SMED30014301

Overview
NameSMED30014301
Smed IDSMED30014301
Length (bp)541
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30014301 (SMED30014301) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30014301 (SMED30014301) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30014301 (SMED30014301) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30014301 (SMED30014301) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014301

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014301 dd_Smed_v4_11849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014301 dd_Smed_v4_11849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30014301 dd_Smed_v4_11849_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30014301 vs. Ensembl Human
Match: BIRC2 (baculoviral IAP repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:590])

HSP 1 Score: 54.6842 bits (130), Expect = 9.325e-9
Identity = 36/98 (36.73%), Postives = 46/98 (46.94%), Query Frame = 2
Query:   89 RPWKMRKV--IYSQRRVRYE-ELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRIN 373
             P   R V  I S R   Y   +  EE R+LT+    + T     E+A  GF++ G     D V C  C G+LS+WE  + A  EH R F  CPF  N
Sbjct:  119 NPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPL-TFLSPSELARAGFYYIGPG---DRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLEN 212          
BLAST of SMED30014301 vs. Ensembl Human
Match: BIRC2 (baculoviral IAP repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:590])

HSP 1 Score: 55.0694 bits (131), Expect = 9.692e-9
Identity = 36/98 (36.73%), Postives = 46/98 (46.94%), Query Frame = 2
Query:   89 RPWKMRKV--IYSQRRVRYE-ELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRIN 373
             P   R V  I S R   Y   +  EE R+LT+    + T     E+A  GF++ G     D V C  C G+LS+WE  + A  EH R F  CPF  N
Sbjct:  159 NPLNSRAVEDISSSRTNPYSYAMSTEEARFLTYHMWPL-TFLSPSELARAGFYYIGPG---DRVACFACGGKLSNWEPKDDAMSEHRRHFPNCPFLEN 252          
BLAST of SMED30014301 vs. Ensembl Human
Match: XIAP (X-linked inhibitor of apoptosis [Source:HGNC Symbol;Acc:HGNC:592])

HSP 1 Score: 53.9138 bits (128), Expect = 2.343e-8
Identity = 30/106 (28.30%), Postives = 55/106 (51.89%), Query Frame = 2
Query:   83 TGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRI--NIDVRNQA 394
            TG+   +   IY +    Y     EE R  +F++   +     +E+A+ G +++G   + D+V C  C G+L +WE  + A  EH R F  C F +  N+++R+++
Sbjct:  143 TGQVVDISDTIYPRNPAMY----SEEARLKSFQNWPDYAHLTPRELASAGLYYTG---IGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSES 241          
BLAST of SMED30014301 vs. Ensembl Human
Match: XIAP (X-linked inhibitor of apoptosis [Source:HGNC Symbol;Acc:HGNC:592])

HSP 1 Score: 53.9138 bits (128), Expect = 2.343e-8
Identity = 30/106 (28.30%), Postives = 55/106 (51.89%), Query Frame = 2
Query:   83 TGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRI--NIDVRNQA 394
            TG+   +   IY +    Y     EE R  +F++   +     +E+A+ G +++G   + D+V C  C G+L +WE  + A  EH R F  C F +  N+++R+++
Sbjct:  143 TGQVVDISDTIYPRNPAMY----SEEARLKSFQNWPDYAHLTPRELASAGLYYTG---IGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSES 241          
BLAST of SMED30014301 vs. Ensembl Human
Match: XIAP (X-linked inhibitor of apoptosis [Source:HGNC Symbol;Acc:HGNC:592])

HSP 1 Score: 53.9138 bits (128), Expect = 2.343e-8
Identity = 30/106 (28.30%), Postives = 55/106 (51.89%), Query Frame = 2
Query:   83 TGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRI--NIDVRNQA 394
            TG+   +   IY +    Y     EE R  +F++   +     +E+A+ G +++G   + D+V C  C G+L +WE  + A  EH R F  C F +  N+++R+++
Sbjct:  143 TGQVVDISDTIYPRNPAMY----SEEARLKSFQNWPDYAHLTPRELASAGLYYTG---IGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSES 241          
BLAST of SMED30014301 vs. Ensembl Fly
Match: Diap2 (gene:FBgn0015247 transcript:FBtr0087297)

HSP 1 Score: 50.0618 bits (118), Expect = 2.485e-7
Identity = 35/117 (29.91%), Postives = 51/117 (43.59%), Query Frame = 2
Query:   35 IKTLVIAIQHYTSF------DTTGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKD--NKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCP 361
            I ++V+A  H  +       D  G       V+ S       +L  E  R +TFKD  N   T    + +A  GF++       D V C++C G ++ WEK + A  EH R F  CP
Sbjct:   72 ICSMVLAPNHCGNVPRSQESDNEGN-----SVVDSPESCSCPDLLLEANRLVTFKDWPNPNIT---PQALAKAGFYYLNRL---DHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQCP 177          
BLAST of SMED30014301 vs. Ensembl Fly
Match: Diap2 (gene:FBgn0015247 transcript:FBtr0087296)

HSP 1 Score: 50.0618 bits (118), Expect = 2.485e-7
Identity = 35/117 (29.91%), Postives = 51/117 (43.59%), Query Frame = 2
Query:   35 IKTLVIAIQHYTSF------DTTGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKD--NKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCP 361
            I ++V+A  H  +       D  G       V+ S       +L  E  R +TFKD  N   T    + +A  GF++       D V C++C G ++ WEK + A  EH R F  CP
Sbjct:   72 ICSMVLAPNHCGNVPRSQESDNEGN-----SVVDSPESCSCPDLLLEANRLVTFKDWPNPNIT---PQALAKAGFYYLNRL---DHVKCVWCNGVIAKWEKNDNAFEEHKRFFPQCP 177          
BLAST of SMED30014301 vs. Ensembl Zebrafish
Match: birc7 (baculoviral IAP repeat containing 7 [Source:ZFIN;Acc:ZDB-GENE-070615-35])

HSP 1 Score: 53.9138 bits (128), Expect = 1.345e-8
Identity = 34/94 (36.17%), Postives = 43/94 (45.74%), Query Frame = 2
Query:  122 QRRVRYEE-----LRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRN 388
            QR  R E      +R EE+R  TF +         +E+A  GF + G     D V C  C+G L HW  G+T + EH R F TC      DV N
Sbjct:   30 QRSARMEAEVRLGMRSEEERLQTFHNWPSDAAVSPEELARAGFHYLG---YGDTVQCFCCEGILRHWVDGDTPRGEHERHFPTCGLMRGRDVGN 120          

