopus japonicus OX=307972 GN=BSL78_03947 PE=4 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 2.604e-124
Identity = 164/214 (76.64%), Postives = 187/214 (87.38%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIEDN 643
            Q+VSS+TASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE L+V+EI NACFD +NQMVKCDPR GKYMACC+LFRGDVVPKDV+ AIA++K+KR+I+FVDWCPTGFKVGINYQ PTTVP  DL K+ RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGE SEAREDI  LE+DY EV  D+    ED+
Sbjct:    3 QVVSSVTASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPIISAEKAFHEQLTVAEITNACFDTANQMVKCDPRHGKYMACCVLFRGDVVPKDVSAAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTTVPGGDLPKLQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGELSEAREDIAALEKDYEEVGTDSTTGSEDS 216          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: R0KUT8 (Tubulin alpha-1C chain (Fragment) OS=Anas platyrhynchos OX=8839 GN=Anapl_18297 PE=3 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 2.637e-124
Identity = 167/214 (78.04%), Postives = 187/214 (87.38%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIEDN 643
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+ E  E+ 
Sbjct:   56 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSVEGDEEG 269          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A095A4Z8 (Tubulin alpha chain OS=Schistosoma haematobium OX=6185 GN=MS3_11213 PE=3 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 3.379e-124
Identity = 168/214 (78.50%), Postives = 187/214 (87.38%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIEDN 643
            QIVSSITASLRF GALNVDLNEFQTNLVP+PRIHFPL +YAP+IS +K  HE LSVSEI N+CF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K++RSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARLN +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LERDY EVA DT +   D+
Sbjct:   80 QIVSSITASLRFSGALNVDLNEFQTNLVPYPRIHFPLTTYAPIISAEKAFHEQLSVSEITNSCFEPANQMVKCDPRNGKYMACCLLYRGDVVPKDVNAAIANIKTRRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAISEAWARLNRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALERDYEEVAADTVDAHSDD 293          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A452RHK0 (Tubulin_C domain-containing protein OS=Ursus americanus OX=9643 PE=3 SV=1)

HSP 1 Score: 362.459 bits (929), Expect = 3.466e-124
Identity = 165/209 (78.95%), Postives = 185/209 (88.52%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKE 628
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+ E
Sbjct:   25 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSVE 233          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000005818.2 (pep primary_assembly:Astyanax_mexicanus-2.0:22:14648029:14650102:-1 gene:ENSAMXG00000008652.2 transcript:ENSAMXT00000005818.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 361.688 bits (927), Expect = 1.203e-124
Identity = 165/209 (78.95%), Postives = 185/209 (88.52%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKE 628
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE L+V+EI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+ E
Sbjct:  218 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSLE 426          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000042562.1 (tubulin alpha chain [Source:NCBI gene;Acc:103038315])

HSP 1 Score: 360.918 bits (925), Expect = 3.656e-124
Identity = 165/207 (79.71%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV++I NACF+ SNQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000019222.2 (tubulin alpha-1 chain [Source:NCBI gene;Acc:103031418])

HSP 1 Score: 360.918 bits (925), Expect = 3.781e-124
Identity = 165/207 (79.71%), Postives = 183/207 (88.41%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPL +Y+P+IS +K  HE LSV+EI +ACF+ SNQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  DT
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISTEKAYHEQLSVAEITSACFEPSNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIANIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDT 439          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: tuba1a (tubulin alpha chain [Source:NCBI gene;Acc:103037973])

HSP 1 Score: 360.918 bits (925), Expect = 3.857e-124
Identity = 165/207 (79.71%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSVSEI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000019223.2 (tubulin alpha-1 chain [Source:NCBI gene;Acc:103031418])

