CDK-activating kinase assembly factor MAT1

Overview
NameCDK-activating kinase assembly factor MAT1
Smed IDSMED30014291
Length (bp)1163
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CDK-activating kinase assembly factor MAT1 (SMED30014291) t-SNE clustered cells

Violin plots show distribution of expression levels for CDK-activating kinase assembly factor MAT1 (SMED30014291) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CDK-activating kinase assembly factor MAT1 (SMED30014291) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CDK-activating kinase assembly factor MAT1 (SMED30014291) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014291

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014291h1SMcG0011105 SmedASXL_012259SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014291h1SMcG0011105 SmedASXL_012259SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30014291h1SMcG0011105 dd_Smed_v4_5889_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014291h1SMcG0011105 dd_Smed_v4_5889_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Human
Match: MNAT1 (MNAT1 component of CDK activating kinase [Source:HGNC Symbol;Acc:HGNC:7181])

HSP 1 Score: 98.5969 bits (244), Expect = 5.645e-23
Identity = 47/131 (35.88%), Postives = 77/131 (58.78%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIK 440
            Q CP+C+ +      LK  V+ CGH++C  C +L+F+R   +CP+C T L K++FR ++FE+  V+  +   + V + YN  + DF +L EYND+LEEVE ++ +L +    +  + KM  Y    K  I+
Sbjct:    4 QGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQ 134          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Human
Match: MNAT1 (MNAT1 component of CDK activating kinase [Source:HGNC Symbol;Acc:HGNC:7181])

HSP 1 Score: 98.5969 bits (244), Expect = 1.032e-22
Identity = 47/131 (35.88%), Postives = 77/131 (58.78%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIK 440
            Q CP+C+ +      LK  V+ CGH++C  C +L+F+R   +CP+C T L K++FR ++FE+  V+  +   + V + YN  + DF +L EYND+LEEVE ++ +L +    +  + KM  Y    K  I+
Sbjct:    4 QGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQ 134          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Celegans
Match: mnat-1 (MNAT (Menage a trois) TFIIH subunit [Source:UniProtKB/TrEMBL;Acc:O17245])

HSP 1 Score: 80.8777 bits (198), Expect = 6.017e-17
Identity = 44/168 (26.19%), Postives = 86/168 (51.19%), Query Frame = 3
Query:   54 CPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIKLRRNRKDKDLEVFEQWEKKEEIIHNQANDEMNQEKIKKE 557
            C KC+ +  + K L   ++ CGH +C  C + +F  N  +C  C+  L KN+FR +++E+  ++      + +++ YN  Q DF+ L E+ DY E  ET++++L+      E   +++ +    K +I   + R D D +  E   ++E  +  +  D M  +  ++E
Sbjct:    4 CKKCKSNEYTNKQLVMMINECGHPLCKNCVDNIFALNSGNCHVCNRVLRKNNFREQIYEDPLIDKETFLRRKLRKIYNLKQDDFENLREFGDYQERFETVVYNLVFETNVNETNAEIQAFEEKHKEQIDRNKRRLDDDQKWIEDQLREERAMKARMTDHMEMDAKEQE 171          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Fly
Match: Mat1 (gene:FBgn0024956 transcript:FBtr0088255)

HSP 1 Score: 102.449 bits (254), Expect = 2.577e-24
Identity = 60/198 (30.30%), Postives = 106/198 (53.54%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIKLRRNRKDKD---LEVFEQWEKKEEIIHNQANDEM-NQEKIKKENIDECFKRKLITSDEPLNEVVMEL 629
            Q CP+C+ +      LK  V+ CGH++C  C +L+F++   +CP+C   L +N+FR ++FE+  VE  +   + + R YN  + DF +L EYNDYLEE+E ++++L +     E   ++  Y    +  I+  + R  +D   LE   + EK +E    +  +E+ N+ K KK    +    +L+ S +   ++V E 
Sbjct:    4 QACPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFLKGSGACPECMVPLRRNNFRVQLFEDPMVEKEVDIRRRILRDYNKREEDFASLAEYNDYLEEIEDIVYNLCNNIDIIETNKRIEAYKRDNREVIQRNKTRVGRDEYALEEMLELEKVQEEARRKELEELENEHKKKKARDKQALIEELMYSGKDAAQIVTEF 201          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Zebrafish
Match: mnat1 (MNAT1 component of CDK activating kinase [Source:ZFIN;Acc:ZDB-GENE-041010-203])