HSP 2 Score: 52.373 bits (124), Expect = 4.432e-8
Identity = 34/128 (26.56%), Postives = 59/128 (46.09%), Query Frame = 2
Query:  137 YEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSEIDSDEKGG------EKRITIIKSFEDPAELI 502
            Y E+  E+ R  TF +       Q   +A  GFF++G     D V C +C G L +WE G+   +EH + F  C + +    +++    +  ++QS  + + +GG         IT ++S   P E +
Sbjct:  153 YSEMETEDNRRSTFHNWPTGAAVQPDTLARAGFFYTGHG---DNVKCFFCDGGLRNWEPGDDPWQEHAKWFPQCEYLL----QSRGQEYVRNVQQSFFNMNGRGGGSLSSAAGNITPVRSDLSPEEQL 273          
BLAST of SMED30014301 vs. Ensembl Zebrafish
Match: birc7 (baculoviral IAP repeat containing 7 [Source:ZFIN;Acc:ZDB-GENE-070615-35])

HSP 1 Score: 53.5286 bits (127), Expect = 1.973e-8
Identity = 34/94 (36.17%), Postives = 43/94 (45.74%), Query Frame = 2
Query:  122 QRRVRYEE-----LRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRN 388
            QR  R E      +R EE+R  TF +         +E+A  GF + G     D V C  C+G L HW  G+T + EH R F TC      DV N
Sbjct:   10 QRSARMEAEVRLGMRSEEERLQTFHNWPSDAAVSPEELARAGFHYLG---YGDTVQCFCCEGILRHWVDGDTPRGEHERHFPTCGLMRGRDVGN 100          

HSP 2 Score: 50.0618 bits (118), Expect = 3.265e-7
Identity = 25/78 (32.05%), Postives = 38/78 (48.72%), Query Frame = 2
Query:  137 YEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRI 370
            Y E+  E+ R  TF +       Q   +A  GFF++G     D V C +C G L +WE G+   +EH + F  C + +
Sbjct:  133 YSEMETEDNRRSTFHNWPTGAAVQPDTLARAGFFYTGHG---DNVKCFFCDGGLRNWEPGDDPWQEHAKWFPQCEYLL 207          
BLAST of SMED30014301 vs. Ensembl Zebrafish
Match: xiap (X-linked inhibitor of apoptosis [Source:ZFIN;Acc:ZDB-GENE-030825-7])

HSP 1 Score: 50.0618 bits (118), Expect = 3.098e-7
Identity = 25/85 (29.41%), Postives = 43/85 (50.59%), Query Frame = 2
Query:  143 ELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAM 397
             ++ EE R  TF +    +  + +++A  G ++ G   + D V C  C G LS WE+G+    EH + +S C F +  +V N  +
Sbjct:  133 HMKSEEARLSTFNNWPADSPVRPEDLAEAGMYYIG---IDDNVQCFCCGGGLSGWEQGDDPWSEHAKYYSNCFFFLGHNVGNVPL 214          
BLAST of SMED30014301 vs. Ensembl Zebrafish
Match: xiap (X-linked inhibitor of apoptosis [Source:ZFIN;Acc:ZDB-GENE-030825-7])

HSP 1 Score: 50.0618 bits (118), Expect = 3.098e-7
Identity = 25/85 (29.41%), Postives = 43/85 (50.59%), Query Frame = 2
Query:  143 ELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAM 397
             ++ EE R  TF +    +  + +++A  G ++ G   + D V C  C G LS WE+G+    EH + +S C F +  +V N  +
Sbjct:  133 HMKSEEARLSTFNNWPADSPVRPEDLAEAGMYYIG---IDDNVQCFCCGGGLSGWEQGDDPWSEHAKYYSNCFFFLGHNVGNVPL 214          
BLAST of SMED30014301 vs. Ensembl Zebrafish
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 48.521 bits (114), Expect = 1.167e-6
Identity = 25/73 (34.25%), Postives = 36/73 (49.32%), Query Frame = 2
Query:  146 LRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPF 364
            +R+E++R  TF+ N         E+A  G ++ G     D V C  C G+L  WE G+ A  EH R +  C F
Sbjct:  203 MRREQERLDTFQ-NWTLATVTPAELAKAGLYYLGQG---DRVACFSCGGQLGSWEPGDRAVSEHQRHYPNCRF 271          
BLAST of SMED30014301 vs. Ensembl Xenopus
Match: fasn (fatty acid synthase [Source:Xenbase;Acc:XB-GENE-1002983])

HSP 1 Score: 61.2326 bits (147), Expect = 7.875e-11
Identity = 36/104 (34.62%), Postives = 52/104 (50.00%), Query Frame = 2
Query:   83 TGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQA 394
            TGR   M    Y     R+ E+  EE R  TF++   ++    KE+A  G F++G   + D+V C  C G+L +WE  + A  EH + F  C F +  DV N A
Sbjct:  149 TGRVVDMSTPKYP----RHMEMCSEEARLQTFQNWPAYSPLTPKELANAGLFYTG---INDQVKCFCCGGKLMNWEPSDKAWTEHKKHFPECYFVLGRDVGNVA 245          
BLAST of SMED30014301 vs. Ensembl Xenopus
Match: crebrf (CREB3 regulatory factor [Source:Xenbase;Acc:XB-GENE-988760])

HSP 1 Score: 54.299 bits (129), Expect = 1.936e-8
Identity = 29/77 (37.66%), Postives = 40/77 (51.95%), Query Frame = 2
Query:  140 EELRKEEQRYLTFKD--NKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPF 364
            E +  EE R  +F++  N   T     E+A  GF+F G     D+V C  C G+L++WE  + A  EH R F  CPF
Sbjct:  200 EYMYTEEARLNSFQEWSNMFLT---PAELAKAGFYFVGPG---DKVACFTCDGKLNNWEPNDNAMSEHRRHFPNCPF 270          
BLAST of SMED30014301 vs. Ensembl Xenopus
Match: crebrf (CREB3 regulatory factor [Source:Xenbase;Acc:XB-GENE-988760])