HSP 1 Score: 360.918 bits (925), Expect = 4.032e-124
Identity = 165/207 (79.71%), Postives = 183/207 (88.41%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPL +Y+P+IS +K  HE LSV+EI +ACF+ SNQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  DT
Sbjct:  234 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISTEKAYHEQLSVAEITSACFEPSNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIANIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDT 440          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 218.009 bits (554), Expect = 4.618e-70
Identity = 97/119 (81.51%), Postives = 110/119 (92.44%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGF 358
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGF
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGF 351          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001139.1 (pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 gene:ENSPMAG00000001018.1 transcript:ENSPMAT00000001139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.846 bits (538), Expect = 1.095e-67
Identity = 94/119 (78.99%), Postives = 108/119 (90.76%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGF 358
            Q+VSSITASLRFDGALNVDLNEFQTNLVP+PRIHFPL +YAP+IS +K  HE LSV+EI NACF+ SNQMVKCDPR GKYMACC+L+RGD+VPKDVN AIA +KS+R++ FVDWCPTGF
Sbjct:  238 QMVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLTTYAPVISAEKAYHEQLSVAEITNACFEPSNQMVKCDPRNGKYMACCLLYRGDIVPKDVNTAIAIIKSRRAVRFVDWCPTGF 356          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 125.176 bits (313), Expect = 3.182e-34
Identity = 61/168 (36.31%), Postives = 94/168 (55.95%), Query Frame = 2
Query:    8 VSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKR 511
            +S +T  LRF G LN DL +   N+VPFPR+HF +  +APL S+   Q+  L+V E+    FD  N M  CDPR G+Y+    +FRG +  K+V+  + ++++K S  FV+W P   K        T V D     +  +   + N+TAI E + R++ QF  MF+++
Sbjct:  216 MSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVK--------TAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRK 375          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001368.1 (pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-1 gene:ENSPMAG00000001230.1 transcript:ENSPMAT00000001368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 125.561 bits (314), Expect = 1.026e-33
Identity = 66/200 (33.00%), Postives = 111/200 (55.50%), Query Frame = 2
Query:    5 IVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVG-EGMEEGEFSEAREDIGCLERDY 601
            ++ ++T+S RF+G+LNVDLNE   NLVPFPR+H+ ++S  PL +   +      + ++ +  F   NQ+++ DPR+  Y+AC ++ RG+V   DV   I  LK   S+ FVDW   G+K G+    P   P         ++  L+N T +   +A +  +F  +++++A +H Y   EGME   F+EA   +  +  +Y
Sbjct:  265 LMLNMTSSSRFEGSLNVDLNEITMNLVPFPRLHYLVSSLTPLYALADVALPPRRLDQMFSDAFSKENQLLRVDPRRSLYLACALMVRGNVQLSDVRRNIERLKP--SLHFVDWNEEGWKTGLCSVPPVGYP--------HSLLALANNTCVKHTFADIQERFARLYRRKAHLHHYTDVEGMELSCFTEAASSLASVIEEY 454          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: tubg1 (tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-836])

HSP 1 Score: 82.8037 bits (203), Expect = 1.479e-18
Identity = 53/206 (25.73%), Postives = 101/206 (49.03%), Query Frame = 2
Query:    5 IVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQH-ENLSVSEIANACFDVSNQMVKCD-PRQGK--YMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGM---EEGEFSEAREDIGCLERDY 601
            I+S+ T +LR+ G +N DL     +L+P PR+HF +  Y PL + + +      +V ++        N MV     RQ    Y+A   + +G+V P  V+ ++  ++ ++   F+ W P   +V ++ ++P       +  +     M++N T+I   + R   Q+D + K+ AF+  +  E M   +  EF ++RE +  L  +Y
Sbjct:  230 IMSASTTTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQPKNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVALSRKSPYLTSAHRVSGL-----MMANHTSISSLFDRTCKQYDKLRKREAFLDQFRKEDMFKEDLSEFDDSREVVQQLIDEY 430          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 327.791 bits (839), Expect = 5.241e-112
Identity = 146/213 (68.54%), Postives = 177/213 (83.10%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIED 640
            Q+VSS+TASLRFDG+LNVDLNEFQTNLVP+PRIHFPL SY+P++SK K  HE+ SVSEI NACF+  NQMVKCDPR GKYMA C+L+RGDVV +DV  A+  +K+K++++ VDWCPTGFK+GI Y+ PT  P+  L  V RAVCMLSNTT+I EAW R++ +FDLM+ KRAFVHWYVGEGMEEGEF+EARED+  LERDYIEV  D+  E E+
Sbjct:  234 QVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPGNQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEPPTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDRKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYAEEEE 446          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 327.02 bits (837), Expect = 8.867e-112
Identity = 143/210 (68.10%), Postives = 177/210 (84.29%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEE 631
            Q++SS+TASLRFDG+LNVDLNEFQTNLVP+PRIHFPL SYAP++SKK+  HE+ SVSEI NACF+  NQMVKCDP +GKYMA C+L+RGDVV +DV  A+  +K+K++++ VDWCPTGFK+GI Y+ P+ +P  +L  V RAVCMLSNTTAI +AW R++ +FDLM+ KRAFVHWYVGEGMEEGEF+EARED+  LERDYIEV  D+  E
Sbjct:  234 QVISSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYAE 443          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 162.155 bits (409), Expect = 1.074e-47
Identity = 81/212 (38.21%), Postives = 118/212 (55.66%), Query Frame = 2
Query:    5 IVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIED 640
            ++S +T SLR+ G LN DL +   NLVPFPR+HF +  YAPL +       +L+V E+    FD  N M   DPR G+Y+     FRG V  K+V   +  ++SK S  FV+W P   +  +   AP          +  A   ++N+T+I E + R+  QF  MFK++AF+HWY  EGM+E EFSEA  ++  L  +Y +  E T E+ E+
Sbjct:  232 VMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIPNNVQTAVCSVAPQ--------GLDMAATFIANSTSIQELFKRVGDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSEYQQYQEATVEDDEE 435          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB4 (Gamma-tubulin; involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004202])