HSP 1 Score: 94.7449 bits (234), Expect = 1.724e-21
Identity = 45/131 (34.35%), Postives = 76/131 (58.02%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIK 440
            Q CP+C+ +      LK  V+ CGH++C  C +++F+R   +C +C T L K++FR ++FE+  ++  +   + V + YN  + DF +L EYNDYLE+VE ++ +L +    E  + KM  Y    K  I+
Sbjct:    4 QGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDMLFVRGSGNCVQCDTPLRKSNFRVQLFEDPAIDKEVEIRKKVLKIYNKREFDFSSLTEYNDYLEQVEDIVFNLANNMDVEMTKQKMEQYQRDNKDVIQ 134          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Xenopus
Match: bag1 (BCL2 associated athanogene 1 [Source:Xenbase;Acc:XB-GENE-957568])

HSP 1 Score: 93.9745 bits (232), Expect = 3.838e-21
Identity = 44/131 (33.59%), Postives = 77/131 (58.78%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIK 440
            Q CP+C+ +      LK  V+ CGH++C  C EL+F+R   SC +C+T L K++FR ++FE+  ++  +   + + + YN  + DF +L EYND+LE++E ++ +L +    +  R K+  Y    K  I+
Sbjct:    4 QGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVELLFVRGSGSCQECNTPLRKSNFRVQLFEDPTIDKEVEIRKKILKIYNKREEDFPSLREYNDFLEDIEEIVFNLTNNVDLDNTRRKIDMYQKENKDTIQ 134          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Xenopus
Match: bag1 (BCL2 associated athanogene 1 [Source:Xenbase;Acc:XB-GENE-957568])

HSP 1 Score: 93.9745 bits (232), Expect = 4.011e-21
Identity = 44/131 (33.59%), Postives = 77/131 (58.78%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIK 440
            Q CP+C+ +      LK  V+ CGH++C  C EL+F+R   SC +C+T L K++FR ++FE+  ++  +   + + + YN  + DF +L EYND+LE++E ++ +L +    +  R K+  Y    K  I+
Sbjct:    4 QGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVELLFVRGSGSCQECNTPLRKSNFRVQLFEDPTIDKEVEIRKKILKIYNKREEDFPSLREYNDFLEDIEEIVFNLTNNVDLDNTRRKIDMYQKENKDTIQ 134          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Mouse
Match: Mnat1 (menage a trois 1 [Source:MGI Symbol;Acc:MGI:106207])

HSP 1 Score: 100.523 bits (249), Expect = 5.791e-24
Identity = 48/131 (36.64%), Postives = 77/131 (58.78%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIK 440
            Q CP+C+ +      LK  V+ CGH++C  C +L+F+R   +CP+C T L K++FR ++FE+  V+  +   + V + YN  + DF +L EYND+LEEVE ++ +L +    E  + KM  Y    K  I+
Sbjct:    4 QGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLENTKKKMEIYQKENKDVIQ 134          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Mouse
Match: Mnat1 (menage a trois 1 [Source:MGI Symbol;Acc:MGI:106207])

HSP 1 Score: 100.523 bits (249), Expect = 1.789e-23
Identity = 84/298 (28.19%), Postives = 147/298 (49.33%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEI---KLRRNRKDKDLEVFEQWEKKEEIIHNQ-----ANDEMNQEKIKKENIDECFKRKLITSDEPLNEVVM-------ELEYTLAREQESRVLQARGDVKMKSE----PLKRYQYCVPLYMHRPEFKYNTARDLKSEILLTTLK-----KPAEGLIRGGGYTPAFWLFR 869
            Q CP+C+ +      LK  V+ CGH++C  C +L+F+R   +CP+C T L K++FR ++FE+  V+  +   + V + YN  + DF +L EYND+LEEVE ++ +L +    E  + KM  Y    K  I   KL+  R+ ++LE   + E++E   H Q       +E  Q+ +K++N  + F  +L +SD P+  ++        +LE  L + +  + +     +KM  +    P+++ +    LY ++P         +  + LL  L      + A      GGYT +    R
Sbjct:    4 QGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLENTKKKMEIYQKENKDVIQKNKLKLTREQEELEEALEVERQE---HEQRRLFIQKEEELQQALKRKN-KQAFLDELESSDLPVALLLAQHKDRSTQLEMQLEKPRSMKPVTFSTGIKMGQQISLAPIQKLEEA--LYEYQPLQIETCGPQVPEQELLGRLGYLNHVRAASPQDLAGGYTSSLACHR 295          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Mouse
Match: Mnat1 (menage a trois 1 [Source:MGI Symbol;Acc:MGI:106207])