HSP 1 Score: 53.9138 bits (128), Expect = 2.431e-8
Identity = 29/77 (37.66%), Postives = 40/77 (51.95%), Query Frame = 2
Query:  140 EELRKEEQRYLTFKD--NKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPF 364
            E +  EE R  +F++  N   T     E+A  GF+F G     D+V C  C G+L++WE  + A  EH R F  CPF
Sbjct:  200 EYMYTEEARLNSFQEWSNMFLT---PAELAKAGFYFVGPG---DKVACFTCDGKLNNWEPNDNAMSEHRRHFPNCPF 270          
BLAST of SMED30014301 vs. Ensembl Xenopus
Match: crebrf (CREB3 regulatory factor [Source:Xenbase;Acc:XB-GENE-988760])

HSP 1 Score: 53.9138 bits (128), Expect = 2.471e-8
Identity = 29/77 (37.66%), Postives = 40/77 (51.95%), Query Frame = 2
Query:  140 EELRKEEQRYLTFKD--NKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPF 364
            E +  EE R  +F++  N   T     E+A  GF+F G     D+V C  C G+L++WE  + A  EH R F  CPF
Sbjct:  164 EYMYTEEARLNSFQEWSNMFLT---PAELAKAGFYFVGPG---DKVACFTCDGKLNNWEPNDNAMSEHRRHFPNCPF 234          
BLAST of SMED30014301 vs. Ensembl Xenopus
Match: asrgl1 (asparaginase like 1 [Source:Xenbase;Acc:XB-GENE-989502])

HSP 1 Score: 53.5286 bits (127), Expect = 4.173e-8
Identity = 28/90 (31.11%), Postives = 48/90 (53.33%), Query Frame = 2
Query:  122 QRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQ 391
            QR +R  E   EE R  +F+D   +   Q  +++A GF+F+G   + D V C  C G L +W++ +   +EH + F  C F  +I  +++
Sbjct:  160 QRDLR--EYVTEEARLHSFRDWPFYARIQPDKLSAAGFYFTG---IRDTVQCFSCAGCLGNWDENDDPWKEHAKWFPECNFLTSIKTQDE 244          
BLAST of SMED30014301 vs. Ensembl Mouse
Match: Xiap (X-linked inhibitor of apoptosis [Source:MGI Symbol;Acc:MGI:107572])

HSP 1 Score: 53.5286 bits (127), Expect = 2.895e-8
Identity = 31/106 (29.25%), Postives = 54/106 (50.94%), Query Frame = 2
Query:   83 TGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRI--NIDVRNQA 394
            TG+   +   IY     R   +  EE R  +F++   +     +E+A+ G +++G     D+V C  C G+L +WE  + A  EH R F  C F +  N++VR+++
Sbjct:  143 TGQVVDISDTIYP----RNPAMCSEEARLKSFQNWPDYAHLTPRELASAGLYYTGAD---DQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSES 241          
BLAST of SMED30014301 vs. Ensembl Mouse
Match: Xiap (X-linked inhibitor of apoptosis [Source:MGI Symbol;Acc:MGI:107572])

HSP 1 Score: 53.5286 bits (127), Expect = 2.895e-8
Identity = 31/106 (29.25%), Postives = 54/106 (50.94%), Query Frame = 2
Query:   83 TGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRI--NIDVRNQA 394
            TG+   +   IY     R   +  EE R  +F++   +     +E+A+ G +++G     D+V C  C G+L +WE  + A  EH R F  C F +  N++VR+++
Sbjct:  143 TGQVVDISDTIYP----RNPAMCSEEARLKSFQNWPDYAHLTPRELASAGLYYTGAD---DQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSES 241          
BLAST of SMED30014301 vs. Ensembl Mouse
Match: Xiap (X-linked inhibitor of apoptosis [Source:MGI Symbol;Acc:MGI:107572])

HSP 1 Score: 53.5286 bits (127), Expect = 2.895e-8
Identity = 31/106 (29.25%), Postives = 54/106 (50.94%), Query Frame = 2
Query:   83 TGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRI--NIDVRNQA 394
            TG+   +   IY     R   +  EE R  +F++   +     +E+A+ G +++G     D+V C  C G+L +WE  + A  EH R F  C F +  N++VR+++
Sbjct:  143 TGQVVDISDTIYP----RNPAMCSEEARLKSFQNWPDYAHLTPRELASAGLYYTGAD---DQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSES 241          
BLAST of SMED30014301 vs. Ensembl Mouse
Match: Xiap (X-linked inhibitor of apoptosis [Source:MGI Symbol;Acc:MGI:107572])

HSP 1 Score: 53.5286 bits (127), Expect = 2.895e-8
Identity = 31/106 (29.25%), Postives = 54/106 (50.94%), Query Frame = 2
Query:   83 TGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRI--NIDVRNQA 394
            TG+   +   IY     R   +  EE R  +F++   +     +E+A+ G +++G     D+V C  C G+L +WE  + A  EH R F  C F +  N++VR+++
Sbjct:  143 TGQVVDISDTIYP----RNPAMCSEEARLKSFQNWPDYAHLTPRELASAGLYYTGAD---DQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSES 241          
BLAST of SMED30014301 vs. Ensembl Mouse
Match: Birc7 (baculoviral IAP repeat-containing 7 (livin) [Source:MGI Symbol;Acc:MGI:2676458])

HSP 1 Score: 51.2174 bits (121), Expect = 1.124e-7
Identity = 28/84 (33.33%), Postives = 41/84 (48.81%), Query Frame = 2
Query:  137 YEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRN 388
            + E+  E+ R  +F D       Q + +AA GFF +G     D+V C +C G L  WE+G+    EH R F  C F +    R+
Sbjct:   87 FPEMDSEDLRLASFYDWPSTAGIQPEPLAAAGFFHTGQQ---DKVRCFFCYGGLQSWERGDDPWTEHARWFPRCQFLLRSKGRD 167          
BLAST of SMED30014301 vs. UniProt/SwissProt
Match: sp|Q5BKL8|XIAP_XENTR (E3 ubiquitin-protein ligase XIAP OS=Xenopus tropicalis OX=8364 GN=xiap PE=2 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 4.172e-10
Identity = 36/104 (34.62%), Postives = 52/104 (50.00%), Query Frame = 2
Query:   83 TGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQA 394
            TGR   M    Y     R+ E+  EE R  TF++   ++    KE+A  G F++G   + D+V C  C G+L +WE  + A  EH + F  C F +  DV N A
Sbjct:  149 TGRVVDMSTPKYP----RHMEMCSEEARLQTFQNWPAYSPLTPKELANAGLFYTG---INDQVKCFCCGGKLMNWEPSDKAWTEHKKHFPECYFVLGRDVGNVA 245          
BLAST of SMED30014301 vs. UniProt/SwissProt
Match: sp|A5D8Q0|XIAP_XENLA (E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis OX=8355 GN=xiap PE=2 SV=2)