HSP 1 Score: 80.4925 bits (197), Expect = 7.675e-18
Identity = 59/215 (27.44%), Postives = 101/215 (46.98%), Query Frame = 2
Query:    5 IVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLIS---KKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWY-VGEGME-----EGEFSEAREDIGCLERDYIEVAEDT 622
            I+SS+T S+RF   +   ++   + L+P P +HF   S+ P  S      I H+  S  ++     D SN +V        Y        G+V P+ ++ A+  L+ +  I+F  W  +   V I  ++P      +  +VS    MLSN + +V  +      FD +F K AF++ Y VG+  +     + EF+E+RE +  L  DY+   +D+
Sbjct:  234 IISSVTNSIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLDPSNSLVSTAMNNPTYFNVYNTIIGNVEPRQISRAMTKLQQR--IKFPSWSSSAMHVNIGRRSPYLPLQPNENEVSG--MMLSNMSTVVNVFENACNTFDKVFAKGAFLNNYNVGDLFQSMQNVQDEFAESREVVQSLMEDYVAAEQDS 444          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO29379 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3T4])

HSP 1 Score: 362.844 bits (930), Expect = 1.785e-127
Identity = 165/207 (79.71%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:   80 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 286          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO29378 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3T3])

HSP 1 Score: 360.918 bits (925), Expect = 2.760e-126
Identity = 164/207 (79.23%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  113 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 319          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO44803 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT0])

HSP 1 Score: 361.688 bits (927), Expect = 8.249e-125
Identity = 165/207 (79.71%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO38066 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDY2])

HSP 1 Score: 361.303 bits (926), Expect = 8.624e-125
Identity = 165/207 (79.71%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO38064 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX8])

HSP 1 Score: 360.533 bits (924), Expect = 1.330e-124
Identity = 165/207 (79.71%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  223 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDS 429          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020049.2 (tubulin alpha-1B chain [Source:NCBI gene;Acc:101159587])

HSP 1 Score: 363.614 bits (932), Expect = 1.273e-125
Identity = 166/207 (80.19%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  DT
Sbjct:  198 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVKRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDT 404          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020614.2 (tubulin alpha-1A chain [Source:NCBI gene;Acc:105354455])

HSP 1 Score: 364.77 bits (935), Expect = 1.290e-125
Identity = 168/214 (78.50%), Postives = 188/214 (87.85%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIEDN 643
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+ E+I  N
Sbjct:  235 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDSIEDISYN 448          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000028969.1 (tubulin alpha-1C chain-like [Source:NCBI gene;Acc:101160296])

HSP 1 Score: 363.999 bits (933), Expect = 2.185e-125
Identity = 167/210 (79.52%), Postives = 186/210 (88.57%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEE 631
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSVSEI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+ E+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSLED 442          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000034557.1 (tubulin alpha chain [Source:NCBI gene;Acc:101168810])

HSP 1 Score: 362.073 bits (928), Expect = 1.407e-124
Identity = 166/207 (80.19%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSVSEI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGVDS 439          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000034480.1 (tubulin alpha-1C chain-like [Source:NCBI gene;Acc:101160296])

HSP 1 Score: 358.992 bits (920), Expect = 2.672e-124
Identity = 164/202 (81.19%), Postives = 181/202 (89.60%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIE 607
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSVSEI NACF+ +NQMVKCDPR GKYMACC+L+RGDVVPKDVN AIA++K+KRSI+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY E
Sbjct:  181 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEE 382          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000039778.1 (SMESG000039778.1)