HSP 1 Score: 64.6994 bits (156), Expect = 1.051e-12
Identity = 26/66 (39.39%), Postives = 43/66 (65.15%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVE 245
            Q CP+C+ +      LK  V+ CGH++C  C +L+F+R   +CP+C T L K++FR ++FE+  V+
Sbjct:    4 QGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVD 69          
BLAST of CDK-activating kinase assembly factor MAT1 vs. UniProt/SwissProt
Match: sp|P51950|MAT1_MARGL (CDK-activating kinase assembly factor MAT1 OS=Marthasterias glacialis OX=7609 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.168e-25
Identity = 64/195 (32.82%), Postives = 105/195 (53.85%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIKLRRNRKDKD---LEVFEQWEKKEEIIHNQANDEMN-QEKIKKENIDECFKRKLITSDEPLNEVV 620
            Q CP+C+ +      LK  V+ CGH++C  C E++F+R   SCP C+T L +N FR + FE+  VE  +   + + + +N  + +F  L++YNDYLEE+ET+I +L +    E  + K+  Y  + +  I   R+++  D   LE   Q E ++E    Q    M  Q K +K+   E    +LI S+ P + V+
Sbjct:    5 QACPRCKSTKYRNPSLKLLVNVCGHTLCENCVEILFVRGSGSCPSCNTPLRRNQFRVQEFEDAYVEKEVDIRKRILKDFNKQEEEFPALKDYNDYLEEIETIIFNLANGTELEATKRKVDQYRKNNRESIMKNRSKQSSDQAYLEALLQQENEDEEEKKQQLQFMERQTKNQKKRDKEALIDELIHSNMPADHVI 199          
BLAST of CDK-activating kinase assembly factor MAT1 vs. UniProt/SwissProt
Match: sp|P51949|MAT1_MOUSE (CDK-activating kinase assembly factor MAT1 OS=Mus musculus OX=10090 GN=Mnat1 PE=1 SV=2)