HSP 1 Score: 58.9214 bits (141), Expect = 2.498e-9
Identity = 35/102 (34.31%), Postives = 51/102 (50.00%), Query Frame = 2
Query:   83 TGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRN 388
            TGR   M K  Y     R+  +  EE R  TF++   ++    KE+A  G F++G   + D+V C  C G+L +WE  + A  EH + F  C F +  DV N
Sbjct:  153 TGRVVDMSKPKYP----RHMAMCSEEARLQTFQNWPGYSPLMPKELANAGLFYTG---INDQVKCFCCGGKLMNWEPSDRAWTEHKKHFPECYFVLGRDVGN 247          
BLAST of SMED30014301 vs. UniProt/SwissProt
Match: sp|Q9R0I6|XIAP_RAT (E3 ubiquitin-protein ligase XIAP OS=Rattus norvegicus OX=10116 GN=Xiap PE=2 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.532e-8
Identity = 32/106 (30.19%), Postives = 55/106 (51.89%), Query Frame = 2
Query:   83 TGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRI--NIDVRNQA 394
            TG+   +   IY     R   +  EE R  TF++   +     +E+A+ G +++G   + D+V C  C G+L +WE  + A  EH R F  C F +  N++VR+++
Sbjct:  143 TGQVVDISDTIYP----RNPAMCSEEARLKTFQNWPDYAHLSPRELASAGLYYTG---IDDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNVNVRSES 241          
BLAST of SMED30014301 vs. UniProt/SwissProt
Match: sp|Q8JHV9|BIR7A_XENLA (Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis OX=8355 GN=birc7-a PE=1 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 4.772e-8
Identity = 24/80 (30.00%), Postives = 43/80 (53.75%), Query Frame = 2
Query:  137 YEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINI 376
            Y E+ +E  R  +F++  ++     + +A  GFF++G     D V C +C G L +WE+G+    EH + F  C F +++
Sbjct:  139 YPEMAEERDRLDSFRNWPMYAHGNPEHLAGSGFFYTGHR---DNVKCFHCDGGLRNWEQGDDPWTEHAKWFPMCDFLLHV 215          
BLAST of SMED30014301 vs. UniProt/SwissProt
Match: sp|O62640|PIAP_PIG (Putative inhibitor of apoptosis OS=Sus scrofa OX=9823 GN=PIAP PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 4.843e-8
Identity = 29/76 (38.16%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  146 LRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRIN 373
            +  E+ R LTF+   + T     ++A  GF++ G     D V C  C G+LS+WE  + A  EHLR F  CPF  N
Sbjct:    1 MNTEKDRLLTFQMWPL-TFLSPADLAKAGFYYIGPG---DRVACFACGGKLSNWEPKDDAMTEHLRHFPNCPFLGN 72          
BLAST of SMED30014301 vs. TrEMBL
Match: C3Z9S3 (RING-type domain-containing protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_224204 PE=4 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.469e-9
Identity = 31/80 (38.75%), Postives = 47/80 (58.75%), Query Frame = 2
Query:  149 RKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRN 388
            + E++R  ++     +   Q +E+A  GFF++G+    D V C  CQG L +WE G+ A  EH R FS+CPF +N +V N
Sbjct:    1 KSEQRRVDSYVTWPAWAPLQPRELAKAGFFYTGSD---DRVQCFCCQGILRNWEAGDRAMNEHRRHFSSCPFVLNFNVGN 77          
BLAST of SMED30014301 vs. TrEMBL
Match: A0A1S3H002 (baculoviral IAP repeat-containing protein 7-like OS=Lingula unguis OX=7574 GN=LOC106150804 PE=4 SV=1)

HSP 1 Score: 64.3142 bits (155), Expect = 1.037e-8
Identity = 30/81 (37.04%), Postives = 45/81 (55.56%), Query Frame = 2
Query:  146 LRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRN 388
            +R E  R  TF +       + +++A  GFF+ GT    D V C +C+G L +WE G+   +EH R  STCPF + ++V N
Sbjct:   83 MRNESDRLATFVNWPSGASVRPRDLARAGFFYVGTE---DRVQCAFCEGVLRNWEPGDQPMQEHRRYLSTCPFVLGLEVGN 160          
BLAST of SMED30014301 vs. TrEMBL
Match: A0A1S3KI49 (baculoviral IAP repeat-containing protein 3-like OS=Lingula unguis OX=7574 GN=LOC106181906 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.471e-8
Identity = 32/108 (29.63%), Postives = 53/108 (49.07%), Query Frame = 2
Query:  143 ELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAM-----NRLEGLRQSEIDSDEKGG 451
            E++ E  R  TF    +    +  ++A  GFF++G     D V C +C G L +W+ G+   +EH   F TC + + +DV N A+     N    +++S + S   GG
Sbjct:  396 EMKSEAARLRTFAHWPISAHVRPHDLAKAGFFYTGNA---DSVQCAFCSGILRNWDPGDRPMQEHRHHFPTCLYALGVDVGNIALEPDQANLPSAIQESLVTSSAAGG 500          
BLAST of SMED30014301 vs. TrEMBL
Match: A0A1I8G104 (RING-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 2.564e-8
Identity = 36/109 (33.03%), Postives = 58/109 (53.21%), Query Frame = 2
Query:   74 FDTTGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFK-DNKVFTDRQ---SKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRN 388
            +DT+G P  + + ++        ++R+EE R+ +F   +  FT        ++AA GFF+    +  D V C +C+G L  WE GE  +  H R FSTCPF + ++V N
Sbjct:   38 WDTSGMPASIPQHLW--------DMRREENRWQSFHLPDASFTAAHLVSVTDLAADGFFYL---QESDRVKCAFCKGVLKDWEAGEQVREAHRRHFSTCPFVLFVEVGN 135          
BLAST of SMED30014301 vs. TrEMBL
Match: A0A1S3HHF5 (uncharacterized protein LOC106155253 OS=Lingula unguis OX=7574 GN=LOC106155253 PE=4 SV=2)