HSP 1 Score: 451.055 bits (1159), Expect = 9.032e-160
Identity = 214/214 (100.00%), Postives = 214/214 (100.00%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIEDN 643
            QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIEDN
Sbjct:  233 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIEDN 446          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000039783.1 (SMESG000039783.1)

HSP 1 Score: 362.459 bits (929), Expect = 1.394e-125
Identity = 167/207 (80.68%), Postives = 185/207 (89.37%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSVSEI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIAS+K+KRSI+FVDWCPTGFKVGINYQ PT+VP  DL KV RA+CMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  185 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 391          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000039783.1 (SMESG000039783.1)

HSP 1 Score: 362.073 bits (928), Expect = 2.485e-125
Identity = 167/207 (80.68%), Postives = 185/207 (89.37%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSVSEI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIAS+K+KRSI+FVDWCPTGFKVGINYQ PT+VP  DL KV RA+CMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  195 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPNNQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIASIKTKRSIQFVDWCPTGFKVGINYQPPTSVPGGDLAKVQRALCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGIDS 401          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000017700.1 (SMESG000017700.1)

HSP 1 Score: 361.688 bits (927), Expect = 1.112e-124
Identity = 168/213 (78.87%), Postives = 186/213 (87.32%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDTKEEIED 640
            Q+VSSITASLRFDGALNVDLNEFQTNLVP+PRIHFPLA+YAP+IS  K  HE LSVSEI N+CF+ SNQMVKCDPR GKYM+CC+L+RGDVVPKDVN AI+ +KSK++I+FVDWCPTGFKVGIN Q PT VP  DL KV RAVCMLSNTTAI EAWARLN +FDLM+ KRAFVHWYVGEGMEEGEFSEAREDI  LERDY EV  D+ E +ED
Sbjct:  233 QVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLATYAPIISADKAFHEQLSVSEITNSCFEPSNQMVKCDPRHGKYMSCCLLYRGDVVPKDVNAAISFIKSKKTIQFVDWCPTGFKVGINSQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLNHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDIAALERDYEEVGIDSVELVED 445          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000005489.1 (SMESG000005489.1)