HSP 1 Score: 100.523 bits (249), Expect = 1.252e-22
Identity = 84/298 (28.19%), Postives = 147/298 (49.33%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEI---KLRRNRKDKDLEVFEQWEKKEEIIHNQ-----ANDEMNQEKIKKENIDECFKRKLITSDEPLNEVVM-------ELEYTLAREQESRVLQARGDVKMKSE----PLKRYQYCVPLYMHRPEFKYNTARDLKSEILLTTLK-----KPAEGLIRGGGYTPAFWLFR 869
            Q CP+C+ +      LK  V+ CGH++C  C +L+F+R   +CP+C T L K++FR ++FE+  V+  +   + V + YN  + DF +L EYND+LEEVE ++ +L +    E  + KM  Y    K  I   KL+  R+ ++LE   + E++E   H Q       +E  Q+ +K++N  + F  +L +SD P+  ++        +LE  L + +  + +     +KM  +    P+++ +    LY ++P         +  + LL  L      + A      GGYT +    R
Sbjct:    4 QGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLENTKKKMEIYQKENKDVIQKNKLKLTREQEELEEALEVERQE---HEQRRLFIQKEEELQQALKRKN-KQAFLDELESSDLPVALLLAQHKDRSTQLEMQLEKPRSMKPVTFSTGIKMGQQISLAPIQKLEEA--LYEYQPLQIETCGPQVPEQELLGRLGYLNHVRAASPQDLAGGYTSSLACHR 295          
BLAST of CDK-activating kinase assembly factor MAT1 vs. UniProt/SwissProt
Match: sp|P51948|MAT1_HUMAN (CDK-activating kinase assembly factor MAT1 OS=Homo sapiens OX=9606 GN=MNAT1 PE=1 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 4.955e-22
Identity = 47/131 (35.88%), Postives = 77/131 (58.78%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIK 440
            Q CP+C+ +      LK  V+ CGH++C  C +L+F+R   +CP+C T L K++FR ++FE+  V+  +   + V + YN  + DF +L EYND+LEEVE ++ +L +    +  + KM  Y    K  I+
Sbjct:    4 QGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQ 134          
BLAST of CDK-activating kinase assembly factor MAT1 vs. UniProt/SwissProt
Match: sp|P51951|MAT1_XENLA (CDK-activating kinase assembly factor MAT1 OS=Xenopus laevis OX=8355 GN=mnat1 PE=2 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.694e-20
Identity = 44/131 (33.59%), Postives = 76/131 (58.02%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIK 440
            Q CP+C+ +      LK  V+ CGH++C  C EL+F+R   SC +C T L K++F+ ++FE+  ++  +   + + + YN  + DF +L EYND+LEE+E ++ +L +    +  R K+  Y    K  I+
Sbjct:    4 QGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVELLFVRGSGSCQECDTPLRKSNFKVQLFEDPTIDKEVEIRKKILKIYNKREEDFPSLREYNDFLEEIEEIVLNLTNNVDLDNTRRKIDMYQKENKDTIQ 134          
BLAST of CDK-activating kinase assembly factor MAT1 vs. UniProt/SwissProt
Match: sp|Q6FMP4|TFB3_CANGA (RNA polymerase II transcription factor B subunit 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=TFB3 PE=3 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 2.436e-14
Identity = 81/262 (30.92%), Postives = 124/262 (47.33%), Query Frame = 3
Query:   51 ICPKCQGSNASFKDLKFKVS-YCGHSICIKCYELMFIRNEDSCP--KCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDT-LEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIKLRRNRKDKDLEVFEQWEK-------KEEIIHNQ--ANDEMNQEKIKKENIDECFKRKLITSDEPLNEV--VMELEYTLAR---EQESRVLQARG-DVKMKSEPLKRYQYCVPLYMHRPEFKYNTARDL 779
            +CP C+       D++F V+  C H IC  C + +F      CP   C   L KN F+T++F++  VE  +   + V   +N    DFD  LE YN YLEEVE +++ L +     E   K+R Y    K  I     R  KDLE FEQ ++       K+ ++  Q  + D+MN+E  K+E ++         +D+ +  V   ++L+ + AR   E+ +RVLQ       M S+ L R +  VP         +N  RDL
Sbjct:   22 MCPICKTDRYLSPDVRFLVNPECYHKICESCVDRIFSLGPAPCPYKSCDKILRKNKFKTQIFDDVGVEKEVDIRKRVFNVFNKTLEDFDNDLEAYNKYLEEVEDIVYKLDNKIDVVETEEKLRTYEELNKQLIMNNMERSKKDLENFEQRQQFEKEMRMKKRMLERQIESEDKMNKEWAKREIVNRLASS--TNADDVIEGVKNTVKLKKSSARRKLEEINRVLQNNPYSSLMLSQGLSRKEDNVPFT------PFNGDRDL 275          
BLAST of CDK-activating kinase assembly factor MAT1 vs. TrEMBL
Match: K1Q034 (CDK-activating kinase assembly factor MAT1 OS=Crassostrea gigas OX=29159 GN=CGI_10002662 PE=4 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 1.176e-26
Identity = 72/210 (34.29%), Postives = 116/210 (55.24%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIKLRRNRKDKD---LEVFEQWEKKEEIIHNQ-ANDEMNQEKIKKENIDECFKRKLITSDEPLNEVVMELEYTLAREQESRV 665
            Q CP+C+ +      LK  V+ CGHS+C  C E +F++    CP+C T L KN+FR ++FE+  +E  +   + + + YN  + DF TLEEYNDY+E +ETLI ++++    +E R  +  Y    K +I   RN+K KD   LE   + EK+E  +  +   +E  +EK  K+   E    +L+ SD    +++ E +  + +E E RV
Sbjct:    4 QGCPRCKTTKYRNPSLKLLVNVCGHSLCETCVEALFVKGSGICPECGTALRKNNFRVQLFEDPFIEKEIEVRRKILKDYNKKEEDFKTLEEYNDYIEMIETLIFNIVNNIDVDETRQMIEQYKRENKDQINKGRNKKSKDEEYLECLIEQEKEESSLKRKFIVEEEQREKDSKKKHKEALLDELMFSDRSALDILNEHKTDIDKENELRV 213          
BLAST of CDK-activating kinase assembly factor MAT1 vs. TrEMBL
Match: R7THV1 (CDK-activating kinase assembly factor MAT1 OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_89450 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 6.706e-26
Identity = 84/286 (29.37%), Postives = 142/286 (49.65%), Query Frame = 3
Query:   54 CPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIKLRRNRKDKDLEVFEQWEKKE-EIIHNQAN---DEMNQEKIKKENIDECFKRKLITSDEPLNEVVMELEYTLAREQ-----------ESRVLQARGDVKMKSEPL---KRYQYCVPLYMHRPEFKYNTARDLKSEILLTTLKKPAEGLIRGGGYTPAF 857
            CP+C+ +     DLK  V+ CGHS+C  C +L+F+R   SC +CS  L +N+FR +MFE+  VE      + + + +N  + DF +L E+NDYLE+VET++ +L +    EE + K+  Y    +  I+  R +  K+ E  E     E EI+ N  N    E+N+EK +K    E     L+ SD P N +V   +  ++ ++            + +   + D  +  +P+   K + Y  PL +H     +  A D+++   L+ + + A    R GGY  + 
Sbjct:    6 CPRCKTTKYRNPDLKLMVNVCGHSLCENCVDLLFVRGSGSCLECSVPLRRNNFRLQMFEDSYVEKETDIRKKILKDFNKKEEDFSSLREFNDYLEDVETIVFNLTNGIDLEETKRKVELYKKEHQDSIRKNRAKMSKEEEELEDMIATEREIVENNRNIIQAEINREKKQKLKQKEALIDDLMFSDLPANHIVATHQQEVSSQKIKSSELKTTKFSTGISMGKRDAFLPIKPVVEGKVFTYS-PLTIHTAGPDFPPAHDIQNLGYLSHI-RAASDQERAGGYEASL 289          
BLAST of CDK-activating kinase assembly factor MAT1 vs. TrEMBL
Match: A0A0L8GZA1 (RING-type domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22025470mg PE=4 SV=1)