HSP 1 Score: 63.1586 bits (152), Expect = 2.724e-8
Identity = 31/81 (38.27%), Postives = 45/81 (55.56%), Query Frame = 2
Query:  146 LRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRN 388
            +R E  R  TF       + + K++A  GFF+ GT    D V C +C+G L +WE G+   +EH R  STCPF + ++V N
Sbjct:  746 MRNESDRLATFVSWPSGANVRPKDLARAGFFYLGTE---DRVQCAFCEGVLRNWELGDQPLQEHRRYLSTCPFILGLEVGN 823          
BLAST of SMED30014301 vs. Ensembl Cavefish
Match: ENSAMXT00000038426.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:10402057:10402371:-1 gene:ENSAMXG00000033609.1 transcript:ENSAMXT00000038426.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.7582 bits (125), Expect = 2.828e-9
Identity = 26/84 (30.95%), Postives = 38/84 (45.24%), Query Frame = 2
Query:  146 LRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAM 397
            +R EE R  TF +    +  Q  ++   G F+   P   D V C  C G L  W++G+    EH + +  C F +  DV N  M
Sbjct:    1 MRSEEARLRTFSNWPSSSPVQPNDLVGAGLFYVPKPTRNDLVQCFCCGGMLKAWKEGDVPWSEHSKIYPNCFFILGHDVGNILM 84          
BLAST of SMED30014301 vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 54.299 bits (129), Expect = 9.138e-9
Identity = 32/113 (28.32%), Postives = 51/113 (45.13%), Query Frame = 2
Query:  119 SQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSEIDSDEKGGEK 457
            S  +  Y E+  E+ R  TF++       Q   +A  GFF++G     D V C +C G L +WE G+   +EH + F  C + +    R    N    ++QS  +  E  G +
Sbjct:  150 SVGQAVYPEMEAEDTRLTTFQNWPPGASVQPDTLAQAGFFYTGHG---DNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEYLLQTRGREYVNN----IQQSHFNMSEMSGSQ 255          

HSP 2 Score: 48.1358 bits (113), Expect = 1.049e-6
Identity = 27/81 (33.33%), Postives = 37/81 (45.68%), Query Frame = 2
Query:  146 LRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRN 388
            +  EE+R  +F+     +     ++A  GF+F G     D V C  C G L  W  G+   REH R F TC F +   V N
Sbjct:   44 MHSEEERLRSFEHWATDSPVSPTDLARAGFYFLG---YGDTVQCFCCDGVLRCWVSGDEPLREHKRHFPTCGFILGRSVGN 121          
BLAST of SMED30014301 vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 54.299 bits (129), Expect = 1.018e-8
Identity = 31/107 (28.97%), Postives = 49/107 (45.79%), Query Frame = 2
Query:  137 YEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSEIDSDEKGGEK 457
            Y E+  E+ R  TF++       Q   +A  GFF++G     D V C +C G L +WE G+   +EH + F  C + +    R    N    ++QS  +  E  G +
Sbjct:  156 YPEMEAEDTRLTTFQNWPPGASVQPDTLAQAGFFYTGHG---DNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEYLLQTRGREYVNN----IQQSHFNMSEMSGSQ 255          

HSP 2 Score: 48.521 bits (114), Expect = 8.261e-7
Identity = 27/81 (33.33%), Postives = 37/81 (45.68%), Query Frame = 2
Query:  146 LRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRN 388
            +  EE+R  +F+     +     ++A  GF+F G     D V C  C G L  W  G+   REH R F TC F +   V N
Sbjct:   44 MHSEEERLRSFEHWATDSPVSPTDLARAGFYFLG---YGDTVQCFCCDGVLRCWVSGDEPLREHKRHFPTCGFILGRSVGN 121          
BLAST of SMED30014301 vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 53.9138 bits (128), Expect = 1.240e-8
Identity = 31/107 (28.97%), Postives = 49/107 (45.79%), Query Frame = 2
Query:  137 YEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSEIDSDEKGGEK 457
            Y E+  E+ R  TF++       Q   +A  GFF++G     D V C +C G L +WE G+   +EH + F  C + +    R    N    ++QS  +  E  G +
Sbjct:  156 YPEMEAEDTRLTTFQNWPPGASVQPDTLAQAGFFYTGHG---DNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEYLLQTRGREYVNN----IQQSHFNMSEMSGSQ 255          

HSP 2 Score: 48.521 bits (114), Expect = 1.004e-6
Identity = 27/81 (33.33%), Postives = 37/81 (45.68%), Query Frame = 2
Query:  146 LRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRN 388
            +  EE+R  +F+     +     ++A  GF+F G     D V C  C G L  W  G+   REH R F TC F +   V N
Sbjct:   44 MHSEEERLRSFEHWATDSPVSPTDLARAGFYFLG---YGDTVQCFCCDGVLRCWVSGDEPLREHKRHFPTCGFILGRSVGN 121          
BLAST of SMED30014301 vs. Ensembl Cavefish
Match: birc7 (baculoviral IAP repeat-containing protein 7 [Source:NCBI gene;Acc:103036970])

HSP 1 Score: 53.9138 bits (128), Expect = 1.350e-8
Identity = 31/107 (28.97%), Postives = 49/107 (45.79%), Query Frame = 2
Query:  137 YEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSEIDSDEKGGEK 457
            Y E+  E+ R  TF++       Q   +A  GFF++G     D V C +C G L +WE G+   +EH + F  C + +    R    N    ++QS  +  E  G +
Sbjct:  156 YPEMEAEDTRLTTFQNWPPGASVQPDTLAQAGFFYTGHG---DNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEYLLQTRGREYVNN----IQQSHFNMSEMSGSQ 255          

HSP 2 Score: 48.521 bits (114), Expect = 9.475e-7
Identity = 27/81 (33.33%), Postives = 37/81 (45.68%), Query Frame = 2
Query:  146 LRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRN 388
            +  EE+R  +F+     +     ++A  GF+F G     D V C  C G L  W  G+   REH R F TC F +   V N
Sbjct:   44 MHSEEERLRSFEHWATDSPVSPTDLARAGFYFLG---YGDTVQCFCCDGVLRCWVSGDEPLREHKRHFPTCGFILGRSVGN 121          
BLAST of SMED30014301 vs. Ensembl Sea Lamprey
Match: birc2 (baculoviral IAP repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-030825-6])