HSP 1 Score: 361.688 bits (927), Expect = 1.351e-124
Identity = 165/207 (79.71%), Postives = 184/207 (88.89%), Query Frame = 2
Query:    2 QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQHENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAIASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTTAIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDYIEVAEDT 622
            QIVSSITASLRFDGALNVDL EFQTNLVP+PRIHFPLA+YAP+IS +K  HE LSV+EI NACF+ +NQMVKCDPR GKYMACCML+RGDVVPKDVN AIA++K+KR+I+FVDWCPTGFKVGINYQ PT VP  DL KV RAVCMLSNTTAI EAWARL+ +FDLM+ KRAFVHWYVGEGMEEGEFSEARED+  LE+DY EV  D+
Sbjct:  233 QIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGMDS 439          
The following BLAST results are available for this feature:
BLAST of Tubulin alpha chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA1A2.248e-12479.23tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA4A3.097e-12479.05tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:1240... [more]
TUBA3C3.376e-12479.71tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
TUBA3D3.376e-12479.71tubulin alpha 3d [Source:HGNC Symbol;Acc:HGNC:2407... [more]
TUBA4A4.489e-12479.05tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:1240... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tba-48.202e-12375.23Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
mec-125.509e-12277.62Tubulin alpha-3 chain Detyrosinated tubulin alpha-... [more]
tba-26.791e-12277.29Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
tba-26.791e-12277.29Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
tba-26.791e-12277.29Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alphaTub85E1.155e-12477.10gene:FBgn0003886 transcript:FBtr0082087[more]
alphaTub84B7.042e-12479.23gene:FBgn0003884 transcript:FBtr0081639[more]
alphaTub84D1.696e-12278.74gene:FBgn0003885 transcript:FBtr0081538[more]
alphaTub67C2.945e-11370.89gene:FBgn0087040 transcript:FBtr0076393[more]
CG77941.735e-7351.23gene:FBgn0038565 transcript:FBtr0083540[more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba8l42.903e-12679.23tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
tuba8l2.990e-12578.04tubulin, alpha 8 like [Source:ZFIN;Acc:ZDB-GENE-03... [more]
si:ch73-199e17.11.691e-12477.57si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-... [more]
tuba1b3.587e-12478.95tubulin, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030822... [more]
tuba1b3.587e-12478.95tubulin, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030822... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
faah.38.550e-12579.90fatty acid amide hydrolase, gene 3 [Source:Xenbase... [more]
jmjd89.200e-12579.71jumonji domain containing 8 [Source:Xenbase;Acc:XB... [more]
pex19.951e-12580.19peroxisomal biogenesis factor 1 [Source:Xenbase;Ac... [more]
pex11.063e-12480.19peroxisomal biogenesis factor 1 [Source:Xenbase;Ac... [more]
pex11.795e-12480.19peroxisomal biogenesis factor 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tuba3a2.318e-12479.71tubulin, alpha 3A [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba3b2.318e-12479.71tubulin, alpha 3B [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba4a3.082e-12479.05tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba1c3.324e-12478.47tubulin, alpha 1C [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba1b4.502e-12479.71tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:10780... [more]
back to top
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P09645|TBA8_CHICK2.004e-12579.71Tubulin alpha-8 chain (Fragment) OS=Gallus gallus ... [more]
sp|P02552|TBA1_CHICK6.685e-12479.23Tubulin alpha-1 chain (Fragment) OS=Gallus gallus ... [more]
sp|P06604|TBA2_DROME1.157e-12377.10Tubulin alpha-2 chain OS=Drosophila melanogaster O... [more]
sp|Q3ZCJ7|TBA1C_BOVIN1.236e-12378.47Tubulin alpha-1C chain OS=Bos taurus OX=9913 GN=TU... [more]
sp|P36220|TBA_TORMA1.361e-12380.19Tubulin alpha chain OS=Torpedo marmorata OX=7788 P... [more]
back to top
BLAST of Tubulin alpha chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A4UUE32.371e-12479.71Tubulin A (Fragment) OS=Hyriopsis cumingii OX=1654... [more]
A0A2G8LFY32.604e-12476.64Tubulin A OS=Stichopus japonicus OX=307972 GN=BSL7... [more]
R0KUT82.637e-12478.04Tubulin alpha-1C chain (Fragment) OS=Anas platyrhy... [more]
A0A095A4Z83.379e-12478.50Tubulin alpha chain OS=Schistosoma haematobium OX=... [more]
A0A452RHK03.466e-12478.95Tubulin_C domain-containing protein OS=Ursus ameri... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000005818.21.203e-12478.95pep primary_assembly:Astyanax_mexicanus-2.0:22:146... [more]
ENSAMXT00000042562.13.656e-12479.71tubulin alpha chain [Source:NCBI gene;Acc:10303831... [more]
ENSAMXT00000019222.23.781e-12479.71tubulin alpha-1 chain [Source:NCBI gene;Acc:103031... [more]
tuba1a3.857e-12479.71tubulin alpha chain [Source:NCBI gene;Acc:10303797... [more]
ENSAMXT00000019223.24.032e-12479.71tubulin alpha-1 chain [Source:NCBI gene;Acc:103031... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA3C4.618e-7081.51tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
ENSPMAT00000001139.11.095e-6778.99pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 g... [more]
tubb23.182e-3436.31tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000001368.11.026e-3333.00pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-... [more]
tubg11.479e-1825.73tubulin, gamma 1 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TUB15.241e-11268.54Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB38.867e-11268.10Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB21.074e-4738.21Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB47.675e-1827.44Gamma-tubulin; involved in nucleating microtubules... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO293791.785e-12779.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO293782.760e-12679.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448038.249e-12579.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380668.624e-12579.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380641.330e-12479.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020049.21.273e-12580.19tubulin alpha-1B chain [Source:NCBI gene;Acc:10115... [more]
ENSORLT00000020614.21.290e-12578.50tubulin alpha-1A chain [Source:NCBI gene;Acc:10535... [more]
ENSORLT00000028969.12.185e-12579.52tubulin alpha-1C chain-like [Source:NCBI gene;Acc:... [more]
ENSORLT00000034557.11.407e-12480.19tubulin alpha chain [Source:NCBI gene;Acc:10116881... [more]
ENSORLT00000034480.12.672e-12481.19tubulin alpha-1C chain-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Tubulin alpha chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039778.19.032e-160100.00SMESG000039778.1[more]
SMESG000039783.11.394e-12580.68SMESG000039783.1[more]
SMESG000039783.12.485e-12580.68SMESG000039783.1[more]
SMESG000017700.11.112e-12478.87SMESG000017700.1[more]
SMESG000005489.11.351e-12479.71SMESG000005489.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014305 ID=SMED30014305|Name=Tubulin alpha chain|organism=Schmidtea mediterranea sexual|type=transcript|length=753bp
TCAGATTGTCAGTTCTATCACTGCTTCATTAAGATTTGATGGGGCTCTAA
ATGTTGACTTAAACGAATTTCAAACAAATCTTGTTCCATTTCCTAGAATT
CATTTTCCTTTAGCGAGCTATGCGCCTTTAATATCTAAAAAAAAGATCCA
GCATGAAAACTTAAGCGTATCTGAAATTGCCAACGCATGTTTTGATGTAT
CAAATCAAATGGTCAAGTGTGACCCTCGACAAGGTAAATATATGGCATGT
TGTATGCTTTTTCGAGGCGATGTGGTTCCTAAAGACGTCAATTTTGCAAT
TGCTTCTTTAAAATCAAAACGCTCAATAGAATTTGTTGATTGGTGTCCAA
CTGGATTTAAAGTAGGTATTAACTATCAGGCTCCAACTACCGTTCCAGAT
GATGACCTAGGAAAAGTATCAAGAGCTGTATGTATGCTAAGCAACACAAC
GGCTATTGTCGAAGCATGGGCGAGGCTAAATATGCAATTTGACCTTATGT
TTAAAAAGAGAGCTTTTGTTCATTGGTACGTTGGAGAAGGAATGGAGGAA
GGTGAGTTTTCAGAGGCGAGAGAAGACATTGGTTGTCTAGAAAGAGATTA
TATTGAAGTAGCCGAAGATACAAAAGAAGAAATAGAAGATAATTATTATT
AATTATTAATTTCTTATTGATATAAATTGATTTATACAAAAAAGATGACT
TTTTTTACTTTAATATATAAAAGACATTGTATTTTCTACAAAATTTGACT
ATG
back to top

protein sequence of SMED30014305-orf-1

>SMED30014305-orf-1 ID=SMED30014305-orf-1|Name=SMED30014305-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=217bp
QIVSSITASLRFDGALNVDLNEFQTNLVPFPRIHFPLASYAPLISKKKIQ
HENLSVSEIANACFDVSNQMVKCDPRQGKYMACCMLFRGDVVPKDVNFAI
ASLKSKRSIEFVDWCPTGFKVGINYQAPTTVPDDDLGKVSRAVCMLSNTT
AIVEAWARLNMQFDLMFKKRAFVHWYVGEGMEEGEFSEAREDIGCLERDY
IEVAEDTKEEIEDNYY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR036525Tubulin/FtsZ_GTPase_sf
IPR037103Tubulin/FtsZ_C_sf
IPR000217Tubulin
IPR002452Alpha_tubulin
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR023123Tubulin_C
IPR003008Tubulin_FtsZ_GTPase
IPR008280Tub_FtsZ_C
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007010cytoskeleton organization
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0005200structural constituent of cytoskeleton
GO:0003924GTPase activity
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
GO:0005856cytoskeleton
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002452Alpha tubulinPRINTSPR01162ALPHATUBULINcoord: 115..128
score: 86.67
coord: 128..147
score: 68.66
coord: 190..206
score: 56.2
coord: 89..110
score: 68.14
coord: 42..57
score: 54.57
coord: 153..169
score: 52.79
IPR018316Tubulin/FtsZ, 2-layer sandwich domainSMARTSM00865Tubulin_C_4coord: 16..161
e-value: 5.4E-48
score: 175.4
IPR018316Tubulin/FtsZ, 2-layer sandwich domainPFAMPF03953Tubulin_Ccoord: 31..160
e-value: 1.1E-48
score: 164.6
IPR036525Tubulin/FtsZ, GTPase domain superfamilyGENE3DG3DSA:3.40.50.1440coord: 1..36
e-value: 3.4E-11
score: 45.0
IPR037103Tubulin/FtsZ, C-terminal domain superfamilyGENE3DG3DSA:3.30.1330.20coord: 37..151
e-value: 8.3E-59
score: 198.5
IPR023123Tubulin, C-terminalGENE3DG3DSA:1.10.287.600coord: 152..204
e-value: 4.2E-29
score: 101.9
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 1..211
NoneNo IPR availablePANTHERPTHR11588:SF274TUBULIN ALPHA CHAINcoord: 1..211
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 14..206