HSP 1 Score: 115.546 bits (288), Expect = 1.040e-25
Identity = 64/191 (33.51%), Postives = 111/191 (58.12%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIKLRRNRKDKDLEVF-----EQWEKKEEIIHNQANDEMNQEKIKKENIDECFKRKLITSDEP 605
            Q CP+C+ +      LK  V+ CGHS+C  C +L+FIR   +CP+C+T L +N+FR ++FE+  VE  +   + + + +N  +SDF +L EYNDYLE VETLI++L +    E  + ++ +Y    K +I   R++  +D E       E+ +  E+ +     +E  ++++K++N  E    +L++SD P
Sbjct:    4 QGCPRCKTTKYRNPSLKLLVNVCGHSLCENCVDLLFIRGSGACPECNTALRRNNFRVQLFEDTTVEKEVDIRKRILKDFNQRESDFSSLNEYNDYLEMVETLIYNLSNNIDVESTKRRIENYRKDNKEQIMKNRSKVSQDEEYLDMLLDEEIQNTEKRLKETFENEQKEKQLKRKN-KELLLDELMSSDLP 193          
BLAST of CDK-activating kinase assembly factor MAT1 vs. TrEMBL
Match: A0A336L0K7 (CDK-activating kinase assembly factor MAT1 OS=Culicoides sonorensis OX=179676 GN=CSON014083 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 6.330e-25
Identity = 76/259 (29.34%), Postives = 130/259 (50.19%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEI---KLRRNRKDKDLEVFEQWEKKEEIIHNQANDEMNQE-KIKKENIDECFKRKLITSDEPLNEVVMELEYTLARE-QESRVL---------------QARGDVKMKSEPLKRYQYCVPLYMHRPEFKYN 764
            Q CPKC+ +      LK  V+ CGH++C  C EL+F++   SCP+C   L +N+FR ++FEN  VE  +   + + R YN  + DFD+L+EYN+YLEE+ET+I++L +         ++  Y    K  I   K R  R++ +LE   + EK++E    Q   ++ QE + KK    E    +L+ S+E    +V +    +    +E++V+                +   V+ +  P+ +    +P   H P+ + N
Sbjct:    4 QACPKCKTTKYRNPSLKLMVNVCGHNLCESCVELLFVKGSGSCPECGVPLRRNNFRVQLFENPMVEKEVDIRKRILRDYNKKEEDFDSLDEYNNYLEEIETIIYNLSNNIDIINTNKRIEQYKKENKDVILKNKQRMGREEFELEQMLEIEKEQEEARKQELTKLEQENRRKKAQAKEDLIDELMFSNEDGAAIVSQFAKQVEETYKEAKVIPPQPKVTSFSSGIQFGSAASVQSQFLPIPKQDEGIPFEYHSPQLQNN 262          
BLAST of CDK-activating kinase assembly factor MAT1 vs. TrEMBL
Match: T1JFU7 (RING-type domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 6.613e-25
Identity = 65/200 (32.50%), Postives = 108/200 (54.00%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIKLRRNRKDKDLEVFEQWEKKEEI--------IHNQANDEMNQEKIKKEN-IDECFKRKLITSDEPLNEVV 620
            Q CPKC+ +      LK  V+ CGH++C  C EL+F++   +CP C   L +N+FRTR+FE+  VE  +   + + R YN  + DF +L EYNDYLE+VE++IH+L    + +  ++ +  Y    K+ I+  +++  +D    E+  + EE+        ++ Q  D+   +   +EN IDE     L  SD P   ++
Sbjct:    4 QECPKCKTTKYRNPSLKLLVNVCGHALCDNCVELLFVKGSGACPICRIPLRRNNFRTRLFEDAVVEKEVDIRKKILRDYNKKEDDFASLNEYNDYLEQVESIIHNLTHGVSVDATKSTIEQYRKENKSLIQKNKSKLSRDDAFLEELIEAEEMKTALRQKQLYQQERDDKRLKAKNRENLIDE-----LTYSDAPAGHIL 198          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Cavefish
Match: mnat1 (MNAT1 component of CDK activating kinase [Source:ZFIN;Acc:ZDB-GENE-041010-203])

HSP 1 Score: 90.8929 bits (224), Expect = 2.102e-20
Identity = 42/122 (34.43%), Postives = 72/122 (59.02%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDY 413
            Q CP+C+ +      LK  V+ CGH++C  C +++F+R   +C +C T L K++FR ++FE+  ++  +   + V + YN    DF +L EYNDYLE+VE ++++L +    E  +  M  Y
Sbjct:    4 QGCPRCKTTKYRNPSLKLMVNVCGHTLCENCVDMLFVRGSGNCVQCDTPLRKSNFRLQLFEDPAIDKEVEIRKRVLKIYNKRDFDFSSLREYNDYLEQVEEIVYNLTNNVDVERTKQIMEQY 125          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Yeast
Match: TFB3 (Subunit of TFIIH and nucleotide excision repair factor 3 complexes; involved in transcription initiation, required for nucleotide excision repair; ring finger protein similar to mammalian CAK and TFIIH subunit [Source:SGD;Acc:S000002868])