HSP 1 Score: 51.6026 bits (122), Expect = 1.752e-8
Identity = 25/74 (33.78%), Postives = 37/74 (50.00%), Query Frame = 2
Query:  143 ELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPF 364
            E+  E  R L+F      +  +  ++A  G ++ G     D V C YC G +  WE+G+   +EH R FSTC F
Sbjct:  162 EMCVEANRLLSFSTWPESSPVRPADLARAGLYYVGPN---DRVACFYCSGVMRDWEEGDVPAKEHERHFSTCAF 232          

HSP 2 Score: 46.9802 bits (110), Expect = 7.500e-7
Identity = 18/51 (35.29%), Postives = 32/51 (62.75%), Query Frame = 2
Query:  212 KEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPF 364
            +++A  GFF++G     D+V C  C+G + +W+ G++A  +HL+ F  C F
Sbjct:   47 RDLAKAGFFYTGKE---DKVECFSCKGVIGNWKSGDSAIAKHLQSFPNCTF 94          
BLAST of SMED30014301 vs. Ensembl Medaka
Match: ENSORLT00000012200.2 (baculoviral IAP repeat containing 7 [Source:NCBI gene;Acc:101164308])

HSP 1 Score: 54.6842 bits (130), Expect = 7.966e-9
Identity = 27/79 (34.18%), Postives = 40/79 (50.63%), Query Frame = 2
Query:  137 YEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRIN 373
            Y E+  E+ R  TF +       Q   +A+ GFF++G     D V C +C G L +WE G+   +EH + F  C F I+
Sbjct:   93 YPEMEAEDSRLTTFHNWPSEASIQPDALASAGFFYTGHG---DNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEFLIH 168          
BLAST of SMED30014301 vs. Ensembl Medaka
Match: ENSORLT00000039931.1 (baculoviral IAP repeat containing 7 [Source:NCBI gene;Acc:101164308])

HSP 1 Score: 54.6842 bits (130), Expect = 7.966e-9
Identity = 27/79 (34.18%), Postives = 40/79 (50.63%), Query Frame = 2
Query:  137 YEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRIN 373
            Y E+  E+ R  TF +       Q   +A+ GFF++G     D V C +C G L +WE G+   +EH + F  C F I+
Sbjct:   93 YPEMEAEDSRLTTFHNWPSEASIQPDALASAGFFYTGHG---DNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEFLIH 168          
BLAST of SMED30014301 vs. Ensembl Medaka
Match: ENSORLT00000034629.1 (baculoviral IAP repeat containing 7 [Source:NCBI gene;Acc:101164308])

HSP 1 Score: 54.299 bits (129), Expect = 1.063e-8
Identity = 27/79 (34.18%), Postives = 40/79 (50.63%), Query Frame = 2
Query:  137 YEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRIN 373
            Y E+  E+ R  TF +       Q   +A+ GFF++G     D V C +C G L +WE G+   +EH + F  C F I+
Sbjct:  129 YPEMEAEDSRLTTFHNWPSEASIQPDALASAGFFYTGHG---DNVKCFFCDGGLRNWEPGDDPWQEHAKWFPRCEFLIH 204          

HSP 2 Score: 53.5286 bits (127), Expect = 2.107e-8
Identity = 28/81 (34.57%), Postives = 41/81 (50.62%), Query Frame = 2
Query:  146 LRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRN 388
            +R+E +R  TF++        S+++A  GF+F G+    D+V C  C G L HW  G+    EH R F  C F +   V N
Sbjct:   17 MRRERERLQTFQNWPDEAPVTSEDLAKAGFYFLGSE---DKVRCFCCGGILRHWADGDCPTAEHSRHFPNCKFILGQAVGN 94          
BLAST of SMED30014301 vs. Ensembl Medaka
Match: xiap (E3 ubiquitin-protein ligase XIAP [Source:NCBI gene;Acc:101166883])

HSP 1 Score: 53.1434 bits (126), Expect = 2.167e-8
Identity = 31/105 (29.52%), Postives = 49/105 (46.67%), Query Frame = 2
Query:   98 KMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEG 412
            + R ++      R   ++ EE R  TF         + +++A  G F+ G     D+V C  C G+LS W+ G+T   EH + FS C + +  DV N  + R  G
Sbjct:  122 RTRAIVDETPYPRNRNMKSEEARLETFSSWPRSAPVRPRDLAQAGLFYLGKE---DKVECFSCGGKLSGWKPGDTPWNEHEKHFSHCFYILGHDVGNVPLERDGG 223          
BLAST of SMED30014301 vs. Ensembl Medaka
Match: xiap (E3 ubiquitin-protein ligase XIAP [Source:NCBI gene;Acc:101166883])

HSP 1 Score: 53.1434 bits (126), Expect = 2.314e-8
Identity = 31/105 (29.52%), Postives = 49/105 (46.67%), Query Frame = 2
Query:   98 KMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEG 412
            + R ++      R   ++ EE R  TF         + +++A  G F+ G     D+V C  C G+LS W+ G+T   EH + FS C + +  DV N  + R  G
Sbjct:  123 RTRAIVDETPYPRNRNMKSEEARLETFSSWPRSAPVRPRDLAQAGLFYLGKE---DKVECFSCGGKLSGWKPGDTPWNEHEKHFSHCFYILGHDVGNVPLERDGG 224          
BLAST of SMED30014301 vs. Planmine SMEST
Match: SMESG000074160.1 (SMESG000074160.1)

HSP 1 Score: 367.081 bits (941), Expect = 9.450e-118
Identity = 173/180 (96.11%), Postives = 177/180 (98.33%), Query Frame = 2
Query:    2 RLWKKPEEEEKIKTLVIAIQHYTSFDTTGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSEIDSDEKGGEKRITIIKSFEDPAELIWEKETINRTFEER 541
            RLWKKPEEEE+IKTL IAIQHYTSFDTTGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDV NQA+NRLEGLRQSEIDSDEKGGEK+ITIIK+FEDP ELIWEKETINRTFEER
Sbjct: 4592 RLWKKPEEEERIKTLAIAIQHYTSFDTTGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVGNQAINRLEGLRQSEIDSDEKGGEKKITIIKNFEDPTELIWEKETINRTFEER 4771          
BLAST of SMED30014301 vs. Planmine SMEST
Match: SMESG000012882.1 (SMESG000012882.1)

HSP 1 Score: 343.199 bits (879), Expect = 2.144e-109
Identity = 173/180 (96.11%), Postives = 177/180 (98.33%), Query Frame = 2
Query:    2 RLWKKPEEEEKIKTLVIAIQHYTSFDTTGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSEIDSDEKGGEKRITIIKSFEDPAELIWEKETINRTFEER 541
            RLWKKPEEEEKIKTLVIAIQHYTSFDTTGRPWKMRKVIYSQR+VRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDV NQA+NRLEGLRQSE+D DEKGGEK+ITIIK FEDPAELIWEKETINRTFEER
Sbjct: 3132 RLWKKPEEEEKIKTLVIAIQHYTSFDTTGRPWKMRKVIYSQRKVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVGNQAINRLEGLRQSELDKDEKGGEKKITIIKGFEDPAELIWEKETINRTFEER 3311          
BLAST of SMED30014301 vs. Planmine SMEST
Match: SMESG000023758.1 (SMESG000023758.1)

HSP 1 Score: 320.857 bits (821), Expect = 1.507e-101
Identity = 153/180 (85.00%), Postives = 165/180 (91.67%), Query Frame = 2
Query:    2 RLWKKPEEEEKIKTLVIAIQHYTSFDTTGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSEIDSDEKGGEKRITIIKSFEDPAELIWEKETINRTFEER 541
            RLWKKPEEEEK+ TL  AI +Y  +D   RP ++ K IYSQ RVR EELRKEEQRYLTFKDNKVFTDRQSKEMAA+GF+F+GTPELPDEVTCIYC+G+L+ WEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSEIDSDEKGGEK+ITIIKSFEDPAELIWEKETINRTFEER
Sbjct: 4052 RLWKKPEEEEKVNTLAAAIIYYKDYDGIRRPTRIIKAIYSQMRVRDEELRKEEQRYLTFKDNKVFTDRQSKEMAAEGFYFTGTPELPDEVTCIYCKGKLAKWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSEIDSDEKGGEKKITIIKSFEDPAELIWEKETINRTFEER 4231          
BLAST of SMED30014301 vs. Planmine SMEST
Match: SMESG000073574.1 (SMESG000073574.1)

HSP 1 Score: 315.464 bits (807), Expect = 8.363e-100
Identity = 150/180 (83.33%), Postives = 165/180 (91.67%), Query Frame = 2
Query:    2 RLWKKPEEEEKIKTLVIAIQHYTSFDTTGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSEIDSDEKGGEKRITIIKSFEDPAELIWEKETINRTFEER 541
            RLWKKPEEEEK+ TL  AI +Y  +D T RP ++ K IYSQ RVR EELRKEEQRYLTFKDNKVFT+RQS+EMAAQGF+F+GTPELPDEVTCIYC+G+L+ WEKGETAKREHLRKF TCPFRINIDVRNQAMNRLEG+RQSEIDSDEKGGEK+ITIIK+FEDPAELIWEKETINRTFEER
Sbjct: 1521 RLWKKPEEEEKVNTLAAAIIYYKDYDGTRRPTQVIKAIYSQMRVRDEELRKEEQRYLTFKDNKVFTERQSQEMAAQGFYFTGTPELPDEVTCIYCKGKLAKWEKGETAKREHLRKFPTCPFRINIDVRNQAMNRLEGIRQSEIDSDEKGGEKKITIIKNFEDPAELIWEKETINRTFEER 1700          
BLAST of SMED30014301 vs. Planmine SMEST
Match: SMESG000066529.1 (SMESG000066529.1)