HSP 1 Score: 73.9442 bits (180), Expect = 3.645e-15
Identity = 66/216 (30.56%), Postives = 106/216 (49.07%), Query Frame = 3
Query:   51 ICPKCQGSNASFKDLKFKVS-YCGHSICIKCYELMFIRNEDSCP--KCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDT-LEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIKLRRNRKDKDLEVFEQWEK-------KEEIIHNQANDE--MNQEKIKKENIDECFKRKLITSDEPLNEVVMELEYTLAREQES 659
            +CP C+       D+KF V+  C H IC  C + +F      CP   C   L KN F+T++F++ +VE  +   + V   +N    DF+  L EYN YLEEVE +I+ L       +   K+R Y    K  I     R   ++E FEQ +K       K+ ++  Q  +E  MN+E  KKE ++     +L T+ + +NE +  ++ T+  ++ S
Sbjct:   12 MCPICKTDRYLSPDVKFLVNPECYHRICESCVDRIFSLGPAQCPYKGCDKILRKNKFKTQIFDDVEVEKEVDIRKRVFNVFNKTIDDFNGDLVEYNKYLEEVEDIIYKLDHGIDVAKTEEKLRTYEELNKQLIMNNLERSRTEIESFEQRQKFEKEMKLKKRLLERQIEEEERMNKEWTKKEIVN-----RLSTTTQDINETIEGVKNTVKLKKSS 222          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Nematostella
Match: EDO44111 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWZ3])

HSP 1 Score: 103.605 bits (257), Expect = 3.328e-25
Identity = 77/255 (30.20%), Postives = 123/255 (48.24%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDF----DTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSS-----RKAEIKLRRNRKDKDLEVFEQWEKKEEIIHNQANDEMNQEKIKKENIDECFKRKLITSDEPLNEVVMELEYTLAREQE---SRVLQARGDVKMKSEPLKRYQYCVPLYMHRPEFKYNTARD 776
            Q CP+C+ +      LK  V+ CGH +C  C +++F R   +CP+C+T L ++ FR + FE+  VE  +   + V + YN  + DF    D L  YNDYLE+VE ++ +L +    EE +  M  Y        RK+ IKL R  +   +   E+ +++ E+   Q      +E  KK    E F   LI  ++PL+E+V E      ++Q    S   Q   +V+ + E +       PLY + P  + N   D
Sbjct:    4 QSCPRCKTTKYRNPKLKLMVNVCGHKLCDNCVDVLFTRPSAACPECNTPLRRSDFRLQQFEDLLVEKEVDIRKTVLKYYNKHEEDFAGEPDPLRSYNDYLEDVEDIVWNLTNGIDVEETKKAMEKYKKENATQIRKSNIKLGR-EEAIIMSQIEEEQREHEMRKKQEAMMTKEETKKKRQEKEAFLDNLIAGNKPLDEIVAEHACKNPKKQSLLFSASNQFTANVQTREEFIPLPLMTTPLYTYTPLKENNEGPD 257          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Medaka
Match: mnat1 (MNAT1 component of CDK activating kinase [Source:NCBI gene;Acc:101174874])

HSP 1 Score: 100.523 bits (249), Expect = 1.457e-23
Identity = 47/131 (35.88%), Postives = 78/131 (59.54%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIK 440
            Q CP+C+ +      LK  V+ CGH++C  C E++F+R   +C +C+T L KN+FR ++FE+  V+  +   + V + YN  + DF +L EYNDYLE+VE ++++L +    E  + +M  Y    K  I+
Sbjct:    4 QGCPRCKTTKYRNPSLKLMVNVCGHTLCENCVEMLFVRGAGNCVQCNTPLRKNNFRVQLFEDPTVDKEVEIRKKVMKIYNKRECDFQSLREYNDYLEQVEDIVYNLTNNVEVESTKLRMEQYQRENKDVIQ 134          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Medaka
Match: mnat1 (MNAT1 component of CDK activating kinase [Source:NCBI gene;Acc:101174874])

HSP 1 Score: 99.3673 bits (246), Expect = 2.324e-23
Identity = 47/131 (35.88%), Postives = 78/131 (59.54%), Query Frame = 3
Query:   48 QICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIK 440
            Q CP+C+ +      LK  V+ CGH++C  C E++F+R   +C +C+T L KN+FR ++FE+  V+  +   + V + YN  + DF +L EYNDYLE+VE ++++L +    E  + +M  Y    K  I+
Sbjct:    4 QGCPRCKTTKYRNPSLKLMVNVCGHTLCENCVEMLFVRGAGNCVQCNTPLRKNNFRVQLFEDPTVDKEVEIRKKVMKIYNKRECDFQSLREYNDYLEQVEDIVYNLTNNVEVESTKLRMEQYQRENKDVIQ 134          
BLAST of CDK-activating kinase assembly factor MAT1 vs. Planmine SMEST
Match: SMESG000068209.1 (SMESG000068209.1)

HSP 1 Score: 590.497 bits (1521), Expect = 0.000e+0
Identity = 285/285 (100.00%), Postives = 285/285 (100.00%), Query Frame = 3
Query:   33 MEDVIQICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIKLRRNRKDKDLEVFEQWEKKEEIIHNQANDEMNQEKIKKENIDECFKRKLITSDEPLNEVVMELEYTLAREQESRVLQARGDVKMKSEPLKRYQYCVPLYMHRPEFKYNTARDLKSEILLTTLKKPAEGLIRGGGYTPAFWLFRLKHFCE 887
            MEDVIQICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIKLRRNRKDKDLEVFEQWEKKEEIIHNQANDEMNQEKIKKENIDECFKRKLITSDEPLNEVVMELEYTLAREQESRVLQARGDVKMKSEPLKRYQYCVPLYMHRPEFKYNTARDLKSEILLTTLKKPAEGLIRGGGYTPAFWLFRLKHFCE
Sbjct:    1 MEDVIQICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPKCSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDYLEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIKLRRNRKDKDLEVFEQWEKKEEIIHNQANDEMNQEKIKKENIDECFKRKLITSDEPLNEVVMELEYTLAREQESRVLQARGDVKMKSEPLKRYQYCVPLYMHRPEFKYNTARDLKSEILLTTLKKPAEGLIRGGGYTPAFWLFRLKHFCE 285          
The following BLAST results are available for this feature:
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MNAT15.645e-2335.88MNAT1 component of CDK activating kinase [Source:H... [more]
MNAT11.032e-2235.88MNAT1 component of CDK activating kinase [Source:H... [more]
back to top
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mnat-16.017e-1726.19MNAT (Menage a trois) TFIIH subunit [Source:UniPr... [more]
back to top
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mat12.577e-2430.30gene:FBgn0024956 transcript:FBtr0088255[more]
back to top
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mnat11.724e-2134.35MNAT1 component of CDK activating kinase [Source:Z... [more]
back to top
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
bag13.838e-2133.59BCL2 associated athanogene 1 [Source:Xenbase;Acc:X... [more]
bag14.011e-2133.59BCL2 associated athanogene 1 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Mnat15.791e-2436.64menage a trois 1 [Source:MGI Symbol;Acc:MGI:106207... [more]
Mnat11.789e-2328.19menage a trois 1 [Source:MGI Symbol;Acc:MGI:106207... [more]
Mnat11.051e-1239.39menage a trois 1 [Source:MGI Symbol;Acc:MGI:106207... [more]
back to top
BLAST of CDK-activating kinase assembly factor MAT1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51950|MAT1_MARGL1.168e-2532.82CDK-activating kinase assembly factor MAT1 OS=Mart... [more]
sp|P51949|MAT1_MOUSE1.252e-2228.19CDK-activating kinase assembly factor MAT1 OS=Mus ... [more]
sp|P51948|MAT1_HUMAN4.955e-2235.88CDK-activating kinase assembly factor MAT1 OS=Homo... [more]
sp|P51951|MAT1_XENLA4.694e-2033.59CDK-activating kinase assembly factor MAT1 OS=Xeno... [more]
sp|Q6FMP4|TFB3_CANGA2.436e-1430.92RNA polymerase II transcription factor B subunit 3... [more]
back to top
BLAST of CDK-activating kinase assembly factor MAT1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1Q0341.176e-2634.29CDK-activating kinase assembly factor MAT1 OS=Cras... [more]
R7THV16.706e-2629.37CDK-activating kinase assembly factor MAT1 OS=Capi... [more]
A0A0L8GZA11.040e-2533.51RING-type domain-containing protein OS=Octopus bim... [more]
A0A336L0K76.330e-2529.34CDK-activating kinase assembly factor MAT1 OS=Culi... [more]
T1JFU76.613e-2532.50RING-type domain-containing protein OS=Strigamia m... [more]
back to top
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mnat12.102e-2034.43MNAT1 component of CDK activating kinase [Source:Z... [more]
back to top
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
TFB33.645e-1530.56Subunit of TFIIH and nucleotide excision repair fa... [more]
back to top
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO441113.328e-2530.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CDK-activating kinase assembly factor MAT1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mnat11.457e-2335.88MNAT1 component of CDK activating kinase [Source:N... [more]
mnat12.324e-2335.88MNAT1 component of CDK activating kinase [Source:N... [more]
back to top
BLAST of CDK-activating kinase assembly factor MAT1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000068209.10.000e+0100.00SMESG000068209.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014291 ID=SMED30014291|Name=CDK-activating kinase assembly factor MAT1|organism=Schmidtea mediterranea sexual|type=transcript|length=1163bp
ATTACCGACGGCGCAAAATTATTTAGACTTAAATGGAAGATGTTATTCAA
ATTTGTCCAAAGTGTCAAGGTTCAAATGCTTCTTTCAAAGATTTAAAATT
TAAAGTTAGCTATTGTGGTCATTCAATATGTATAAAATGTTATGAATTAA
TGTTTATACGGAATGAAGATAGTTGTCCAAAATGTAGTACGAAATTACCA
AAAAACAGCTTTAGGACAAGAATGTTTGAAAATGATGATGTTGAATCGTA
TATGTGTTATTATCAAGATGTCAAAAGAAAATATAATTGCGACCAGTCTG
ATTTCGATACTCTCGAAGAATACAATGATTATTTGGAAGAAGTAGAAACC
TTGATTCATGATTTAATGGATCCAAATACTTGTGAAGAGGCTAGAACAAA
AATGCGTGATTATTATTCATCTCGTAAAGCTGAAATTAAACTAAGGAGAA
ATAGAAAAGATAAGGATCTGGAGGTTTTTGAGCAGTGGGAGAAAAAAGAA
GAAATCATTCATAATCAGGCCAATGACGAAATGAATCAGGAAAAAATCAA
AAAAGAAAATATCGATGAATGTTTTAAGCGCAAACTGATTACGTCTGATG
AGCCTTTGAATGAAGTTGTAATGGAGTTGGAATACACTTTAGCCCGTGAA
CAAGAAAGCAGAGTACTTCAAGCGCGTGGTGATGTCAAGATGAAATCGGA
ACCTTTGAAACGATACCAATATTGCGTTCCGTTGTATATGCATCGGCCGG
AATTCAAGTACAATACTGCGAGAGATTTGAAATCAGAAATTTTACTCACT
ACTCTCAAGAAGCCGGCGGAAGGCTTGATTCGCGGAGGAGGTTATACACC
CGCGTTCTGGTTGTTTCGCCTGAAGCATTTTTGTGAATAAATTCTGTTTC
AATTTTATTAGTTAATTTTTTTCATATTCAATCCTCTAGACGATTTATTA
TTATTTTATTTTCTACAAAATCTGATTCATAGTCGAATTTTGTAGAAAAT
ATTATGTCATTTATAAAGAAATCAGAGGTGAAAAGCAAAAAAGTCCTTAT
AATATATTATTTTGTTTTAATTATATTTTTTATATGTTATTTTGTTTTAT
TTGGTGTTTTTATTTTTTATTTTTAATATCTGTCTATGGAGCTTGTGTAT
GTTTACGGTAGCC
back to top

protein sequence of SMED30014291-orf-1

>SMED30014291-orf-1 ID=SMED30014291-orf-1|Name=SMED30014291-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=286bp
MEDVIQICPKCQGSNASFKDLKFKVSYCGHSICIKCYELMFIRNEDSCPK
CSTKLPKNSFRTRMFENDDVESYMCYYQDVKRKYNCDQSDFDTLEEYNDY
LEEVETLIHDLMDPNTCEEARTKMRDYYSSRKAEIKLRRNRKDKDLEVFE
QWEKKEEIIHNQANDEMNQEKIKKENIDECFKRKLITSDEPLNEVVMELE
YTLAREQESRVLQARGDVKMKSEPLKRYQYCVPLYMHRPEFKYNTARDLK
SEILLTTLKKPAEGLIRGGGYTPAFWLFRLKHFCE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005675holo TFIIH complex
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006289nucleotide-excision repair
GO:0007049cell cycle
GO:0016310phosphorylation
GO:0045737positive regulation of cyclin-dependent protein serine/threonine kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR004575MAT1/Tfb3
IPR013083Znf_RING/FYVE/PHD
IPR015877Cdk-activating_kinase_MAT1_cen
IPR017907Znf_RING_CS
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0016301kinase activity
GO:0061575cyclin-dependent protein serine/threonine kinase activator activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015877Cdk-activating kinase assembly factor MAT1, centrePFAMPF06391MAT1coord: 56..211
e-value: 4.8E-22
score: 78.8
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 5..67
e-value: 1.5E-12
score: 48.9
IPR004575Cdk-activating kinase assembly factor MAT1/Tfb3PANTHERPTHR12683:SF13CDK-ACTIVATING KINASE ASSEMBLY FACTOR MAT1coord: 1..276
NoneNo IPR availablePANTHERPTHR12683FAMILY NOT NAMEDcoord: 1..276
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 6..63
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 28..37
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 8..52
score: 9.288