HSP 1 Score: 303.523 bits (776), Expect = 1.511e-95
Identity = 144/180 (80.00%), Postives = 160/180 (88.89%), Query Frame = 2
Query:    2 RLWKKPEEEEKIKTLVIAIQHYTSFDTTGRPWKMRKVIYSQRRVRYEELRKEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLSHWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSEIDSDEKGGEKRITIIKSFEDPAELIWEKETINRTFEER 541
            RLWKKPEEEEK+ TL  +I +Y  +D T RP ++ K IYSQRRV+ EELRKEEQRYLTFKDNKVFT+RQS+EMAAQGF+F+GTPELPDEVTCIYC+G+L+ WEKGETAKREHLRKF TCPFRINIDVRNQAMNR EGLRQSE+D DEKGGEK+ITIIK FEDP EL WEKETI RTFEER
Sbjct: 3849 RLWKKPEEEEKVNTLAASIIYYKDYDGTRRPTQIIKAIYSQRRVKDEELRKEEQRYLTFKDNKVFTERQSQEMAAQGFYFTGTPELPDEVTCIYCKGKLAKWEKGETAKREHLRKFPTCPFRINIDVRNQAMNRSEGLRQSELDKDEKGGEKKITIIKGFEDPTELKWEKETIKRTFEER 4028          
The following BLAST results are available for this feature:
BLAST of SMED30014301 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BIRC29.325e-936.73baculoviral IAP repeat containing 2 [Source:HGNC S... [more]
BIRC29.692e-936.73baculoviral IAP repeat containing 2 [Source:HGNC S... [more]
XIAP2.343e-828.30X-linked inhibitor of apoptosis [Source:HGNC Symbo... [more]
XIAP2.343e-828.30X-linked inhibitor of apoptosis [Source:HGNC Symbo... [more]
XIAP2.343e-828.30X-linked inhibitor of apoptosis [Source:HGNC Symbo... [more]
back to top
BLAST of SMED30014301 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014301 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Diap22.485e-729.91gene:FBgn0015247 transcript:FBtr0087297[more]
Diap22.485e-729.91gene:FBgn0015247 transcript:FBtr0087296[more]
back to top
BLAST of SMED30014301 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
birc71.345e-836.17baculoviral IAP repeat containing 7 [Source:ZFIN;A... [more]
birc71.973e-836.17baculoviral IAP repeat containing 7 [Source:ZFIN;A... [more]
xiap3.098e-729.41X-linked inhibitor of apoptosis [Source:ZFIN;Acc:Z... [more]
xiap3.098e-729.41X-linked inhibitor of apoptosis [Source:ZFIN;Acc:Z... [more]
birc21.167e-634.25baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
back to top
BLAST of SMED30014301 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fasn7.875e-1134.62fatty acid synthase [Source:Xenbase;Acc:XB-GENE-10... [more]
crebrf1.936e-837.66CREB3 regulatory factor [Source:Xenbase;Acc:XB-GEN... [more]
crebrf2.431e-837.66CREB3 regulatory factor [Source:Xenbase;Acc:XB-GEN... [more]
crebrf2.471e-837.66CREB3 regulatory factor [Source:Xenbase;Acc:XB-GEN... [more]
asrgl14.173e-831.11asparaginase like 1 [Source:Xenbase;Acc:XB-GENE-98... [more]
back to top
BLAST of SMED30014301 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Xiap2.895e-829.25X-linked inhibitor of apoptosis [Source:MGI Symbol... [more]
Xiap2.895e-829.25X-linked inhibitor of apoptosis [Source:MGI Symbol... [more]
Xiap2.895e-829.25X-linked inhibitor of apoptosis [Source:MGI Symbol... [more]
Xiap2.895e-829.25X-linked inhibitor of apoptosis [Source:MGI Symbol... [more]
Birc71.124e-733.33baculoviral IAP repeat-containing 7 (livin) [Sourc... [more]
back to top
BLAST of SMED30014301 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5BKL8|XIAP_XENTR4.172e-1034.62E3 ubiquitin-protein ligase XIAP OS=Xenopus tropic... [more]
sp|A5D8Q0|XIAP_XENLA2.498e-934.31E3 ubiquitin-protein ligase XIAP OS=Xenopus laevis... [more]
sp|Q9R0I6|XIAP_RAT3.532e-830.19E3 ubiquitin-protein ligase XIAP OS=Rattus norvegi... [more]
sp|Q8JHV9|BIR7A_XENLA4.772e-830.00Baculoviral IAP repeat-containing protein 7-A OS=X... [more]
sp|O62640|PIAP_PIG4.843e-838.16Putative inhibitor of apoptosis OS=Sus scrofa OX=9... [more]
back to top
BLAST of SMED30014301 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3Z9S31.469e-938.75RING-type domain-containing protein (Fragment) OS=... [more]
A0A1S3H0021.037e-837.04baculoviral IAP repeat-containing protein 7-like O... [more]
A0A1S3KI491.471e-829.63baculoviral IAP repeat-containing protein 3-like O... [more]
A0A1I8G1042.564e-833.03RING-type domain-containing protein OS=Macrostomum... [more]
A0A1S3HHF52.724e-838.27uncharacterized protein LOC106155253 OS=Lingula un... [more]
back to top
BLAST of SMED30014301 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000038426.12.828e-930.95pep primary_assembly:Astyanax_mexicanus-2.0:24:104... [more]
birc79.138e-928.32baculoviral IAP repeat-containing protein 7 [Sourc... [more]
birc71.018e-828.97baculoviral IAP repeat-containing protein 7 [Sourc... [more]
birc71.240e-828.97baculoviral IAP repeat-containing protein 7 [Sourc... [more]
birc71.350e-828.97baculoviral IAP repeat-containing protein 7 [Sourc... [more]
back to top
BLAST of SMED30014301 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
birc21.752e-833.78baculoviral IAP repeat containing 2 [Source:ZFIN;A... [more]
back to top
BLAST of SMED30014301 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014301 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30014301 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000012200.27.966e-934.18baculoviral IAP repeat containing 7 [Source:NCBI g... [more]
ENSORLT00000039931.17.966e-934.18baculoviral IAP repeat containing 7 [Source:NCBI g... [more]
ENSORLT00000034629.11.063e-834.18baculoviral IAP repeat containing 7 [Source:NCBI g... [more]
xiap2.167e-829.52E3 ubiquitin-protein ligase XIAP [Source:NCBI gene... [more]
xiap2.314e-829.52E3 ubiquitin-protein ligase XIAP [Source:NCBI gene... [more]
back to top
BLAST of SMED30014301 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074160.19.450e-11896.11SMESG000074160.1[more]
SMESG000012882.12.144e-10996.11SMESG000012882.1[more]
SMESG000023758.11.507e-10185.00SMESG000023758.1[more]
SMESG000073574.18.363e-10083.33SMESG000073574.1[more]
SMESG000066529.11.511e-9580.00SMESG000066529.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014301 ID=SMED30014301|Name=SMED30014301|organism=Schmidtea mediterranea sexual|type=transcript|length=541bp
GAGATTATGGAAAAAACCAGAGGAAGAGGAAAAAATCAAAACCTTAGTAA
TCGCAATTCAGCACTATACCAGTTTCGACACAACCGGACGACCATGGAAA
ATGAGGAAAGTAATTTACTCACAGAGAAGAGTAAGATACGAAGAGCTGAG
AAAAGAGGAACAGAGATATCTAACGTTCAAAGATAATAAGGTATTTACCG
ACCGACAGAGTAAAGAGATGGCAGCACAAGGATTCTTTTTCTCAGGAACC
CCCGAATTACCAGATGAAGTTACCTGTATTTATTGTCAAGGAAGACTATC
ACACTGGGAAAAAGGAGAGACAGCTAAACGAGAACACCTGAGGAAATTTT
CAACCTGCCCATTTAGAATTAATATCGATGTAAGAAACCAAGCGATGAAC
AGATTAGAAGGACTTCGACAATCAGAAATAGACAGTGATGAAAAGGGAGG
TGAGAAAAGGATAACGATAATAAAGAGTTTCGAAGATCCAGCAGAATTAA
TCTGGGAAAAAGAAACCATAAATAGAACATTCGAAGAGAGA
back to top

protein sequence of SMED30014301-orf-1

>SMED30014301-orf-1 ID=SMED30014301-orf-1|Name=SMED30014301-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=180bp
RLWKKPEEEEKIKTLVIAIQHYTSFDTTGRPWKMRKVIYSQRRVRYEELR
KEEQRYLTFKDNKVFTDRQSKEMAAQGFFFSGTPELPDEVTCIYCQGRLS
HWEKGETAKREHLRKFSTCPFRINIDVRNQAMNRLEGLRQSEIDSDEKGG
EKRITIIKSFEDPAELIWEKETINRTFEER
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR001370BIR_rpt
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding