Multidrug resistance-associated protein 1

Overview
NameMultidrug resistance-associated protein 1
Smed IDSMED30014286
Length (bp)4099
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Multidrug resistance-associated protein 1 (SMED30014286) t-SNE clustered cells

Violin plots show distribution of expression levels for Multidrug resistance-associated protein 1 (SMED30014286) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014286

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30014286SMESG000074229.1 SMESG000074226.1 SmedASXL_018329SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30014286SMESG000074229.1 SMESG000074226.1 SmedASXL_018328SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
parenchymal cellSMED30014286SMESG000074229.1 SMESG000074226.1 dd_Smed_v4_13596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30014286SMESG000074229.1 SMESG000074226.1 dd_Smed_v4_13596_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30014286SMESG000074229.1 SMESG000074226.1 Contig10898newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014286SMESG000074229.1 SMESG000074226.1 Contig10898uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Category 2 cellSMED30014286SMESG000074229.1 SMESG000074226.1 dd_Smed_v4_13596_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 505/1339 (37.71%), Postives = 778/1339 (58.10%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSEN--------SEKCLKYLKENLR---------SPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGA-PIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLN---ESSDKVDKNQNNLIQPSAPNKRKR------------------------------SRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVW-YFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES---INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE+ +S LS+IT+ W+   I + +++ ++    + LN  +TS +          ++C K  K+ ++          P   S++   E+ + LI K    +E+  S   + K L + + P     +  K   D+++ + P +LKLL+ ++ +      W+G    +L F      +L  +  F I     +R++ A+ G +Y+K L ++  AR   + G+IVN+ SVD ++ M+  TY  +  S P Q+ILA+ LL+L LG S+ AGV  +  ++P+N ++   ++ +    +  KD R+ ++ EI +G+K++K+YAWE  F  K+  IR +E+K ++  +    + +  W   PF V   TF  ++    N+++  +  FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E E DS    P K   G   I ++N +F+W     PTLN I  ++    L+AVVG+VG GKSSLLSA+L EM  + G V  +G +AYVPQ+AWIQN++LR NIL      + +Y  V+ AC L  D+E LP+ D+TEIGE+GVNLSGGQKQRVSLARAVY ++DIYL DDPLSAVD +VG+ +F  +I  +G+LK+KTR+LVTH + +LP VD I V++  G+ISE G+Y+ L+     F  FL     +  + D  +N +   S P K  +                              SR   S ++        EE ++     +   ++  +G+V L S+ W Y KA G+F+   SI   +   V     N WL +  D      +   N ++   K  ++ YG +G+ Q +AV  +      GG+ AS+ +H  LL ++LRS + FF  TPSG ++NRF+K+L  +D  +   I   +     +I + +VI + TP   I+  P+ + Y  +Q FY++SSRQ +RL+S + S V +H  ET  G S+IR+ E +  F       +D++ K      ++ RWL +RL+ +GN IV  + +FAV++R SLSA LVGLS+SY+LQVT  LNWL R  +E ETN V++ER+++Y+    E+   I ET      +W   G +   N+ L+Y  +L  VL++I + INGGEK+G+VGRTGAGKSSL L LFR+ E   G I IDG+NI  IGLH LR ++TI+PQDPV+FSG+L+ NLDPF +Y+D+++  SLE++ + D+V++L + ++++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF   TV+ IAHRL TI+D  ++I LD G I E+G+P +LL    G F ++A+
Sbjct:  209 PESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSP-QKEWNPS---LFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAP-DWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSG-GKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWK-----LMEADKAQTGQVKL-SVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTD------DPIVNGTQEHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAP--PSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLL-QQRGLFYSMAK 1526          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 505/1339 (37.71%), Postives = 778/1339 (58.10%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSEN--------SEKCLKYLKENLR---------SPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGA-PIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLN---ESSDKVDKNQNNLIQPSAPNKRKR------------------------------SRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVW-YFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES---INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE+ +S LS+IT+ W+   I + +++ ++    + LN  +TS +          ++C K  K+ ++          P   S++   E+ + LI K    +E+  S   + K L + + P     +  K   D+++ + P +LKLL+ ++ +      W+G    +L F      +L  +  F I     +R++ A+ G +Y+K L ++  AR   + G+IVN+ SVD ++ M+  TY  +  S P Q+ILA+ LL+L LG S+ AGV  +  ++P+N ++   ++ +    +  KD R+ ++ EI +G+K++K+YAWE  F  K+  IR +E+K ++  +    + +  W   PF V   TF  ++    N+++  +  FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E E DS    P K   G   I ++N +F+W     PTLN I  ++    L+AVVG+VG GKSSLLSA+L EM  + G V  +G +AYVPQ+AWIQN++LR NIL      + +Y  V+ AC L  D+E LP+ D+TEIGE+GVNLSGGQKQRVSLARAVY ++DIYL DDPLSAVD +VG+ +F  +I  +G+LK+KTR+LVTH + +LP VD I V++  G+ISE G+Y+ L+     F  FL     +  + D  +N +   S P K  +                              SR   S ++        EE ++     +   ++  +G+V L S+ W Y KA G+F+   SI   +   V     N WL +  D      +   N ++   K  ++ YG +G+ Q +AV  +      GG+ AS+ +H  LL ++LRS + FF  TPSG ++NRF+K+L  +D  +   I   +     +I + +VI + TP   I+  P+ + Y  +Q FY++SSRQ +RL+S + S V +H  ET  G S+IR+ E +  F       +D++ K      ++ RWL +RL+ +GN IV  + +FAV++R SLSA LVGLS+SY+LQVT  LNWL R  +E ETN V++ER+++Y+    E+   I ET      +W   G +   N+ L+Y  +L  VL++I + INGGEK+G+VGRTGAGKSSL L LFR+ E   G I IDG+NI  IGLH LR ++TI+PQDPV+FSG+L+ NLDPF +Y+D+++  SLE++ + D+V++L + ++++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF   TV+ IAHRL TI+D  ++I LD G I E+G+P +LL    G F ++A+
Sbjct:  209 PESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSP-QKEWNPS---LFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAP-DWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSG-GKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWK-----LMEADKAQTGQVKL-SVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTD------DPIVNGTQEHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAP--PSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLL-QQRGLFYSMAK 1526          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 817.765 bits (2111), Expect = 0.000e+0
Identity = 505/1349 (37.44%), Postives = 778/1349 (57.67%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSEN--------SEKCLKYLKENLR---------SPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGA-PIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL-------------NESSDKVDKNQNNLIQPSAPNKRKR------------------------------SRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVW-YFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES---INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE+ +S LS+IT+ W+   I + +++ ++    + LN  +TS +          ++C K  K+ ++          P   S++   E+ + LI K    +E+  S   + K L + + P     +  K   D+++ + P +LKLL+ ++ +      W+G    +L F      +L  +  F I     +R++ A+ G +Y+K L ++  AR   + G+IVN+ SVD ++ M+  TY  +  S P Q+ILA+ LL+L LG S+ AGV  +  ++P+N ++   ++ +    +  KD R+ ++ EI +G+K++K+YAWE  F  K+  IR +E+K ++  +    + +  W   PF V   TF  ++    N+++  +  FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E E DS    P K   G   I ++N +F+W     PTLN I  ++    L+AVVG+VG GKSSLLSA+L EM  + G V  +G +AYVPQ+AWIQN++LR NIL      + +Y  V+ AC L  D+E LP+ D+TEIGE+GVNLSGGQKQRVSLARAVY ++DIYL DDPLSAVD +VG+ +F  +I  +G+LK+KTR+LVTH + +LP VD I V++  G+ISE G+Y+ L+     F  FL                S  +D+ +  +   S P K  +                              SR   S ++        EE ++     +   ++  +G+V L S+ W Y KA G+F+   SI   +   V     N WL +  D      +   N ++   K  ++ YG +G+ Q +AV  +      GG+ AS+ +H  LL ++LRS + FF  TPSG ++NRF+K+L  +D  +   I   +     +I + +VI + TP   I+  P+ + Y  +Q FY++SSRQ +RL+S + S V +H  ET  G S+IR+ E +  F       +D++ K      ++ RWL +RL+ +GN IV  + +FAV++R SLSA LVGLS+SY+LQVT  LNWL R  +E ETN V++ER+++Y+    E+   I ET      +W   G +   N+ L+Y  +L  VL++I + INGGEK+G+VGRTGAGKSSL L LFR+ E   G I IDG+NI  IGLH LR ++TI+PQDPV+FSG+L+ NLDPF +Y+D+++  SLE++ + D+V++L + ++++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF   TV+ IAHRL TI+D  ++I LD G I E+G+P +LL    G F ++A+
Sbjct:  108 PESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSP-QKEWNPS---LFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAP-DWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSG-GKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGSTVMDEEEAGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWK-----LMEADKAQTGQVKL-SVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTD------DPIVNGTQEHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAP--PSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLL-QQRGLFYSMAK 1435          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 817.765 bits (2111), Expect = 0.000e+0
Identity = 505/1349 (37.44%), Postives = 778/1349 (57.67%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSEN--------SEKCLKYLKENLR---------SPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGA-PIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL-------------NESSDKVDKNQNNLIQPSAPNKRKR------------------------------SRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVW-YFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES---INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE+ +S LS+IT+ W+   I + +++ ++    + LN  +TS +          ++C K  K+ ++          P   S++   E+ + LI K    +E+  S   + K L + + P     +  K   D+++ + P +LKLL+ ++ +      W+G    +L F      +L  +  F I     +R++ A+ G +Y+K L ++  AR   + G+IVN+ SVD ++ M+  TY  +  S P Q+ILA+ LL+L LG S+ AGV  +  ++P+N ++   ++ +    +  KD R+ ++ EI +G+K++K+YAWE  F  K+  IR +E+K ++  +    + +  W   PF V   TF  ++    N+++  +  FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E E DS    P K   G   I ++N +F+W     PTLN I  ++    L+AVVG+VG GKSSLLSA+L EM  + G V  +G +AYVPQ+AWIQN++LR NIL      + +Y  V+ AC L  D+E LP+ D+TEIGE+GVNLSGGQKQRVSLARAVY ++DIYL DDPLSAVD +VG+ +F  +I  +G+LK+KTR+LVTH + +LP VD I V++  G+ISE G+Y+ L+     F  FL                S  +D+ +  +   S P K  +                              SR   S ++        EE ++     +   ++  +G+V L S+ W Y KA G+F+   SI   +   V     N WL +  D      +   N ++   K  ++ YG +G+ Q +AV  +      GG+ AS+ +H  LL ++LRS + FF  TPSG ++NRF+K+L  +D  +   I   +     +I + +VI + TP   I+  P+ + Y  +Q FY++SSRQ +RL+S + S V +H  ET  G S+IR+ E +  F       +D++ K      ++ RWL +RL+ +GN IV  + +FAV++R SLSA LVGLS+SY+LQVT  LNWL R  +E ETN V++ER+++Y+    E+   I ET      +W   G +   N+ L+Y  +L  VL++I + INGGEK+G+VGRTGAGKSSL L LFR+ E   G I IDG+NI  IGLH LR ++TI+PQDPV+FSG+L+ NLDPF +Y+D+++  SLE++ + D+V++L + ++++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF   TV+ IAHRL TI+D  ++I LD G I E+G+P +LL    G F ++A+
Sbjct:  108 PESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSP-QKEWNPS---LFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAP-DWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSG-GKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGSTVMDEEEAGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWK-----LMEADKAQTGQVKL-SVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTD------DPIVNGTQEHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAP--PSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLL-QQRGLFYSMAK 1435          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Match: ABCC3 (ATP binding cassette subfamily C member 3 [Source:HGNC Symbol;Acc:HGNC:54])

HSP 1 Score: 813.142 bits (2099), Expect = 0.000e+0
Identity = 478/1193 (40.07%), Postives = 722/1193 (60.52%), Query Frame = 2
Query:  452 TWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL-NESSDK--------------VDKNQNNLIQPSAPNK------------------RKRSRLSTSG-SQG-------FDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVW-YFKATGIFVFGSSILACVIFGVLQ---AFG-NVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES--INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            +W G L+A L F   +  SL   + +       V+ R  + G+IY+K L ++   +   + G+IVN+ SVD ++ M+   +  +  S P QIILAI  L+  LG S+ AGV  +  +IPLN  +    R F  +++  KD R+ +++EI +G+K++K+YAWE  F K++E IR  E++ +R  +      +  W   PF V  IT   ++Y  PN+++  EK FVS+ LFN L+LP+ +LP  +S    A VS  RI+ FL  S++E D  +   + +SPG  I I +G+F+W +D  PTL+++++ V    L+AVVG VG GKSSL+SA+LGEM  L G V  +G +AYVPQ+AWIQN TL+ N+L  K+ N   Y + L+AC L  D+E LP  DQTEIGE+G+NLSGGQ+QRVSLARAVY D+DI+LLDDPLSAVD +V + +F+ +I  +G+L  KTRVLVTHG+ +LP  D I V+ D GQ+SE G Y  L+     F +FL N + D+               +  +  LI+ +  N                   R+ S LS+ G  QG          +E  +    K    ++ EE+   G V L S+ W Y KA G+     + LA  +  V Q   A G NVWL       +  N++  +  +N+    +  Y  +G+ Q   V+L       GG++A++ +H  LL   +RS   FF+ TPSGRILN F+KD++++D  L   I  ++N     I++LVVI   TP F +V +P+ + Y L+Q FY ++SRQ +RL+S + S + +H  ET +G+S+IR+     DFE I    +D + +      +S RWL + ++ +GN +V  + +FAV+ R SL+  LVGLS+SY+LQVT  LNW+ R  ++ E+N V++ER+++Y+    E+  + E +    E W   G +   N+S++Y   L  VL++++++++GGEK+G+VGRTGAGKSS+ L LFR++E   G I IDG+N+  IGLH LR QLTI+PQDP++FSGTL+ NLDPF  Y+++ +  +LE+S +  +V+S   G+++ C   G NLS+GQ+QL+CLAR LL+KS+I++LDEATA++D ETD  +   I+ QF + TV+ IAHRL TI+D  +++ LD G + EF SP  L++ + G F  +A+
Sbjct:  346 SWWGFLVAGLMFLCSMMQSLILQHYYHYIFVTGVKFRTGIMGVIYRKALVITNSVKRASTVGEIVNLMSVDAQRFMDLAPFLNLLWSAPLQIILAIYFLWQNLGPSVLAGVAFMVLLIPLNGAVAVKMRAFQVKQMKLKDSRIKLMSEILNGIKVLKLYAWEPSFLKQVEGIRQGELQLLRTAAYLHTTTTFTWMCSPFLVTLITLWVYVYVDPNNVLDAEKAFVSVSLFNILRLPLNMLPQLISNLTQASVSLKRIQQFL--SQEELDPQSVERKTISPGYAITIHSGTFTWAQDLPPTLHSLDIQVPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGKVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADLEMLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDADIFLLDDPLSAVDSHVAKHIFDHVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLAD-GQVSEMGPYPALLQRNGSFANFLCNYAPDEDQGHLEDSWTALEGAEDKEALLIEDTLSNHTDLTDNDPVTYVVQKQFMRQLSALSSDGEGQGRPVPRRHLGPSEKVQVTEAKADGALTQEEKAAIGTVEL-SVFWDYAKAVGL----CTTLAICLLYVGQSAAAIGANVWL------SAWTNDAMADSRQNNTSLRLGVYAALGILQGFLVMLAAMAMAAGGIQAARVLHQALLHNKIRSPQSFFDTTPSGRILNCFSKDIYVVDEVLAPVILMLLNSFFNAISTLVVIMASTPLFTVVILPLAVLYTLVQRFYAATSRQLKRLESVSRSPIYSHFSETVTGASVIRAYNRSRDFEIISDTKVDANQRSCYPYIISNRWLSIGVEFVGNCVVLFAALFAVIGRSSLNPGLVGLSVSYSLQVTFALNWMIRMMSDLESNIVAVERVKEYSKTETEAPWVVEGSR-PPEGWPPRGEVEFRNYSVRYRPGLDLVLRDLSLHVHGGEKVGIVGRTGAGKSSMTLCLFRILEAAKGEIRIDGLNVADIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGSYSEEDIWWALELSHLHTFVSSQPAGLDFQCSEGGENLSVGQRQLVCLARALLRKSRILVLDEATAAIDLETDNLIQATIRTQFDTCTVLTIAHRLNTIMDYTRVLVLDKGVVAEFDSPANLIA-ARGIFYGMAR 1522          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 798.505 bits (2061), Expect = 0.000e+0
Identity = 501/1343 (37.30%), Postives = 773/1343 (57.56%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVP-NSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSW--TEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQ-GLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMD-------------------------FGTEFK---------------------SFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQ-------GFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFS--LSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE  +S L+Q+T+ W     Y   K+ ++ E  +DLN  + +            EN+    IE+ I ++E  +  I KKN       +   ++  + + Y   +  G   K+  D+L    P +L+ L++++++K+    W G+ +ALL F   L  S+  +  F    ++ + +R+ L   +Y KTL LS EAR   + G IVN+ SVD++++ +  T+  +F S P QI+L++  L+  LG S+ AG   +  +IP N  I    R     ++ FKD+R+ +++EI +GMK++K+Y+WEK   K + E+R  EI+ ++ +S      ++ W   PF V  +TF  ++ + P N+++TP+  FV+L LFN L+ P+ +     SQA+    S  R++ F  A E    ++ +        + I++  GSF+W   E+ R  L++I  N++  +L+A+VGRVG GKSSLL A+LGEM  L+G+VQ  G +AYVPQ AWIQN +LRNNIL  + ++   Y  V++ C L  D+ESLP  D+TEIGE+G+NLSGGQKQRVSLARAVYQ+++I LLDDPLSAVD +VG+ +F  +IS   G L  KTRVL+THGL +L   D++ V+ D+  ISE GTY+ LM+                         FG + K                     S +++  +K D     +I+       + +  S   S+            E   E  ++    +  +E + +G+V     + YF+A GI +     L  V   +L  F N++L   +D    +  S  N S +  +  +  Y ++G+GQ  +V         G + AS+ +H+ LL+ ++RS + FF+ TP GRILNRF KD+  ID TL  +I  ++     +I+++ VI   TPW GI  + +   Y ++  FY+S+SRQ +RL+S + S + +H  E+  G+S IR+      F       +D++        ++ RWL +RL+++GNLIV  S   AV  R S  LSA LVGLS+SYAL +T  LNW  R  +E ETN V++ERI +YT+ P E  N + +   ++W  NG I+++NFS++Y   L  VL  +T +I+  EKIG+VGRTGAGKSSL LALFR++E   G I IDG NI  + L QLR +LTI+PQDPV+FSGT++ NLDPF  ++DD++ ++L  + +  +V SL EG+++     G NLS+GQ+QLICLAR LL+K+K+++LDEA A+VD ETD  + + I+ QF   TV+ IAHRL T++D D+++ LD G + EF +PK+LLSN  G F ++A+
Sbjct:  208 PEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKA------------ENIIPSFIENLIPEVEGYRRKI-KKNPEAAIPKNHPSILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIEDKNQP-MWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQTSIAYG---GTDSAIKMDGGSFAWGSKEEDR-KLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDE-TISEMGTYQELMNSNGAFSEFLEEFLLEESKHKGRSVSFGEDSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLHKDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTKTQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDDAKEIALSG-NGSSSETQIRLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDIEAIDQTLPHSIRAMVMTIFNVISTVFVIIWATPWAGIGFLVLGFVYFVVLRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEG-NNSQSLAPKSWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIFYSMAK 1529          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5e.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 504/1345 (37.47%), Postives = 774/1345 (57.55%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVP-NSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSW--TEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQ-GLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMD-------------------------FGTEFK---------------------SFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQ-------GFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPW--FGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFS--LSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE  +S L+Q+T+ W     Y   K+ ++ E  +DLN  + +            EN+    IE+ I ++E  +  I KKN       +   ++  + + Y   +  G   K+  D+L    P +L+ L++++++K+    W G+ +ALL F   L  S+  +  F    ++ + +R+ L   +Y KTL LS EAR   + G IVN+ SVD++++ +  T+  +F S P QI+L++  L+  LG S+ AG   +  +IP N  I    R     ++ FKD+R+ +++EI +GMK++K+Y+WEK   K + E+R  EI+ ++ +S      ++ W   PF V  +TF  ++ + P N+++TP+  FV+L LFN L+ P+ +     SQA+    S  R++ F  A E    ++ +        + I++  GSF+W   E+ R  L++I  N++  +L+A+VGRVG GKSSLL A+LGEM  L+G+VQ  G +AYVPQ AWIQN +LRNNIL  + ++   Y  V++ C L  D+ESLP  D+TEIGE+G+NLSGGQKQRVSLARAVYQ+++I LLDDPLSAVD +VG+ +F  +IS   G L  KTRVL+THGL +L   D++ V+ D+  ISE GTY+ LM+                         FG + K                     S +++  +K D     +I+       + +  S   S+            E   E  ++    +  +E + +G+V     + YF+A GI +     L  V   +L  F N++L   +D    +  S  N S +  +  +  Y ++G+GQ  +V         G + AS+ +H+ LL+ ++RS + FF+ TP GRILNRF KD+ ++D  L  NI D +     L+  +V  S  TP+  F IV I I  C+ +L+ FY+S+SRQ +RL+S + S + +H  E+  G+S IR+      F       +D++        ++ RWL +RL+++GNLIV  S   AV  R S  LSA LVGLS+SYAL +T  LNW  R  +E ETN V++ERI +YT+ P E  N + +   ++W  NG I+++NFS++Y   L  VL  +T +I+  EKIG+VGRTGAGKSSL LALFR++E   G I IDG NI  + L QLR +LTI+PQDPV+FSGT++ NLDPF  ++DD++ ++L  + +  +V SL EG+++     G NLS+GQ+QLICLAR LL+K+K+++LDEA A+VD ETD  + + I+ QF   TV+ IAHRL T++D D+++ LD G + EF +PK+LLSN  G F ++A+
Sbjct:  208 PEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKA------------ENIIPSFIENLIPEVEGYRRKI-KKNPEAAIPKNHPSILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIEDKNQP-MWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQTSIAYG---GTDSAIKMDGGSFAWGSKEEDR-KLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDE-TISEMGTYQELMNSNGAFSEFLEEFLLEESKHKGRSVSFGEDSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLHKDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTKTQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDDAKEIALSG-NGSSSETQIRLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDMDVVDERLPDNIGDFLLTFSELVACVVFTSYATPFAIFPIVLIAI-GCFAILR-FYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEG-NNSQSLAPKSWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIFYSMAK 1529          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 500/1343 (37.23%), Postives = 766/1343 (57.04%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVP-NSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSW--TEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQ-GLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMD-------------------------FGTEFK---------------------SFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQ-------GFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFS--LSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE  +S L+Q+T+ W     Y   K+ ++ E  +DLN  + +            EN+    IE+ I ++E  +  I KKN       +   ++  + + Y   +  G   K+  D+L    P +L+ L++++++K+    W G+ +ALL F   L  S+  +  F    ++ + +R+ L   +Y KTL LS EAR   + G IVN+ SVD++++ +  T+  +F S P QI+L++  L+  LG S+ AG   +  +IP N  I    R     ++ FKD+R+ +++EI +GMK++K+Y+WEK   K + E+R  EI+ ++ +S      ++ W   PF V  +TF  ++ + P N+++TP+  FV+L LFN L+ P+ +     SQA+    S  R++ F  A E    ++ +        + I++  GSF+W   E+ R  L++I  N++  +L+A+VGRVG GKSSLL A+LGEM  L+G+VQ  G +AYVPQ AWIQN +LRNNIL  + ++   Y  V++ C L  D+ESLP  D+TEIGE+G+NLSGGQKQRVSLARAVYQ+++I LLDDPLSAVD +VG+ +F  +IS   G L  KTRVL+THGL +L   D++ V+ D+  ISE GTY+ LM+                         FG + K                     S +++  +K D     +I+       + +  S   S+            E   E  ++    +  +E + +G+V     + YF+A GI +     L  V   +L  F N++L   +D    +  S  N S +  +  +  Y ++G+GQ  +V         G + AS+ +H+ LL+ ++RS + FF+ TP GRILNRF KD+ +ID+ L   I   +   V  +T   V    TP        +LI Y  L  FY+S+SRQ +RL+S + S + +H  E+  G+S IR+      F       +D++        ++ RWL +RL+++GNLIV  S   AV  R S  LSA LVGLS+SYAL +T  LNW  R  +E ETN V++ERI +YT+ P E  N + +   ++W  NG I+++NFS++Y   L  VL  +T +I+  EKIG+VGRTGAGKSSL LALFR++E   G I IDG NI  + L QLR +LTI+PQDPV+FSGT++ NLDPF  ++DD++ ++L  + +  +V SL EG+++     G NLS+GQ+QLICLAR LL+K+K+++LDEA A+VD ETD  + + I+ QF   TV+ IAHRL T++D D+++ LD G + EF +PK+LLSN  G F ++A+
Sbjct:  208 PEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKA------------ENIIPSFIENLIPEVEGYRRKI-KKNPEAAIPKNHPSILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIEDKNQP-MWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQTSIAYG---GTDSAIKMDGGSFAWGSKEEDR-KLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDE-TISEMGTYQELMNSNGAFSEFLEEFLLEESKHKGRSVSFGEDSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLHKDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTKTQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDDAKEIALSG-NGSSSETQIRLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDIDVIDYRLPSCIMTFVGAIVQAVTIFAVPIYATPLSSFPITIVLIGYYFLLRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEG-NNSQSLAPKSWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIFYSMAK 1529          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-1 (pep chromosome:WBcel235:X:576318:587483:-1 gene:WBGene00003407.1 transcript:F57C12.5d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-1)

HSP 1 Score: 788.489 bits (2035), Expect = 0.000e+0
Identity = 497/1343 (37.01%), Postives = 769/1343 (57.26%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVP-NSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSW--TEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQ-GLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMD-------------------------FGTEFK---------------------SFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQ-------GFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFS--LSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE  +S L+Q+T+ W     Y   K+ ++ E  +DLN  + +            EN+    IE+ I ++E  +  I KKN       +   ++  + + Y   +  G   K+  D+L    P +L+ L++++++K+    W G+ +ALL F   L  S+  +  F    ++ + +R+ L   +Y KTL LS EAR   + G IVN+ SVD++++ +  T+  +F S P QI+L++  L+  LG S+ AG   +  +IP N  I    R     ++ FKD+R+ +++EI +GMK++K+Y+WEK   K + E+R  EI+ ++ +S      ++ W   PF V  +TF  ++ + P N+++TP+  FV+L LFN L+ P+ +     SQA+    S  R++ F  A E    ++ +        + I++  GSF+W   E+ R  L++I  N++  +L+A+VGRVG GKSSLL A+LGEM  L+G+VQ  G +AYVPQ AWIQN +LRNNIL  + ++   Y  V++ C L  D+ESLP  D+TEIGE+G+NLSGGQKQRVSLARAVYQ+++I LLDDPLSAVD +VG+ +F  +IS   G L  KTRVL+THGL +L   D++ V+ D+  ISE GTY+ LM+                         FG + K                     S +++  +K D     +I+       + +  S   S+            E   E  ++    +  +E + +G+V     + YF+A GI +     L  V   +L  F N++L   +D    +  S  N S +  +  +  Y ++G+GQ  +V         G + AS+ +H+ LL+ ++RS + FF+ TP GRILNRF KD+  +D  +   ++  I   V  I  + +I   TP    + +P+ I Y ++  FY+S+SRQ +RL+S + S + +H  E+  G+S IR+      F       +D++        ++ RWL +RL+++GNLIV  S   AV  R S  LSA LVGLS+SYAL +T  LNW  R  +E ETN V++ERI +YT+ P E  N + +   ++W  NG I+++NFS++Y   L  VL  +T +I+  EKIG+VGRTGAGKSSL LALFR++E   G I IDG NI  + L QLR +LTI+PQDPV+FSGT++ NLDPF  ++DD++ ++L  + +  +V SL EG+++     G NLS+GQ+QLICLAR LL+K+K+++LDEA A+VD ETD  + + I+ QF   TV+ IAHRL T++D D+++ LD G + EF +PK+LLSN  G F ++A+
Sbjct:  208 PEYTASFLNQLTFQWFSGLAYLGNKKSLEKEDLWDLNERDKA------------ENIIPSFIENLIPEVEGYRRKI-KKNPEAAIPKNHPSILIPIFKTYKFTLLAGGCYKLMFDLLQFVAPELLRQLISFIEDKNQP-MWIGVSIALLMFLSSLLQSMILHQYFHEMFRLGMNIRSVLTSAVYTKTLNLSNEARKGKTTGAIVNLMSVDIQRIQDMTTFIMLFWSAPLQILLSLYFLWKLLGVSVLAGFVILILLIPFNSFISVKMRNCQMEQMKFKDERIKMMSEILNGMKVLKLYSWEKSMEKMVLEVREKEIRVLKKLSYLNAATTLSWACAPFLVAVLTFGLYVLWDPENNVLTPQITFVALALFNILRFPLAVFAMVFSQAVQCSASNTRLKEFFAAEEMSPQTSIAYG---GTDSAIKMDGGSFAWGSKEEDR-KLHDITFNIKRGQLVAIVGRVGSGKSSLLHALLGEMNKLSGSVQVNGSVAYVPQLAWIQNLSLRNNILFNRPYDAKLYQNVIENCALVQDLESLPAEDRTEIGEKGINLSGGQKQRVSLARAVYQNAEIVLLDDPLSAVDSHVGKHIFENVISTATGCLGTKTRVLLTHGLTYLKHCDQVIVLKDE-TISEMGTYQELMNSNGAFSEFLEEFLLEESKHKGRSVSFGEDSKEVNELLRDLDQVSPAIRQRIQSQMSQEIEKTDDKNAEIIRNGLHKDEQTAHSSIGKSEEKESLLGAISPKEKTPEPPKQTKTQLIEKEAVETGKVKFEVYMSYFRAIGIKIALVFFLVYVASSMLGVFSNLYLARWSDDAKEIALSG-NGSSSETQIRLGIYAVLGMGQATSVCAASIIMALGMVCASRLLHATLLENIMRSPMAFFDVTPLGRILNRFGKDVDGVDTDIPRTMSMFIRTAVSSIEIIAIILWATPLAISLLLPLFIVYFVVLRFYVSTSRQLKRLESASRSPIYSHFQESIQGASSIRAYGVVDKFIRESQHRVDENLATYYPSIVANRWLAVRLEMVGNLIVLSSAGAAVYFRDSPGLSAGLVGLSVSYALNITQTLNWAVRMTSELETNIVAVERINEYTITPTEG-NNSQSLAPKSWPENGEISIKNFSVRYRPGLDLVLHGVTAHISPCEKIGIVGRTGAGKSSLTLALFRIIEADGGCIEIDGTNIADLLLEQLRSRLTIVPQDPVLFSGTMRMNLDPFFAFSDDQIWEALRNAHLDSFVKSLQEGLHHHISEGGENLSVGQRQLICLARALLRKTKVLVLDEAAAAVDVETDSLLQKTIREQFKDCTVLTIAHRLNTVMDSDRLLVLDKGCVAEFDTPKKLLSNPDGIFYSMAK 1529          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Match: mrp-7 (pep chromosome:WBcel235:V:19674843:19693043:1 gene:WBGene00003413.1 transcript:Y43F8C.12.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mrp-7)

HSP 1 Score: 786.563 bits (2030), Expect = 0.000e+0
Identity = 492/1338 (36.77%), Postives = 762/1338 (56.95%), Query Frame = 2
Query:   32 NPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGW------ILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASE-KENDSNNSMPRKMSPGAPIEIQNGSFSWTED---GRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLM-------DFGTEFKSFLNESSDKVDKNQNNL-----------------------IQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNR---FSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNY-ISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHF-KALAQADEYIKHE 3910
            +PE  SS L+++T  W +   +   + +++ +  F+LN       +  + L  L E+   P     IHD      +  KK+ +E+ K     VI S+    F  + F W       LK   D +    P +L  LLN++  K+  + WKG+ +++L F      SL  N  F I  ++  +++ +L   +YKKTL +S  AR   + G+IVN+ ++D+E+          F SCP+QI  A++ L++ LGYS   GV  +   +P+NII     RK+   ++  KD+R  ++ E+ +G+K++K+YAWE      I+EIR  E+  I+  ++   I+       PF V   +F  F+   P+ L+TP+  FVSL LFN L+ P+ ++   ++QA+ A+VS  R++ FL+A E  E   + S+  + S  A + ++N + SW  +   G  TL +++L      LIAVVG+VG GKSSLL A+LGEM  L G +   G++AYVPQ+ WIQN TLR+NI   + F++  Y +VL AC L+ DI+ LP  DQTEIGE+G+NLSGGQK RVSLARAVYQ+ D+YLLDDPLSAVD +VG+ +F K+I   GLL+ KTR+LVTHGL +    DEI V+  +G+I E GT+EHL+       DF  E+KS  + SS+      ++                        +  +       +++ST  S        +     +  N +  +E I  G+V + +   Y KA G  +  + I   +++  LQ   + WL   +D     + S    ++    + +  YG +G  +     +     +F G RASK +H  L+  ++RS + F++ TP GRILNR  KD+  ID  L +N   ++   + +  +L+VI I TP F +V +P+ + Y++   +Y+ +SRQ +RL+S   S + +H  ET  G++ IR+     +F     R +D   + +    +S RWL +RL+ +GN I+F + +FAVL++   +  S  ++G+S+SYAL +T +LN+  RQ +E E N VS+ER+ +YT  P E+         +  W S G +  + +S +Y   L  VL +I+ ++  GEKIG+VGRTGAGKSS ALALFR++E   GRI ID V ++ IGLH LR  +TI+PQDPV+FSGTL+ NLDPF  Y+DD++ ++LE++ +  +   L +G+ Y     G NLS+GQ+QL+ LAR LL+ +++++LDEATA+VD  TD  + E I+ +F   TV  IAHRL TI+D D+I+ LD GSI+EF +P  L+++ +  F K +A A E  KHE
Sbjct:  207 SPELQSSFLNRLTLWWFNSIPWTGARRDLEIDDIFELNE-----RSGTEFLSELWESFWEPKRLKYIHD----TSIWAKKDPSEQEK--DPVVIPSVVSSLF--MMFRWEFLLASTLKFVSDTMQFASPFLLHELLNFISAKNAPF-WKGMALSILMFSVSELRSLILNGYFYIMFRMGTKIQTSLTAAVYKKTLLISNSARRDRTVGEIVNLMAIDVERFQMITPQIQQFWSCPYQITFALVYLFITLGYSALPGVVIMVIFVPMNIISSMIVRKWQIEQMKLKDERTKMVNEVLNGIKVVKLYAWEVPMEAYIDEIRTKELALIKKSAMVRNILDSFNTASPFLVALFSFGTFVLSNPSHLLTPQIAFVSLALFNQLRSPMTMIALLINQAVQAVVSNKRLKEFLVAEELDEKCVDRSVNIERSHNA-VRVENLTASWDPEEAAGEKTLQDVDLTAPRNSLIAVVGKVGSGKSSLLQALLGEMGKLRGRIGVNGRVAYVPQQPWIQNMTLRDNITFGRPFDRKRYDQVLYACALKADIKILPAGDQTEIGEKGINLSGGQKARVSLARAVYQNLDVYLLDDPLSAVDAHVGRHIFEKVIGPNGLLREKTRILVTHGLTYTKMADEILVML-EGKIEESGTFEHLIKRRGLFFDFMEEYKSGSDNSSEAGGSQDDDFEAIGGEIQDYMNPEDVVLTVTNDLDETIRTPELTTQISTMSSPEKPPTGTSPAAATESQNKLIKKEGIAQGKVEIATYQLYVKAAGYLLSIAFIGFFIVYMTLQILRSFWLSAWSDEYDPDSPSAHPMAKG---WRLGVYGALGFSETACFFVALLALVFVGQRASKNLHGPLIHNLMRSPMSFYDTTPLGRILNRCAKDIETIDMMLPMNFRYLVMCVLQVAFTLIVIIISTPLFAVVILPLALIYLIFLRYYVPTSRQLKRLESVHRSPIYSHFGETIQGAASIRAFGKVDEFRQDSGRILDTFIRCRYSSLVSNRWLAVRLEFVGNCIIFFAALFAVLSKEFGWITSPGVIGVSVSYALNITEVLNFAVRQVSEIEANIVSVERVNEYTNTPNEAPWRIEGREPAPGWPSRGVVKFDGYSTRYREGLDLVLHDISADVAAGEKIGIVGRTGAGKSSFALALFRMIEAAGGRIVIDDVEVSQIGLHDLRSNITIIPQDPVLFSGTLRFNLDPFFTYSDDQIWRALELAHLKHFAAGLPDGLLYKISEAGENLSVGQRQLVALARALLRHTRVLVLDEATAAVDVATDALIQETIREEFKECTVFTIAHRLNTIMDYDRIMVLDKGSILEFDTPDALMADKNSAFAKMVADAAEQDKHE 1525          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090026)

HSP 1 Score: 853.973 bits (2205), Expect = 0.000e+0
Identity = 518/1342 (38.60%), Postives = 788/1342 (58.72%), Query Frame = 2
Query:   29 ENPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLI----------GKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL------------------------------------------NES-SDKVD-KNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESI--NETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            E PE  +S LS+ITY W DK   + ++  ++++  +DL   ++ SE       +  +N+R  N +++   +E K              G+KN  ++   S   ++  + + +  +  FG ++K+F D L    P VL L++++++ +D    WKGIL A+L F      +      F     + +R+R AL   IY+K LR+S   +   + G+IVN+ +VD ++ M   TY  +  S P QI LA+  L+ +LG S+ AG+  +  +IP+N +I    + +  R++ +KD+R+ ++ E+  G+K++K+YAWE  F K++ +IR+ EI  +R+ +      S LW   PF V  +TF  ++    N+++   K FVSL LFN L+ P+ +LP  ++  +   VS  RI  FL  + +E D N+ +     P  P+ I+NG FSW ++   TL NIN+ V+   L+A+VG VG GKSS++ A LGEM  L G V T GK+AYVPQ+AWIQN T+R+NIL  +++++  Y KV+DAC L  DI+ L   D TEIGE+G+NLSGGQKQR+SLARAVY D+D+YLLDDPLSAVD +VG+ +F ++I  +G+L  K+RVLVTHG+ +LP VD I VI   G+ISE GT++ L+     F  F+                                           ES SD +   + ++L+      +R+  R  +  S     +   ++  E     +   E+  +G V       Y K+ GIF+  ++++   +F   Q   N+WL   A+ Q++ N++           Y+  YG  G GQ++   L       G + +++ +H+VLL   LR  ++ F+ TP GRI+NRF+KD+  ID+TL LN+  +I +   ++ ++VVIS+ TP F  V +PI   Y   Q FY+++SRQ  RL+S + S + +H  ET +G+S IR+      F       +DK+   K    ++ RWL +RL+++GNLI+  + +FAVL     +  LVGLS+SYALQVT  LNWL R  ++ ETN VS+ERI++Y     E+    E +    +NW   G +  +NF ++Y   L  VL+ ++ NI GGEK+G+VGRTGAGKSSL LALFR++E   GRI IDGV+I S+GLH LR +LTI+PQDPV+FSG+L+ NLDPF+  TDD++ K+LE+S +  +V SL  G+N++    G NLS+GQ+QL+CLAR LL+K+K+++LDEATA+VD ETD  + + I+ +F   TV+ IAHRL TI+D DK+I LD G IIEF SP ELL N    F ++A+
Sbjct:  223 EIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRK-NYKNKAR-VEPKAQFSNGNVTFENPHGEKNGRKKGMAS---IMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFL--NSEELDPNSVLHDSSKP-HPMSIENGEFSWGDE--ITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIK-MGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVE---GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTGLRD------MYLGVYGAFGFGQVVTGYLSTLILSLGCVYSARYMHNVLLHGTLRWPMEMFDITPLGRIVNRFSKDVDTIDNTLPLNLRVVILQLFAVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGG-QTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAK 1543          

HSP 2 Score: 80.1073 bits (196), Expect = 1.350e-14
Identity = 118/511 (23.09%), Postives = 216/511 (42.27%), Query Frame = 2
Query: 2447 KIHSVLLDTVLRSTLQFFNATPS----GRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFG-------IVGIPILICYILLQVFYISSSR----QARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKS-NKFKLIQYL----SLRWLCLRLDILGNLIVFGS-VIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAI---KFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKH 3907
            +I + L++ + R  L+  N+T      G I+N     L  +D    + +T  +N   ++ ++ + I +   +         + G+ ++I  IL+ V  + +SR    Q R++  K     L +  E  SG  +++    E  FE       DK     +   YL    S  W C     L +L+ F + V+    N    + + V LS+   L+    L  L           VS+ RI ++    + S     N +  +      +++EN    +   +   L+NI I +  G  + +VG  G+GKSS+  A    +E  +G +       N++G      +L  +PQ   I + T++ N+     Y   +  K ++   +   ++ L+ G   + G  G NLS GQKQ I LAR +   + + +LD+  ++VD    + + E +   K      + +++ H +  +   D I  +  G I E G+  +L+ N  G F     AD  I+H
Sbjct:  403 RIRTALINAIYRKALRISNSTKKESTVGEIVN-----LMAVDAQRFMELTTYLN---MIWSAPLQIGLALYFLWQQLGPSVLAGLAVMI--ILIPVNGVIASRIKTYQIRQMKYKDERVKLMN--EVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCA--PFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFP--LTMLPMLITNLVQTQVSVNRINKF----LNSEELDPNSVLHDSSKPHPMSIENGEFSWGDEI--TLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVV-------NTVG------KLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKN-KGAF-----ADFIIQH 872          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090025)

HSP 1 Score: 851.662 bits (2199), Expect = 0.000e+0
Identity = 518/1342 (38.60%), Postives = 782/1342 (58.27%), Query Frame = 2
Query:   29 ENPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLI----------GKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL------------------------------------------NES-SDKVD-KNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESI--NETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            E PE  +S LS+ITY W DK   + ++  ++++  +DL   ++ SE       +  +N+R  N +++   +E K              G+KN  ++   S   ++  + + +  +  FG ++K+F D L    P VL L++++++ +D    WKGIL A+L F      +      F     + +R+R AL   IY+K LR+S   +   + G+IVN+ +VD ++ M   TY  +  S P QI LA+  L+ +LG S+ AG+  +  +IP+N +I    + +  R++ +KD+R+ ++ E+  G+K++K+YAWE  F K++ +IR+ EI  +R+ +      S LW   PF V  +TF  ++    N+++   K FVSL LFN L+ P+ +LP  ++  +   VS  RI  FL  + +E D N+ +     P  P+ I+NG FSW ++   TL NIN+ V+   L+A+VG VG GKSS++ A LGEM  L G V T GK+AYVPQ+AWIQN T+R+NIL  +++++  Y KV+DAC L  DI+ L   D TEIGE+G+NLSGGQKQR+SLARAVY D+D+YLLDDPLSAVD +VG+ +F ++I  +G+L  K+RVLVTHG+ +LP VD I VI   G+ISE GT++ L+     F  F+                                           ES SD +   + ++L+      +R+  R  +  S     +   ++  E     +   E+  +G V       Y K+ GIF+  ++++   +F   Q   N+WL   A+ Q++ N++           Y+  YG  G GQ             G L A+K +HS+LL+ VLR+ +  F+ TP GRIL+RF+KD+  +D  +   I D I     ++ ++VVIS+ TP F  V +PI   Y   Q FY+++SRQ  RL+S + S + +H  ET +G+S IR+      F       +DK+   K    ++ RWL +RL+++GNLI+  + +FAVL     +  LVGLS+SYALQVT  LNWL R  ++ ETN VS+ERI++Y     E+    E +    +NW   G +  +NF ++Y   L  VL+ ++ NI GGEK+G+VGRTGAGKSSL LALFR++E   GRI IDGV+I S+GLH LR +LTI+PQDPV+FSG+L+ NLDPF+  TDD++ K+LE+S +  +V SL  G+N++    G NLS+GQ+QL+CLAR LL+K+K+++LDEATA+VD ETD  + + I+ +F   TV+ IAHRL TI+D DK+I LD G IIEF SP ELL N    F ++A+
Sbjct:  223 EIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRK-NYKNKAR-VEPKAQFSNGNVTFENPHGEKNGRKKGMAS---IMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFL--NSEELDPNSVLHDSSKP-HPMSIENGEFSWGDE--ITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIK-MGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVE---GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTGLRD------MYLGVYGAFGFGQGFTSFFSDLAPALGSLHAAKVLHSMLLENVLRAPMTMFDTTPVGRILSRFSKDVESVDQKMPQVINDCIWCAFEVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGG-QTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAK 1543          

HSP 2 Score: 80.8777 bits (198), Expect = 8.999e-15
Identity = 118/511 (23.09%), Postives = 216/511 (42.27%), Query Frame = 2
Query: 2447 KIHSVLLDTVLRSTLQFFNATPS----GRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFG-------IVGIPILICYILLQVFYISSSR----QARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKS-NKFKLIQYL----SLRWLCLRLDILGNLIVFGS-VIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAI---KFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKH 3907
            +I + L++ + R  L+  N+T      G I+N     L  +D    + +T  +N   ++ ++ + I +   +         + G+ ++I  IL+ V  + +SR    Q R++  K     L +  E  SG  +++    E  FE       DK     +   YL    S  W C     L +L+ F + V+    N    + + V LS+   L+    L  L           VS+ RI ++    + S     N +  +      +++EN    +   +   L+NI I +  G  + +VG  G+GKSS+  A    +E  +G +       N++G      +L  +PQ   I + T++ N+     Y   +  K ++   +   ++ L+ G   + G  G NLS GQKQ I LAR +   + + +LD+  ++VD    + + E +   K      + +++ H +  +   D I  +  G I E G+  +L+ N  G F     AD  I+H
Sbjct:  403 RIRTALINAIYRKALRISNSTKKESTVGEIVN-----LMAVDAQRFMELTTYLN---MIWSAPLQIGLALYFLWQQLGPSVLAGLAVMI--ILIPVNGVIASRIKTYQIRQMKYKDERVKLMN--EVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCA--PFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFP--LTMLPMLITNLVQTQVSVNRINKF----LNSEELDPNSVLHDSSKPHPMSIENGEFSWGDEI--TLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVV-------NTVG------KLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKN-KGAF-----ADFIIQH 872          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090022)

HSP 1 Score: 850.892 bits (2197), Expect = 0.000e+0
Identity = 517/1342 (38.52%), Postives = 783/1342 (58.35%), Query Frame = 2
Query:   29 ENPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLI----------GKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL------------------------------------------NES-SDKVD-KNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESI--NETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            E PE  +S LS+ITY W DK   + ++  ++++  +DL   ++ SE       +  +N+R  N +++   +E K              G+KN  ++   S   ++  + + +  +  FG ++K+F D L    P VL L++++++ +D    WKGIL A+L F      +      F     + +R+R AL   IY+K LR+S   +   + G+IVN+ +VD ++ M   TY  +  S P QI LA+  L+ +LG S+ AG+  +  +IP+N +I    + +  R++ +KD+R+ ++ E+  G+K++K+YAWE  F K++ +IR+ EI  +R+ +      S LW   PF V  +TF  ++    N+++   K FVSL LFN L+ P+ +LP  ++  +   VS  RI  FL  + +E D N+ +     P  P+ I+NG FSW ++   TL NIN+ V+   L+A+VG VG GKSS++ A LGEM  L G V T GK+AYVPQ+AWIQN T+R+NIL  +++++  Y KV+DAC L  DI+ L   D TEIGE+G+NLSGGQKQR+SLARAVY D+D+YLLDDPLSAVD +VG+ +F ++I  +G+L  K+RVLVTHG+ +LP VD I VI   G+ISE GT++ L+     F  F+                                           ES SD +   + ++L+      +R+  R  +  S     +   ++  E     +   E+  +G V       Y K+ GIF+  ++++   +F   Q   N+WL   A+ Q++ N++           Y+  YG  G GQ+            G L+ S+ +H  LL   LR  ++ F+ TP GRI+NRF+KD+  ID+ L  NI  +I +  +++ ++VVIS+ TP F  V +PI   Y   Q FY+++SRQ  RL+S + S + +H  ET +G+S IR+      F       +DK+   K    ++ RWL +RL+++GNLI+  + +FAVL     +  LVGLS+SYALQVT  LNWL R  ++ ETN VS+ERI++Y     E+    E +    +NW   G +  +NF ++Y   L  VL+ ++ NI GGEK+G+VGRTGAGKSSL LALFR++E   GRI IDGV+I S+GLH LR +LTI+PQDPV+FSG+L+ NLDPF+  TDD++ K+LE+S +  +V SL  G+N++    G NLS+GQ+QL+CLAR LL+K+K+++LDEATA+VD ETD  + + I+ +F   TV+ IAHRL TI+D DK+I LD G IIEF SP ELL N    F ++A+
Sbjct:  223 EIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRK-NYKNKAR-VEPKAQFSNGNVTFENPHGEKNGRKKGMAS---IMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFPLTMLPMLITNLVQTQVSVNRINKFL--NSEELDPNSVLHDSSKP-HPMSIENGEFSWGDE--ITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIK-MGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVE---GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTGLRD------MYLGVYGAFGFGQVATNFFSSLAISLGCLKCSQLLHQTLLYYNLRWPMELFDTTPLGRIVNRFSKDIDTIDNVLPFNIRVVIGQAYMVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGG-QTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAK 1543          

HSP 2 Score: 80.4925 bits (197), Expect = 1.189e-14
Identity = 118/511 (23.09%), Postives = 216/511 (42.27%), Query Frame = 2
Query: 2447 KIHSVLLDTVLRSTLQFFNATPS----GRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFG-------IVGIPILICYILLQVFYISSSR----QARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKS-NKFKLIQYL----SLRWLCLRLDILGNLIVFGS-VIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAI---KFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKH 3907
            +I + L++ + R  L+  N+T      G I+N     L  +D    + +T  +N   ++ ++ + I +   +         + G+ ++I  IL+ V  + +SR    Q R++  K     L +  E  SG  +++    E  FE       DK     +   YL    S  W C     L +L+ F + V+    N    + + V LS+   L+    L  L           VS+ RI ++    + S     N +  +      +++EN    +   +   L+NI I +  G  + +VG  G+GKSS+  A    +E  +G +       N++G      +L  +PQ   I + T++ N+     Y   +  K ++   +   ++ L+ G   + G  G NLS GQKQ I LAR +   + + +LD+  ++VD    + + E +   K      + +++ H +  +   D I  +  G I E G+  +L+ N  G F     AD  I+H
Sbjct:  403 RIRTALINAIYRKALRISNSTKKESTVGEIVN-----LMAVDAQRFMELTTYLN---MIWSAPLQIGLALYFLWQQLGPSVLAGLAVMI--ILIPVNGVIASRIKTYQIRQMKYKDERVKLMN--EVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCA--PFLVSLVTFATYVLIDENNVLDATKTFVSLSLFNILRFP--LTMLPMLITNLVQTQVSVNRINKF----LNSEELDPNSVLHDSSKPHPMSIENGEFSWGDEI--TLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVV-------NTVG------KLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKN-KGAF-----ADFIIQH 872          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090017)

HSP 1 Score: 849.736 bits (2194), Expect = 0.000e+0
Identity = 515/1342 (38.38%), Postives = 786/1342 (58.57%), Query Frame = 2
Query:   29 ENPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLI----------GKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL------------------------------------------NES-SDKVD-KNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESI--NETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            E PE  +S LS+ITY W DK   + ++  ++++  +DL   ++ SE       +  +N+R  N +++   +E K              G+KN  ++   S   ++  + + +  +  FG ++K+F D L    P VL L++++++ +D    WKGIL A+L F      +      F     + +R+R AL   IY+K LR+S   +   + G+IVN+ +VD ++ M   TY  +  S P QI LA+  L+ +LG S+ AG+  +  +IP+N +I    + +  R++ +KD+R+ ++ E+  G+K++K+YAWE  F K++ +IR+ EI  +R+ +      S LW   PF V  +TF  ++     + ++ EK+ VS+ LF+ ++LP+ +LP          VS  RI  FL  + +E D N+ +     P  P+ I+NG FSW ++   TL NIN+ V+   L+A+VG VG GKSS++ A LGEM  L G V T GK+AYVPQ+AWIQN T+R+NIL  +++++  Y KV+DAC L  DI+ L   D TEIGE+G+NLSGGQKQR+SLARAVY D+D+YLLDDPLSAVD +VG+ +F ++I  +G+L  K+RVLVTHG+ +LP VD I VI   G+ISE GT++ L+     F  F+                                           ES SD +   + ++L+      +R+  R  +  S     +   ++  E     +   E+  +G V       Y K+ GIF+  ++++   +F   Q   N+WL   A+ Q++ N++           Y+  YG  G GQ++   L       G + +++ +H+VLL   LR  ++ F+ TP GRI+NRF+KD+  ID+TL LN+  +I +   ++ ++VVIS+ TP F  V +PI   Y   Q FY+++SRQ  RL+S + S + +H  ET +G+S IR+      F       +DK+   K    ++ RWL +RL+++GNLI+  + +FAVL     +  LVGLS+SYALQVT  LNWL R  ++ ETN VS+ERI++Y     E+    E +    +NW   G +  +NF ++Y   L  VL+ ++ NI GGEK+G+VGRTGAGKSSL LALFR++E   GRI IDGV+I S+GLH LR +LTI+PQDPV+FSG+L+ NLDPF+  TDD++ K+LE+S +  +V SL  G+N++    G NLS+GQ+QL+CLAR LL+K+K+++LDEATA+VD ETD  + + I+ +F   TV+ IAHRL TI+D DK+I LD G IIEF SP ELL N    F ++A+
Sbjct:  223 EIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRK-NYKNKAR-VEPKAQFSNGNVTFENPHGEKNGRKKGMAS---IMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLTSEANQLSVEKVLVSIALFDLMKLPLTILPMLSVDIAETQVSVNRINKFL--NSEELDPNSVLHDSSKP-HPMSIENGEFSWGDE--ITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIK-MGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVE---GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTGLRD------MYLGVYGAFGFGQVVTGYLSTLILSLGCVYSARYMHNVLLHGTLRWPMEMFDITPLGRIVNRFSKDVDTIDNTLPLNLRVVILQLFAVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGG-QTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAK 1543          

HSP 2 Score: 84.7297 bits (208), Expect = 4.917e-16
Identity = 120/512 (23.44%), Postives = 225/512 (43.95%), Query Frame = 2
Query: 2447 KIHSVLLDTVLRSTLQFFNATPS----GRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFG-------IVGIPILICYILLQVFYISSSR----QARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKS-NKFKLIQYL----SLRWLCLRLDILGNLIVFGS-VIFAVLNRFSLSASLVGLSISYALQVT-GILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAI---KFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKH 3907
            +I + L++ + R  L+  N+T      G I+N     L  +D    + +T  +N   ++ ++ + I +   +         + G+ ++I  IL+ V  + +SR    Q R++  K     L +  E  SG  +++    E  FE       DK     +   YL    S  W C     L +L+ F + V+ +  N+ S+   LV +++   +++   IL  L+   AE +   VS+ RI ++    + S     N +  +      +++EN    +   +   L+NI I +  G  + +VG  G+GKSS+  A    +E  +G +       N++G      +L  +PQ   I + T++ N+     Y   +  K ++   +   ++ L+ G   + G  G NLS GQKQ I LAR +   + + +LD+  ++VD    + + E +   K      + +++ H +  +   D I  +  G I E G+  +L+ N  G F     AD  I+H
Sbjct:  403 RIRTALINAIYRKALRISNSTKKESTVGEIVN-----LMAVDAQRFMELTTYLN---MIWSAPLQIGLALYFLWQQLGPSVLAGLAVMI--ILIPVNGVIASRIKTYQIRQMKYKDERVKLMN--EVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCA--PFLVSLVTFATYVLTSEANQLSVEKVLVSIALFDLMKLPLTILPMLSVDIAETQ---VSVNRINKF----LNSEELDPNSVLHDSSKPHPMSIENGEFSWGDEI--TLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVV-------NTVG------KLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKN-KGAF-----ADFIIQH 872          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Match: MRP (gene:FBgn0032456 transcript:FBtr0090016)

HSP 1 Score: 846.655 bits (2186), Expect = 0.000e+0
Identity = 514/1342 (38.30%), Postives = 781/1342 (58.20%), Query Frame = 2
Query:   29 ENPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLI----------GKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL------------------------------------------NES-SDKVD-KNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESI--NETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            E PE  +S LS+ITY W DK   + ++  ++++  +DL   ++ SE       +  +N+R  N +++   +E K              G+KN  ++   S   ++  + + +  +  FG ++K+F D L    P VL L++++++ +D    WKGIL A+L F      +      F     + +R+R AL   IY+K LR+S   +   + G+IVN+ +VD ++ M   TY  +  S P QI LA+  L+ +LG S+ AG+  +  +IP+N +I    + +  R++ +KD+R+ ++ E+  G+K++K+YAWE  F K++ +IR+ EI  +R+ +      S LW   PF V  +TF  ++     + ++ EK+ VS+ LF+ ++LP+ +LP          VS  RI  FL  + +E D N+ +     P  P+ I+NG FSW ++   TL NIN+ V+   L+A+VG VG GKSS++ A LGEM  L G V T GK+AYVPQ+AWIQN T+R+NIL  +++++  Y KV+DAC L  DI+ L   D TEIGE+G+NLSGGQKQR+SLARAVY D+D+YLLDDPLSAVD +VG+ +F ++I  +G+L  K+RVLVTHG+ +LP VD I VI   G+ISE GT++ L+     F  F+                                           ES SD +   + ++L+      +R+  R  +  S     +   ++  E     +   E+  +G V       Y K+ GIF+  ++++   +F   Q   N+WL   A+ Q++ N++           Y+  YG  G GQ+            G L+ S+ +H  LL   LR  ++ F+ TP GRI+NRF+KD+  ID+ L  NI  +I +  +++ ++VVIS+ TP F  V +PI   Y   Q FY+++SRQ  RL+S + S + +H  ET +G+S IR+      F       +DK+   K    ++ RWL +RL+++GNLI+  + +FAVL     +  LVGLS+SYALQVT  LNWL R  ++ ETN VS+ERI++Y     E+    E +    +NW   G +  +NF ++Y   L  VL+ ++ NI GGEK+G+VGRTGAGKSSL LALFR++E   GRI IDGV+I S+GLH LR +LTI+PQDPV+FSG+L+ NLDPF+  TDD++ K+LE+S +  +V SL  G+N++    G NLS+GQ+QL+CLAR LL+K+K+++LDEATA+VD ETD  + + I+ +F   TV+ IAHRL TI+D DK+I LD G IIEF SP ELL N    F ++A+
Sbjct:  223 EIPELSASFLSRITYQWFDKMALKGYRNPLEEKDLWDLRPQDSCSEVMPIFAHHWNQNVRK-NYKNKAR-VEPKAQFSNGNVTFENPHGEKNGRKKGMAS---IMPPIYKSFGGVFLFGALMKLFTDTLTFAQPQVLSLIISFVEAQDAEPEWKGILYAVLLFVLAAAQTFILGQYFHRMFIVGLRIRTALINAIYRKALRISNSTKKESTVGEIVNLMAVDAQRFMELTTYLNMIWSAPLQIGLALYFLWQQLGPSVLAGLAVMIILIPVNGVIASRIKTYQIRQMKYKDERVKLMNEVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCAPFLVSLVTFATYVLTSEANQLSVEKVLVSIALFDLMKLPLTILPMLSVDIAETQVSVNRINKFL--NSEELDPNSVLHDSSKP-HPMSIENGEFSWGDE--ITLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVVNTVGKLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIK-MGEISESGTFDQLVKNKGAFADFIIQHLQEGNEEEEELNQIKRQISSTADVPELLGTVEKAIKLARTESLSDSISVTSADSLMGGGGSLRRRTKRQDSHDSVASAASLKKKQEVE---GKLIETEKSQTGGVEFAVYKHYIKSVGIFLSVATLVLNFVFQAFQIGSNLWLTQWANDQNVANDTGLRD------MYLGVYGAFGFGQVATNFFSSLAISLGCLKCSQLLHQTLLYYNLRWPMELFDTTPLGRIVNRFSKDIDTIDNVLPFNIRVVIGQAYMVLATIVVISLSTPIFLAVIVPIAFLYYFAQRFYVATSRQLMRLESVSRSPIYSHFSETVTGASTIRAYNVGDRFIEESDAKVDKNQVCKYPSVIANRWLAIRLEMVGNLIILFASLFAVLGG-QTNPGLVGLSVSYALQVTQTLNWLVRMSSDIETNIVSVERIKEYGETKQEAPWELEQDKNKPKNWPQEGRVEFQNFQVRYREGLDLVLRGVSFNIQGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGRISIDGVDIASMGLHMLRSRLTIIPQDPVLFSGSLRINLDPFEIKTDDEIWKALELSHLKSFVKSLAAGLNHEIAEGGENLSVGQRQLVCLARALLRKTKVLVLDEATAAVDLETDDLIQKTIRTEFKECTVLTIAHRLNTILDSDKVIVLDKGQIIEFASPTELLDNPKSAFYSMAK 1543          

HSP 2 Score: 85.1149 bits (209), Expect = 3.980e-16
Identity = 120/512 (23.44%), Postives = 225/512 (43.95%), Query Frame = 2
Query: 2447 KIHSVLLDTVLRSTLQFFNATPS----GRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFG-------IVGIPILICYILLQVFYISSSR----QARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKS-NKFKLIQYL----SLRWLCLRLDILGNLIVFGS-VIFAVLNRFSLSASLVGLSISYALQVT-GILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAI---KFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKH 3907
            +I + L++ + R  L+  N+T      G I+N     L  +D    + +T  +N   ++ ++ + I +   +         + G+ ++I  IL+ V  + +SR    Q R++  K     L +  E  SG  +++    E  FE       DK     +   YL    S  W C     L +L+ F + V+ +  N+ S+   LV +++   +++   IL  L+   AE +   VS+ RI ++    + S     N +  +      +++EN    +   +   L+NI I +  G  + +VG  G+GKSS+  A    +E  +G +       N++G      +L  +PQ   I + T++ N+     Y   +  K ++   +   ++ L+ G   + G  G NLS GQKQ I LAR +   + + +LD+  ++VD    + + E +   K      + +++ H +  +   D I  +  G I E G+  +L+ N  G F     AD  I+H
Sbjct:  403 RIRTALINAIYRKALRISNSTKKESTVGEIVN-----LMAVDAQRFMELTTYLN---MIWSAPLQIGLALYFLWQQLGPSVLAGLAVMI--ILIPVNGVIASRIKTYQIRQMKYKDERVKLMN--EVLSGIKVLKLYAWEPSFEKQVLDIRDKEIATLRSTAYLNAGTSFLWSCA--PFLVSLVTFATYVLTSEANQLSVEKVLVSIALFDLMKLPLTILPMLSVDIAETQ---VSVNRINKF----LNSEELDPNSVLHDSSKPHPMSIENGEFSWGDEI--TLRNINIEVKKGSLVALVGTVGSGKSSVVQAFLGEMEKLAGVV-------NTVG------KLAYVPQQAWIQNATVRDNILFGQTYDRKRYNKVIDACALRADIDILSAGDLTEIGEKGINLSGGQKQRISLARAVYSDADLYLLDDPLSAVDAHVGKHIFEEVIGPKGILARKSRVLVTHGVTFLPQVDSIYVIKMGEISESGTFDQLVKN-KGAF-----ADFIIQH 872          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [Source:ZFIN;Acc:ZDB-GENE-050517-15])

HSP 1 Score: 829.706 bits (2142), Expect = 0.000e+0
Identity = 509/1322 (38.50%), Postives = 785/1322 (59.38%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSEN--------SEKCLKY---LKENLRSP--NIESEIHD---IEDKKCLIGKKNFNEEFKYSGK-FVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAP--IEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL----NESSDKVDKNQNNLIQ--------PSAPNKRKRSRLSTSGS----QGFDGNENAEENYEKYF--NDISHEEEIMSGRVSLNSIVW-YFKATGIFVFGSSILACVIFGV--LQAFG-NVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES-INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFK 3874
            PE+ +S LS+IT+ W+   + + +K  ++++  + LNN + S            ++C+K    + + L SP  +   E  D   +E+ + L+ K       + +G+  +  +LCR + P      + KI  D+L+   P +L+LL+ ++ +     TW G     L F      +L     F +     +R+R A+ G +Y+K L ++  AR   + G+IVN+ SVD ++ M+ ITY  +  S P Q+ILA+  L+  LG S+ AGV  +  ++PLN +I   ++ +   ++  KD R+ ++ E+ +G+K++K+YAWE  F  K+  IR  E++ ++ ++    I +  W   PF V   TF  ++    N+++  +K FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL  S +E D +N + R    G P  I I +G+FSW++D  PTL  IN+++    L+AVVG VG GKSSLLSA+LGEM+   G+V  +G +AYVPQ+AWIQN TL++NIL  +     +Y KV++AC L  D+E LP  D TEIGE+GVNLSGGQKQRVS+ARAVY +  +YLLDDPLSAVD +VG+ +F K+I  QGLL+ +TRVLVTHGL +LP  D I V+ D G+I+E G+Y  L+     F  FL    N   ++ +++  + +         P+A  ++ +  L+ +G+    Q  + N++A     K    + ++  ++  +GRV L S+ W Y KA G+ +   SI +  +F    L + G N WL +  D      +   N ++   +  +  YG +G+ Q +AV  +      GG+ AS+ +H  +L  VLRS + FF  TPSG ++NRF K+   ID  +   I   +     ++ S  VI I TP   I+  P+ + Y  +Q FY++SSRQ +RL+S + S V TH  ET  G+S+IR+   +  F       +D + K      ++ RWL +RL+ +GN IV  + +FAV+ R +LS  ++GLSISYALQVT  LNWL R  +E ETN V++ER+++Y     E+     N+ +   W + G+I +  F L+Y  +L   + +I++NI GGEK+G+VGRTGAGKSSL L LFR++E   G I IDGVNI  +GLH+LR ++TI+PQDPV+FSG+L+ NLDPFD YTD+++ +SLE++ +  +V+ L + +N++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF   TV+ IAHRL TI+D  +++ LD G + EF SP  L++     +K
Sbjct:  209 PESGASFLSKITFWWITGLMVKGYKRPLEEKDLWSLNNEDKSERVVPQLVRRWDQECVKVKRPVDKTLYSPKRSTRGEKKDGQPVEESEILLAKA-----LQKTGEPSLFFALCRTFGPYFLVSSLYKIIHDVLMFVGPEILRLLILFVNDSSAP-TWHGYFYTALLFVCTCLQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGASVLAGVAVMVLMVPLNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKGKVSAIRESELRVLKKMAYLGAISTFTWVCAPFLVALSTFAVYVLVDENNILDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMQRLRVFL--SHEELDDDN-VERPAISGTPDSIRIADGAFSWSKDDPPTLKRINVSIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGSVSIKGSVAYVPQQAWIQNATLKDNILFGRETKDSWYQKVVEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSVARAVYCNCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGLLQGRTRVLVTHGLSFLPQADLILVMVD-GEITEMGSYTELLGRQGAFAEFLRTYTNTEQEEGEESLGDAVPRKGLENGGPAALLRQSQISLNATGAGKTTQKTEANDDAAATKTKSAEASRLTEADKANTGRVKL-SVFWEYMKAIGLPL---SIFSIFLFFCHHLSSLGSNYWLSLWTD------DPVVNNTQPKREMRLGVYGALGISQGIAVFCYSVSVSVGGILASRYLHQTMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQMKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIKESDGRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARNNLSPGIMGLSISYALQVTASLNWLVRMSSELETNIVAVERVKEYGDTEKEAEWKLENSNLPPGWPTAGHIEIHKFGLRYREDLELAICDISVNIAGGEKVGIVGRTGAGKSSLTLGLFRIIEAAEGEIRIDGVNIADLGLHELRSRITIIPQDPVLFSGSLRMNLDPFDGYTDEEVWRSLELAHLKTFVSGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGQMAEFDSPSNLIAKKGIFYK 1510          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [Source:ZFIN;Acc:ZDB-GENE-050517-15])

HSP 1 Score: 826.239 bits (2133), Expect = 0.000e+0
Identity = 506/1306 (38.74%), Postives = 773/1306 (59.19%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSEN--------SEKCLKY---LKENLRSP--NIESEIHD---IEDKKCLIGKKNFNEEFKYSGK-FVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAP--IEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYF--NDISHEEEIMSGRVSLNSIVW-YFKATGIFVFGSSILACVIFGV--LQAFG-NVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES-INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFK 3874
            PE+ +S LS+IT+ W+   + + +K  ++++  + LNN + S            ++C+K    + + L SP  +   E  D   +E+ + L+ K       + +G+  +  +LCR + P      + KI  D+L+   P +L+LL+ ++ +     TW G     L F      +L     F +     +R+R A+ G +Y+K L ++  AR   + G+IVN+ SVD ++ M+ ITY  +  S P Q+ILA+  L+  LG S+ AGV  +  ++PLN +I   ++ +   ++  KD R+ ++ E+ +G+K++K+YAWE  F  K+  IR  E++ ++ ++    I +  W   PF V   TF  ++    N+++  +K FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL  S +E D +N + R    G P  I I +G+FSW++D  PTL  IN+++    L+AVVG VG GKSSLLSA+LGEM+   G+V  +G +AYVPQ+AWIQN TL++NIL  +     +Y KV++AC L  D+E LP  D TEIGE+GVNLSGGQKQRVS+ARAVY +  +YLLDDPLSAVD +VG+ +F K+I  QGLL+ +TRVLVTHGL +LP  D I V+ D G+I+E G+Y  L+     F  FL   ++            +   + + S      S+G   N++A     K    + ++  ++  +GRV L S+ W Y KA G+ +   SI +  +F    L + G N WL +  D      +   N ++   +  +  YG +G+ Q +AV  +      GG+ AS+ +H  +L  VLRS + FF  TPSG ++NRF K+   ID  +   I   +     ++ S  VI I TP   I+  P+ + Y  +Q FY++SSRQ +RL+S + S V TH  ET  G+S+IR+   +  F       +D + K      ++ RWL +RL+ +GN IV  + +FAV+ R +LS  ++GLSISYALQVT  LNWL R  +E ETN V++ER+++Y     E+     N+ +   W + G+I +  F L+Y  +L   + +I++NI GGEK+G+VGRTGAGKSSL L LFR++E   G I IDGVNI  +GLH+LR ++TI+PQDPV+FSG+L+ NLDPFD YTD+++ +SLE++ +  +V+ L + +N++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF   TV+ IAHRL TI+D  +++ LD G + EF SP  L++     +K
Sbjct:  217 PESGASFLSKITFWWITGLMVKGYKRPLEEKDLWSLNNEDKSERVVPQLVRRWDQECVKVKRPVDKTLYSPKRSTRGEKKDGQPVEESEILLAKA-----LQKTGEPSLFFALCRTFGPYFLVSSLYKIIHDVLMFVGPEILRLLILFVNDSSAP-TWHGYFYTALLFVCTCLQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGASVLAGVAVMVLMVPLNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKGKVSAIRESELRVLKKMAYLGAISTFTWVCAPFLVALSTFAVYVLVDENNILDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMQRLRVFL--SHEELDDDN-VERPAISGTPDSIRIADGAFSWSKDDPPTLKRINVSIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGSVSIKGSVAYVPQQAWIQNATLKDNILFGRETKDSWYQKVVEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSVARAVYCNCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGLLQGRTRVLVTHGLSFLPQADLILVMVD-GEITEMGSYTELLGRQGAFAEFLRTYTN------------TEQEEGEESLGGEQTSEGLSSNDDAAATKTKSAEASRLTEADKANTGRVKL-SVFWEYMKAIGLPL---SIFSIFLFFCHHLSSLGSNYWLSLWTD------DPVVNNTQPKREMRLGVYGALGISQGIAVFCYSVSVSVGGILASRYLHQTMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQMKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIKESDGRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARNNLSPGIMGLSISYALQVTASLNWLVRMSSELETNIVAVERVKEYGDTEKEAEWKLENSNLPPGWPTAGHIEIHKFGLRYREDLELAICDISVNIAGGEKVGIVGRTGAGKSSLTLGLFRIIEAAEGEIRIDGVNIADLGLHELRSRITIIPQDPVLFSGSLRMNLDPFDGYTDEEVWRSLELAHLKTFVSGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGQMAEFDSPSNLIAKKGIFYK 1490          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1523])

HSP 1 Score: 816.609 bits (2108), Expect = 0.000e+0
Identity = 514/1367 (37.60%), Postives = 788/1367 (57.64%), Query Frame = 2
Query:   32 NPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETS-------SENSEKCLKYLKENLRSPNIESEIH-DIEDKKCLIGKKNFNEEF------------------------KYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSG----SQGFDGNENAEENYEKYFNDISH----------------------------------EEEIM-SGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTF-NQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKHEDK 3916
            NPE  ++ LS+IT+ W +  +++ FK  +  E  +DLN  +++        +   K LK  + NL+    +     D E +  L   K  +++                          Y   +++ ++ + +  ++    + K+ +D+L    P +LKL++ + +NKD SY W G L A+L        S+     F     + ++VR A+   +YKK L +S ++R   +AG+IVN+ S D ++  +   +  +  SCP QI L+I  L++ELG S+ +G+  +  ++P+N  +   SR+F  + + FKD RM I+ ++ +G+KI+K YAWE  F  +++EIR  E+K +R  +    + + ++   P  V   TF  F+   P++++  EK F S+ LFN L+ P+ +LP  +S  +   VS  R+E FL   + +     ++    S  A + + NG+++W  D  P L  ++L+++  +L+AVVG VG GK+SL+SA+LGE++++ G +   G +AYVPQ+AWIQN TL++NIL   S ++  Y  V+ AC LE D++ LP RDQTEIGE+G+NLSGGQKQRVSLARAVY  +D+YLLDDPLSAVD +VG+ LF K+I   GLL+ KTR+LVTHG+ +LP+VDEI V+   G +SE G+YE L      F  FL E+  K + N++N  + +A        + T      +Q     E+   +  K  N + H                                  E+E+M +GRV  +  + Y  A G +  G S +   I  V     N+WL    D      N T+ N  R++    I  +G +GL Q   V         G + AS+ +H+ LL  +L+  + FF+ TPSGRI+NRF KD+F +D  + ++    I   + ++ +L VI + TP F  V +P+ + Y  +Q FY+++SRQ RRLDS + S + +H  ET SG S+IR+   +  F       ID++ K      +S RWL +RL+ LGNL+VF + +FAV++R SL++ LVGLSISYAL VT  LNWL R  +E ETN V++ER+R+Y  I  E+   T+    ++W S GNI  E++ ++Y   L  VL  +T +I   EKIG+VGRTGAGKSSL   LFR+VE   GRI ID ++I ++GLH LR +LTI+PQDPV+FSGTL+ NLDPF  ++D ++   LE++ + ++V  L  G+ ++    G NLS+GQ+QL+CLAR LL+KS+I+ILDEATA+VD ETD  +   I+ +F   TV+ IAHRL TI+D  +++ LD G I+EF SP ELLS   GHF ++A+ D  I+ E++
Sbjct:  207 NPEAKATFLSRITFNWFNSMVWKGFKRPLVQEDMWDLNKNDSTHFICQTFEDVMAKELKKARNNLQKKKSKKRKTVDAEGQNGL--AKGVSQDVLVMETETEKESKKKKKKKQKDSDSDYPQSWLVTTIVKSFKGVLLESALFKLLQDLLSFASPQLLKLMIAFTQNKD-SYAWTGYLYAVLLVLVAFVQSVVLQQYFQRCFILGMKVRTAIMAAVYKKALVVSNDSRKESTAGEIVNLMSADAQRFNDVTNFIHLLWSCPLQIALSIAFLWIELGPSVLSGLLVMVLMVPINGWLATKSRQFQMQNMKFKDSRMKIVNDLLNGIKILKYYAWETSFEAQVQEIREKELKVMRKFAYLSSVSTFIFSCAPALVSLATFAVFVSVSPDNILDAEKAFTSISLFNILRFPLAMLPQLISIMVQTSVSKKRLEKFLSGDDLDT---TTVTHNSSITAAVSMTNGTYAWERDTEPVLKQVSLDIKPGRLVAVVGAVGSGKTSLVSALLGELHSIKGNININGSVAYVPQQAWIQNATLKDNILFGSSVDEERYQSVIKACALEPDLDLLPGRDQTEIGEKGINLSGGQKQRVSLARAVYSSADVYLLDDPLSAVDSHVGKHLFEKVIGPNGLLRDKTRILVTHGISFLPYVDEIVVLV-HGVVSEIGSYESLRASKGAFSEFL-ETYGKDESNKDNDKKAAAAQTPVYEEIETLPEGLETQADGSPEDIVSSTLKRENSLRHSQRHSKRNGSVKVRKNSSLRAQKDPEDKKGQRLIEKEMMETGRVKFSVYLQYLSAMGWWYVGFSFVFYFIQNVAVIGQNLWLSDWTDDSIEYFNQTYPNHIRDTR---IGVFGALGLAQGFLVFFGTILLADGSISASRTLHTSLLTNILKVPMMFFDTTPSGRIVNRFAKDIFTVDEMIPMSFRSWILCLLGVLGTLFVICLATPIFTAVVVPMAVVYYFVQRFYVATSRQLRRLDSVSRSPIYSHFGETVSGLSVIRAYGHQDRFLKHNEDTIDQNLKSVYPWIVSNRWLAMRLESLGNLVVFFAALFAVISRDSLNSGLVGLSISYALNVTQTLNWLVRMTSELETNIVAVERVREYAEIQNEAPWVTSVRPPDDWPSAGNIRFEDYKVRYRPELELVLHGVTCDIQSTEKIGIVGRTGAGKSSLTNCLFRIVEAADGRILIDDIDIATLGLHDLRSRLTIIPQDPVLFSGTLRMNLDPFQTFSDAEIWSVLELAHLKEYVRGLPTGLEHEVSEGGENLSLGQRQLLCLARALLRKSRILILDEATAAVDLETDDLIQSTIRREFSHCTVLTIAHRLNTILDSSRVMVLDSGKIVEFDSPNELLSK-PGHFSSMAE-DAGIRREEE 1560          

HSP 2 Score: 69.3218 bits (168), Expect = 3.199e-11
Identity = 97/434 (22.35%), Postives = 190/434 (43.78%), Query Frame = 2
Query:  794 GAVIPLNII---IMKF----SRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRN--VSVGWCIMSV--LWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDS---NNSMPRKMSPGAP-IEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTV-------------QTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNN 2011
              V+P+ ++   + +F    SR+    + + +    S   E   G+ +I+ Y  +  F K  E+  +  +K++    VS  W  M +  L +LV FF        F     +SL     + +S+    N+   +  L    S+  + +V+  R+  +   +E +N++    +  P    P A  I  ++    +  +    L+ +  ++++ + I +VGR G GKSSL + +   +   +G +                 ++  +PQ+  + + TLR N+   ++F+      VL+   L+  +  LP   + E+ E G NLS GQ+Q + LARA+ + S I +LD+  +AVD+     L    I  +    H T + + H L  +     + V+ D G+I E  +   L+     F S   ++  + ++ Q+ 
Sbjct: 1143 AVVVPMAVVYYFVQRFYVATSRQLRRLDSVSRSPIYSHFGETVSGLSVIRAYGHQDRFLKHNEDTIDQNLKSVYPWIVSNRWLAMRLESLGNLVVFFA-----ALFAVISRDSL-NSGLVGLSISYALNVTQTLNWLVRMTSELETNIVAVERVREY---AEIQNEAPWVTSVRPPDDWPSAGNIRFEDYKVRYRPELELVLHGVTCDIQSTEKIGIVGRTGAGKSSLTNCLFRIVEAADGRILIDDIDIATLGLHDLRSRLTIIPQDPVLFSGTLRMNLDPFQTFSDAEIWSVLELAHLKEYVRGLPTGLEHEVSEGGENLSLGQRQLLCLARALLRKSRILILDEATAAVDLET-DDLIQSTIRRE--FSHCTVLTIAHRLNTILDSSRVMVL-DSGKIVEFDSPNELLSKPGHFSSMAEDAGIRREEEQSQ 1563          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1523])

HSP 1 Score: 815.068 bits (2104), Expect = 0.000e+0
Identity = 515/1367 (37.67%), Postives = 789/1367 (57.72%), Query Frame = 2
Query:   32 NPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETS-------SENSEKCLKYLKENLRSPNIESEIH-DIEDKKCLIGKKNFNEEF------------------------KYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSA---PNKRKRSRLSTSGSQGFDGN-ENAEENYEKYFNDISH----------------------------------EEEIM-SGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTF-NQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKHEDK 3916
            NPE  ++ LS+IT+ W +  +++ FK  +  E  +DLN  +++        +   K LK  + NL+    +     D E +  L   K  +++                          Y   +++ ++ + +  ++    + K+ +D+L    P +LKL++ + +NKD SY W G L A+L        S+     F     + ++VR A+   +YKK L +S ++R   +AG+IVN+ S D ++  +   +  +  SCP QI L+I  L++ELG S+ +G+  +  ++P+N  +   SR+F  + + FKD RM I+ ++ +G+KI+K YAWE  F  +++EIR  E+K +R  +    + + ++   P  V   TF  F+   P++++  EK F S+ LFN L+ P+ +LP  +S  +   VS  R+E FL   + +     ++    S  A + + NG+++W  D  P L  ++L+++  +L+AVVG VG GK+SL+SA+LGE++++ G +   G +AYVPQ+AWIQN TL++NIL   S ++  Y  V+ AC L  D++ LP RDQTEIGE+G+NLSGGQKQRVSLARAVY  +D+YLLDDPLSAVD +VG+ LF K+I   GLL+ KTR+LVTHG+ +LP+VDEI V+   G +SE G+YE L      F  FL E+  K + N++N  + +A   P   +   L        DG+ E+   +  K  N + H                                  E+E+M +GRV  +  + Y  A G +  G S +   I  V     N+WL    D      N T+ N  R++    I  +G +GL Q   V         G + AS+ +H+ LL  +L+  + FF+ TPSGRI+NRF KD+F +D  + ++    I   + ++ +L VI + TP F  V +P+ + Y  +Q FY+++SRQ RRLDS + S + +H  ET SG S+IR+   +  F       ID++ K      +S RWL +RL+ LGNL+VF + +FAV++R SL++ LVGLSISYAL VT  LNWL R  +E ETN V++ER+R+Y  I  E+   T+    ++W S GNI  E++ ++Y   L  VL  +T +I   EKIG+VGRTGAGKSSL   LFR+VE   GRI ID ++I ++GLH LR +LTI+PQDPV+FSGTL+ NLDPF  ++D ++   LE++ + ++V  L  G+ ++    G NLS+GQ+QL+CLAR LL+KS+I+ILDEATA+VD ETD  +   I+ +F   TV+ IAHRL TI+D  +++ LD G I+EF SP ELLS   GHF ++A+ D  I+ E++
Sbjct:  193 NPEAKATFLSRITFNWFNSMVWKGFKRPLVQEDMWDLNKNDSTHFICQTFEDVMAKELKKARNNLQKKKSKKRKTVDAEGQNGL--AKGVSQDVLVMETETEKESKKKKKKKQKDSDSDYPQSWLVTTIVKSFKGVLLESALFKLLQDLLSFASPQLLKLMIAFTQNKD-SYAWTGYLYAVLLVLVAFVQSVVLQQYFQRCFILGMKVRTAIMAAVYKKALVVSNDSRKESTAGEIVNLMSADAQRFNDVTNFIHLLWSCPLQIALSIAFLWIELGPSVLSGLLVMVLMVPINGWLATKSRQFQMQNMKFKDSRMKIVNDLLNGIKILKYYAWETSFEAQVQEIREKELKVMRKFAYLSSVSTFIFSCAPALVSLATFAVFVSVSPDNILDAEKAFTSISLFNILRFPLAMLPQLISIMVQTSVSKKRLEKFLSGDDLDT---TTVTHDSSITAAVSMTNGTYAWERDTEPVLKQVSLDIKPGRLVAVVGAVGSGKTSLVSALLGELHSIKGNININGSVAYVPQQAWIQNATLKDNILFGSSVDEERYQSVIKACALGPDLDLLPGRDQTEIGEKGINLSGGQKQRVSLARAVYSSADVYLLDDPLSAVDSHVGKHLFEKVIGPNGLLRDKTRILVTHGISFLPYVDEIVVLV-HGVVSEIGSYESLRASKGAFSEFL-ETYGKDESNKDNDKKAAAAQTPVYEEIETLPEGLETQADGSPEDIVSSTLKRENSLRHSQRHSKRNGSVKVRKNSSLRAQKDPEDKKGQRLIEKEMMETGRVKFSVYLQYLSAMGWWYVGFSFVFYFIQNVAVIGQNLWLSDWTDDSIEYFNQTYPNHIRDTR---IGVFGALGLAQGFLVFFGTILLADGSISASRTLHTSLLTNILKVPMMFFDTTPSGRIVNRFAKDIFTVDEMIPMSFRSWILCLLGVLGTLFVICLATPIFTAVVVPMAVVYYFVQRFYVATSRQLRRLDSVSRSPIYSHFGETVSGLSVIRAYGHQDRFLKHNEHTIDQNLKSVYPWIVSNRWLAMRLESLGNLVVFFAALFAVISRDSLNSGLVGLSISYALNVTQTLNWLVRMTSELETNIVAVERVREYAEIQNEAPWVTSVRPPDDWPSAGNIRFEDYKVRYRPELELVLHGVTCDIQSTEKIGIVGRTGAGKSSLTNCLFRIVEAADGRILIDDIDIATLGLHDLRSRLTIIPQDPVLFSGTLRMNLDPFQTFSDAEIWSVLELAHLKEYVRGLPTGLEHEVSEGGENLSLGQRQLLCLARALLRKSRILILDEATAAVDLETDDLIQSTIRREFSHCTVLTIAHRLNTILDSSRVMVLDSGKIVEFDSPNELLSK-PGHFSSMAE-DAGIRREEE 1546          

HSP 2 Score: 68.9366 bits (167), Expect = 4.079e-11
Identity = 97/434 (22.35%), Postives = 189/434 (43.55%), Query Frame = 2
Query:  794 GAVIPLNII---IMKF----SRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRN--VSVGWCIMSV--LWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDS---NNSMPRKMSPGAP-IEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTV-------------QTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNN 2011
              V+P+ ++   + +F    SR+    + + +    S   E   G+ +I+ Y  +  F K  E   +  +K++    VS  W  M +  L +LV FF        F     +SL     + +S+    N+   +  L    S+  + +V+  R+  +   +E +N++    +  P    P A  I  ++    +  +    L+ +  ++++ + I +VGR G GKSSL + +   +   +G +                 ++  +PQ+  + + TLR N+   ++F+      VL+   L+  +  LP   + E+ E G NLS GQ+Q + LARA+ + S I +LD+  +AVD+     L    I  +    H T + + H L  +     + V+ D G+I E  +   L+     F S   ++  + ++ Q+ 
Sbjct: 1129 AVVVPMAVVYYFVQRFYVATSRQLRRLDSVSRSPIYSHFGETVSGLSVIRAYGHQDRFLKHNEHTIDQNLKSVYPWIVSNRWLAMRLESLGNLVVFFA-----ALFAVISRDSL-NSGLVGLSISYALNVTQTLNWLVRMTSELETNIVAVERVREY---AEIQNEAPWVTSVRPPDDWPSAGNIRFEDYKVRYRPELELVLHGVTCDIQSTEKIGIVGRTGAGKSSLTNCLFRIVEAADGRILIDDIDIATLGLHDLRSRLTIIPQDPVLFSGTLRMNLDPFQTFSDAEIWSVLELAHLKEYVRGLPTGLEHEVSEGGENLSLGQRQLLCLARALLRKSRILILDEATAAVDLET-DDLIQSTIRRE--FSHCTVLTIAHRLNTILDSSRVMVL-DSGKIVEFDSPNELLSKPGHFSSMAEDAGIRREEEQSQ 1549          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Match: abcc6b.2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 6b, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-110208-2])

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 471/1305 (36.09%), Postives = 753/1305 (57.70%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSE-----NSEKCLKYLKENLRSPNI-ESEIHDIEDKKCLIGKKNFNEEFK--YSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPG-APIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLM---DFGTEFKSF-LNESSDKVD-----KNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEK-YFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESI-NETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQA 3889
            P   +S LS++ + W  + + + ++  +K E  + L   +TS +       E   ++ K   +  ++ E++    +   C+  K+ F + FK   +G  + ++L +++ P    G +  + +D  ++     +  LL      + +  WKG L A   F      SL  +        + +RV+ A+ G++Y+K+L +++ AR   + G+IVN+ S D +++++ + Y       P +I L +  L+  LG S  AG+T +  + PLN  I K   K  E ++  KD+R+ ++ EI  G+KI+K YAWEK F +++   R  E+  ++   + + +    ++     + +  F  ++      ++  +KIFVS+ L N L+ P+  LP  +S  +  +VS  R+  FL   E + DS   +P   +P    + I NG+FSW++D  P L  IN+ V+   L+AVVG VG GKSSLLSA+LGEM   +G +   G + YVPQ+AWIQN TL++NIL         Y KVL+AC L  D+E LP RD TEIGE+G+NLSGGQKQRVSLARAVY++SDIYLLDDPLSAVD +VGQ +F K+I   G LK+KTRVLVTHGL +LP  D I V+ D G+I E G+Y  L+   +   E K+F ++E  +        K+ + L          R  L ++  Q  +   + + N ++     ++  ++  +GRV L   V YF+  G+      I       V     N WL + AD      +   N ++ +    +  YG +G  Q +A+         GG+ AS+++H  LL+ VL S + FF +TPSG +LNRF+K++  ID  +   +  ++     L+   +++ + TP+ G++ +P+ + Y  +Q FY+++S Q RRL+S + S + TH  ET  G+S+IR+   +  F       +D +      ++++ RWL + L+ LGNL+V  + I +V+ R +LS   VGL++S++LQVTGIL+W+ R   + E N VS+ER+++Y     E+     ++ +  +W  +G+I  + + LQY   L   LK I++++N  EK+G+VGRTGAGKSSLAL +FR++E   G+IFIDG+NI  IGLH+LR ++TI+PQDPV+FSG+L+ NLDPFD YTD+++ +SLE++ +  +V+ L + +N++C   G NLS+GQ+QLICLAR LL+K+KI++LDEATA+VD +TD  +   I+ QF   TV+ IAHRL TI+D  ++I +D G+I E  SP  L+S     ++   +A
Sbjct:  207 PVEDASFLSKLLFWWYGRLVVKGYRSPLKAEDLWSLREEDTSEKIICDLEKEWAKQWAKLQQKKSSLNEAQTLGFKLSSCV--KQLFRKLFKEQCTGFVLFRTLAKIFSPYFLTGTLFLVIQD-ALMFSIPQVLSLLLGYVRDEDAPLWKGYLFAFSLFLLSCLQSLFNHQYMYTCLTVGMRVKTAVMGLVYRKSLVINSAARKTCTVGEIVNLVSADTQKLVDFVMYFNALWLAPIEIALCLFFLWQHLGPSTLAGITTVILIFPLNGFIAKMRSKLQEVQMKHKDERIKLMNEILSGIKILKFYAWEKAFRERVLGYREKELNALKKSQILYSVSIASFNSSTLLIAFAMFGVYVLIDDKHVLDAQKIFVSMALINILKAPLSQLPIAMSTTMQVVVSLKRLGTFLDQDELKLDSVQRVP--YNPNIESVVINNGTFSWSKDSTPCLRRINVKVQRGSLVAVVGHVGSGKSSLLSAMLGEMEKKSGHITITGSVGYVPQQAWIQNATLKDNILFGCEKKDSLYQKVLEACALLPDLEILPARDATEIGEKGLNLSGGQKQRVSLARAVYRNSDIYLLDDPLSAVDAHVGQHIFEKVIGPNGSLKNKTRVLVTHGLSFLPQADLILVMAD-GEIKEMGSYAELLSRKNAFAELKAFSVSERKESATLKGTRKSVSFLSIKDFSTDLIRGDLGSASIQTMEAISDPKLNQDRDEVGRLTQADKAHTGRVKLEMYVEYFRTIGLAFIIPIIFLYAFQQVASLAYNYWLSLWAD------DPVINGTQVNTDLKLGVYGALGFAQGIAIFGTTVAISLGGIIASRQLHLDLLNNVLHSPMSFFESTPSGNLLNRFSKEIDAIDCMIPHGLKIMLGYVFKLLEVCIIVLMATPFAGVIILPLTLLYAFIQSFYVATSCQLRRLESVSRSPIYTHFNETVQGASVIRAFGEQPRFILQANCRVDLNQTSYFPRFVASRWLAVNLEFLGNLLVLAAAILSVMGRATLSPGTVGLAVSHSLQVTGILSWIVRSWTDVENNIVSVERVKEYAETAKEAPWTFEDSPLPSDWPRSGSIGFQAYGLQYRKGLDWALKEISLSVNEREKVGIVGRTGAGKSSLALGIFRILEAAKGKIFIDGINIAEIGLHELRSRITIIPQDPVLFSGSLRINLDPFDRYTDEEVWRSLELAHLKTFVSDLPDKLNHECSEGGENLSLGQRQLICLARALLRKTKILVLDEATAAVDLKTDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVMDRGNITEIDSPSNLISQHGQFYRMCREA 1499          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: septin9 (septin 9 [Source:Xenbase;Acc:XB-GENE-1012202])

HSP 1 Score: 843.188 bits (2177), Expect = 0.000e+0
Identity = 511/1347 (37.94%), Postives = 769/1347 (57.09%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKK-----NFNEEFKYSGKFVI------------KSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWK---GILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDIS-------------------------------------HEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFG---NVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES---INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE+ +  LS++T+ W  K     +K  ++D+  + LN  +TS+      +K           E E  ++   +    KK     N  +E  Y    +I            K L R + P    G   K+F+D+L    P +L +L+ ++KNKD    W     +LM L    Q L       YCF       +R+R+A+ G+IY+K+L ++  A+   + G++VN+ SVD ++  +  T+  +  S P QI LA+  L+  LG S+ AGV  +  +IP+N  I   +R F   ++ +KD R+ ++ EI +G+K++K+YAWE  F +K+ EIRN E+  ++  +    + +  W   PF V   TF  ++     +++  EK FVSL LFN L+ P+ +LP  +S    A VS  RI+NFL  +  E D N     K  PG  I + NG+FSW ++G   L NINL V +  L+AVVG+VG GKSSL+SA+LGEM    G V   G +AYVPQ+AWIQN TL++NIL  ++ N+  Y KVL+AC L  D+E LP  DQTEIGE+G+NLSGGQKQRVSLARAV+ ++D+YLLDDPLSAVD +V + +F+ +I   GLL+ KTRVLVTHG+ +LP VD I V+ D G+++E G+Y+ L+     F  FL   +   +  + ++  P            ++ +   D    A E  +K+   IS                                       E   +GRV +     Y KA G+ +   S+  C ++    A     NVWL          N    NQ++ + +  +  Y  +G+ Q L V+         G+ A++K+HS LLD  + +   F++ TP GRI+NRF+KD+++ID  +   I   +      +++++VI   TP F +V IP+ I YI +Q FY+++SRQ +RL+S + S + +H  ET +G+SIIR+   ++ F  +    +D++ K      +S RWL +R++ +GN +V  + +FAVL R  LS  LVGLS+SYALQVT  LNW+ R  ++ ETN V++ER+++Y     E+   I +T     E+W S G + L N+S++Y   L  VLKN+ + +NGGEK+G+VGRTGAGKSS+ L LFR++E   G + ID VNI+ IGL  LR +LTI+PQDPV+FSGTL+ NLDPF++Y+DD++ K+LE+S +  +V      + Y+C   G NLS+GQ+QL+CLAR LL+K++I+ILDEATA++D ETD  +   I+ QF   TV+ IAHRL TI+D  +++ LD G I EF +P  L++   G F  +A+
Sbjct:  208 PESDAGFLSRLTFWWFTKMAILGYKRPLEDKDLWSLNEDDTSNVVVTNLIK---------EWEKEKSNLAQMQVSYSKKPEAVLNHTDEKAYESDVLIVDNKKPKEPSFLKVLLRTFGPYFLIGSFFKLFQDLLSFVNPQLLSILITFIKNKDAPSWWGFCIAVLMFLTSLVQTLILHQHFQYCFVTG----MRLRSAITGIIYRKSLVITNSAKRSSTVGEVVNLMSVDAQRFQDLTTFLNMLWSAPLQICLALYFLWQALGPSVLAGVAVMVLLIPINAFIAMKTRAFQVEQMQYKDSRIKLMNEILNGIKVLKLYAWEPSFAQKVLEIRNKELNILKKAAYLNALSTFAWTSAPFLVALTTFAVYVTVDEKNILDAEKAFVSLSLFNILRFPLNMLPQVISNLAQASVSIKRIQNFL--ANDELDLNAVTKDKTLPGNAITVHNGTFSWAKNGGAILQNINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEVSVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVLVD-GRVTEMGSYQELLKQNGAFSEFLRNYAFDDEVEEEDITIPDEEEVLLAEETLSTHTDLADNEPVANEARKKFIRQISILSDGEPSHAMSTRRRFTEKKPSENLVAKQPPTEKLIQTETTETGRVKMTVFWQYMKAVGLAI---SVFICFLYSCQNAAAIGANVWLS------DWTNEPVINQTQQNTQMRVGVYAALGILQGLLVMTSSFSLAIAGIGAARKLHSALLDNKMHTPQSFYDTTPIGRIINRFSKDIYVIDEVIPGTILMFLATFFTSLSTMIVIVASTPLFAVVIIPLAIAYIFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGASIIRAYGRQNSFIVLSDNKVDENQKSYYPGIVSNRWLGVRVEFVGNCVVLFAALFAVLGREHLSPGLVGLSVSYALQVTMSLNWMVRMTSDLETNIVAVERVKEYAENETEAPWHIEDTKP--PEDWPSKGEVELSNYSVRYRAGLDLVLKNLNLKVNGGEKVGIVGRTGAGKSSMTLCLFRILEPAEGIVKIDNVNISEIGLQDLRSRLTIIPQDPVLFSGTLRMNLDPFNKYSDDEIWKALELSNLKKFVAGQPSQLEYECSEGGENLSVGQRQLVCLARALLRKTRILILDEATAAIDLETDDLIQMTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGRIAEFDTPTNLIA-LKGIFYGMAK 1526          

HSP 2 Score: 92.8189 bits (229), Expect = 3.380e-18
Identity = 78/299 (26.09%), Postives = 137/299 (45.82%), Query Frame = 2
Query: 3038 LNWLTRQCAEFETNAVSIERIRQYTMIPVESINETN-NYISENWVSNGN-INLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAI---KFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQA--DEYIKHED 3913
            LN L +  +     +VSI+RI+ +      + +E + N ++++    GN I + N +  +  N   +L+NI + +  G  + VVG+ G GKSSL  AL   +E   G + + G              +  +PQ   I + TLK N+       +    K LE   ++  +  L  G   + G  G NLS GQKQ + LAR +   + + +LD+  ++VD    + + + +          T +++ H +  +   D I+ L DG + E GS +ELL  +    + L     D+ ++ ED
Sbjct:  590 LNMLPQVISNLAQASVSIKRIQNFL-----ANDELDLNAVTKDKTLPGNAITVHNGTFSWAKNGGAILQNINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEVSVRG-------------SVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVLVDGRVTEMGSYQELLKQNGAFSEFLRNYAFDDEVEEED 870          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 833.558 bits (2152), Expect = 0.000e+0
Identity = 512/1315 (38.94%), Postives = 783/1315 (59.54%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSE-------------NSEKCLKYLKENLRSPNIESEI----HDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRL-----------------STSGSQGFDGNENAEENY-EKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISE-NWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHF 3871
            PE+ +S LSQIT+ W+ + + Q FK  ++ +  + LN  + S E             N  K  K   + + SP  +++      D+ ++   +  K   +E + S   ++K+L + + P  F     K F D+L+ + P +L+LL+ ++ +KD    W G L   L FF     +L  +  F I     +R++ A+ G++Y+K L ++  AR   + G+IVN+ SVD ++ M+  TY  +  S P Q+ILA  LL+  LG S+ AG+  +  ++P+N +I   ++K+   ++  KD R+ ++ EI +G+K++K+YAWE  F +K+  IR DE+K ++  +    + +  W   PF V   TF  ++     +++  EK FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E E +S    P+K S G+ I +++ +FSW+ +  P+L +IN+++    L+AVVG+VG GKSSLLSA+LGEM   +G V  +G + YV Q+AWIQN +L++N+L  +  N+  Y KV++AC L  D+E LP  D+TEIGE+GVNLSGGQKQRVSLARAVY ++DIYLLDDPLSAVD +VG+ +F+K+I  +G+LK+KTR+LVTHG+ +LP +D I V+ D G+I+E G+Y+ L+     F  FL   ++     + N  Q   P+ ++ SRL                 ++S ++  + N+  + N  EK    ++  ++  +GRV L     Y KA G+F+   SI   +   V     N WL +  D      +   N ++ +    ++ YG +G  Q +AV  +      GG+ AS+ +H+ LL  VLR  + FF  TPSG ++NRF+K++  ID+T+   I   +     +I + V+I   TP   ++  P+ + Y  +Q FY+++SRQ +RL+S + S V +H  ET  GSS+IR+   +  F  I    +D++ +      +S RWL +RL+ +GN IV  + +FAV++R +LS  LVGLS+SYALQVT  LNWL R  +E ETN V++ER+++Y  +  E+         E  W   G I    + L+Y  +L   LKNI + I GGEK+G+VGRTGAGKSSL L LFR+ E  +G I IDG N+  IGLH LR ++TI+PQDPV+FSGTL+ NLDPFD+YTDD +  SLE++ +  +V +L + +N++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ +F   TVI IAHRL TI+D  K+I LD G ++EF SP  LL      F
Sbjct:  203 PESSASFLSQITFWWISRMMVQGFKRPLEAKDLWSLNKEDKSLEVVPVLSKNWEKEYNKAKAKKVPLKMVYSPKKQTKKLNSKEDVREEAEALIVKPAPKELEPS---LLKALYKTFGPYFFISCFFKFFHDVLMFSGPQLLQLLIKFVGDKDAP-DWHGYLYTFLLFFCACLQTLILHKYFHICFVTGMRLKTAVVGLVYRKALVINNSARRTSTIGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILAFYLLWQNLGPSVLAGIAVMVLLVPVNAVIAMKTKKYQVVQMKCKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLGIRKDELKVLKKSAYLAAVGTFTWVCAPFLVALSTFAVYVLIDKQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELEPESIIREPQKSSEGS-INMKDATFSWSRNDLPSLKDINISIPEGSLVAVVGQVGCGKSSLLSALLGEMEKQDGYVAMKGSVGYVSQQAWIQNASLKDNVLFGRESNESMYKKVIEACALLPDLEILPTGDRTEIGEKGVNLSGGQKQRVSLARAVYCNTDIYLLDDPLSAVDAHVGKHIFDKVIGPKGMLKNKTRILVTHGVSYLPQMDSIIVMVD-GKITEVGSYQDLLMQDGAFAEFLRTYANA----EQNKDQEGKPSNQEESRLYLNRFHIHFLFNFRQLSASSETKSLNQNKTGDLNSSEKDDWKLTEADKAKTGRVKLAVFWEYMKAIGLFLCFLSIFLFMCNHVASLASNYWLSLWTD------DKVVNGTQQNTTMRLSVYGALGFSQGIAVYGYSTAVSLGGILASRFLHTDLLHNVLRFPMSFFERTPSGNLVNRFSKEIDTIDNTIPQIIKMFMGSLFNVIGACVIILTATPIVAVIIPPLGLVYFFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGSSVIRAFGEQKRFIQISDFKVDENQRAYYPSIVSNRWLAIRLEFVGNCIVLFASLFAVISRTTLSPGLVGLSVSYALQVTTYLNWLVRMSSELETNIVAVERVKEYADLKQEAAWTVQETAPEATWPHEGKIEFRGYGLRYREDLDLALKNINVTIQGGEKVGIVGRTGAGKSSLTLGLFRINEAAAGEIVIDGCNLAKIGLHDLRFRVTIIPQDPVLFSGTLRMNLDPFDKYTDDDIWTSLELAHLKRFVANLPDRLNHECAEGGENLSIGQRQLVCLARALLRKTKILVLDEATAAVDLETDGLIQSTIRKEFQDCTVITIAHRLNTIMDYTKVIVLDKGQVVEFDSPSNLLQQQGIFF 1501          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 833.173 bits (2151), Expect = 0.000e+0
Identity = 517/1312 (39.41%), Postives = 787/1312 (59.98%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETS-------SENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEE-----FKYSGK----FVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSA-PNKRKR-------------SRLSTSG-SQGFDGNENAEENY-EKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISE-NWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHF 3871
            PE+ +S LSQIT+ W+ + + Q FK  ++ +  + LN  + S       S+N EK  +Y K   +   ++      +  K L  K++  EE      K + K     ++K+L + + P  F     K F D+L+ + P +L+LL+ ++ +KD    W G L   L FF     +L  +  F I     +R++ A+ G++Y+K L ++  AR   + G+IVN+ SVD ++ M+  TY  +  S P Q+ILA  LL+  LG S+ AG+  +  ++P+N +I   ++K+   ++  KD R+ ++ EI +G+K++K+YAWE  F +K+  IR DE+K ++  +    + +  W   PF V   TF  ++     +++  EK FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E E +S    P+K S G+ I +++ +FSW+ +  P+L +IN+++    L+AVVG+VG GKSSLLSA+LGEM   +G V  +G + YV Q+AWIQN +L++N+L  +  N+  Y KV++AC L  D+E LP  D+TEIGE+GVNLSGGQKQRVSLARAVY ++DIYLLDDPLSAVD +VG+ +F+K+I  +G+LK+KTR+LVTHG+ +LP +D I V+ D G+I+E G+Y+ L+     F  FL   ++  ++N++    PS  P++ KR              +LS S  ++  + N+  + N  EK    ++  ++  +GRV L     Y KA G+F+   SI   +   V     N WL +  D      +   N ++ +    ++ YG +G  Q +AV  +      GG+ AS+ +H+ LL  VLR  + FF  TPSG ++NRF+K++  ID+T+   I   +     +I + V+I   TP   ++  P+ + Y  +Q FY+++SRQ +RL+S + S V +H  ET  GSS+IR+   +  F  I    +D++ +      +S RWL +RL+ +GN IV  + +FAV++R +LS  LVGLS+SYALQVT  LNWL R  +E ETN V++ER+++Y  +  E+         E  W   G I    + L+Y  +L   LKNI + I GGEK+G+VGRTGAGKSSL L LFR+ E  +G I IDG N+  IGLH LR ++TI+PQDPV+FSGTL+ NLDPFD+YTDD +  SLE++ +  +V +L + +N++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ +F   TVI IAHRL TI+D  K+I LD G ++EF SP  LL      F
Sbjct:  193 PESSASFLSQITFWWISRMMVQGFKRPLEAKDLWSLNKEDKSLEVVPVLSKNWEK--EYNKAKAKKVPLKMVYSPKKQTKKLNSKEDVREEAEALIVKPAPKELEPSLLKALYKTFGPYFFISCFFKFFHDVLMFSGPQLLQLLIKFVGDKDAP-DWHGYLYTFLLFFCACLQTLILHKYFHICFVTGMRLKTAVVGLVYRKALVINNSARRTSTIGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILAFYLLWQNLGPSVLAGIAVMVLLVPVNAVIAMKTKKYQVVQMKCKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLGIRKDELKVLKKSAYLAAVGTFTWVCAPFLVALSTFAVYVLIDKQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELEPESIIREPQKSSEGS-INMKDATFSWSRNDLPSLKDINISIPEGSLVAVVGQVGCGKSSLLSALLGEMEKQDGYVAMKGSVGYVSQQAWIQNASLKDNVLFGRESNESMYKKVIEACALLPDLEILPTGDRTEIGEKGVNLSGGQKQRVSLARAVYCNTDIYLLDDPLSAVDAHVGKHIFDKVIGPKGMLKNKTRILVTHGVSYLPQMDSIIVMVD-GKITEVGSYQDLLMQDGAFAEFLRTYAN-AEQNKDQEEAPSPVPSEEKRLENGILRNERNLQRQLSASSETKSLNQNKTGDLNSSEKDDWKLTEADKAKTGRVKLAVFWEYMKAIGLFLCFLSIFLFMCNHVASLASNYWLSLWTD------DKVVNGTQQNTTMRLSVYGALGFSQGIAVYGYSTAVSLGGILASRFLHTDLLHNVLRFPMSFFERTPSGNLVNRFSKEIDTIDNTIPQIIKMFMGSLFNVIGACVIILTATPIVAVIIPPLGLVYFFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGSSVIRAFGEQKRFIQISDFKVDENQRAYYPSIVSNRWLAIRLEFVGNCIVLFASLFAVISRTTLSPGLVGLSVSYALQVTTYLNWLVRMSSELETNIVAVERVKEYADLKQEAAWTVQETAPEATWPHEGKIEFRGYGLRYREDLDLALKNINVTIQGGEKVGIVGRTGAGKSSLTLGLFRINEAAAGEIVIDGCNLAKIGLHDLRFRVTIIPQDPVLFSGTLRMNLDPFDKYTDDDIWTSLELAHLKRFVANLPDRLNHECAEGGENLSIGQRQLVCLARALLRKTKILVLDEATAAVDLETDGLIQSTIRKEFQDCTVITIAHRLNTIMDYTKVIVLDKGQVVEFDSPSNLLQQQGIFF 1492          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: septin9 (septin 9 [Source:Xenbase;Acc:XB-GENE-1012202])

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 489/1238 (39.50%), Postives = 730/1238 (58.97%), Query Frame = 2
Query:  311 IKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWK---GILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDIS-------------------------------------HEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFG---NVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES---INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            +K L R + P    G   K+F+D+L    P +L +L+ ++KNKD    W     +LM L    Q L       YCF       +R+R+A+ G+IY+K+L ++  A+   + G++VN+ SVD ++  +  T+  +  S P QI LA+  L+  LG S+ AGV  +  +IP+N  I   +R F   ++ +KD R+ ++ EI +G+K++K+YAWE  F +K+ EIRN E+  ++  +    + +  W   PF V   TF  ++     +++  EK FVSL LFN L+ P+ +LP  +S    A VS  RI+NFL  +  E D N     K  PG  I + NG+FSW ++G   L NINL V +  L+AVVG+VG GKSSL+SA+LGEM    G V   G +AYVPQ+AWIQN TL++NIL  ++ N+  Y KVL+AC L  D+E LP  DQTEIGE+G+NLSGGQKQRVSLARAV+ ++D+YLLDDPLSAVD +V + +F+ +I   GLL+ KTRVLVTHG+ +LP VD I V+ D G+++E G+Y+ L+     F  FL   +   +  + ++  P            ++ +   D    A E  +K+   IS                                       E   +GRV +     Y KA G+ +   S+  C ++    A     NVWL          N    NQ++ + +  +  Y  +G+ Q L V+         G+ A++K+HS LLD  + +   F++ TP GRI+NRF+KD+++ID  +   I   +      +++++VI   TP F +V IP+ I YI +Q FY+++SRQ +RL+S + S + +H  ET +G+SIIR+   ++ F  +    +D++ K      +S RWL +R++ +GN +V  + +FAVL R  LS  LVGLS+SYALQVT  LNW+ R  ++ ETN V++ER+++Y     E+   I +T     E+W S G + L N+S++Y   L  VLKN+ + +NGGEK+G+VGRTGAGKSS+ L LFR++E   G + ID VNI+ IGL  LR +LTI+PQDPV+FSGTL+ NLDPF++Y+DD++ K+LE+S +  +V      + Y+C   G NLS+GQ+QL+CLAR LL+K++I+ILDEATA++D ETD  +   I+ QF   TV+ IAHRL TI+D  +++ LD G I EF +P  L++   G F  +A+
Sbjct:  309 LKVLLRTFGPYFLIGSFFKLFQDLLSFVNPQLLSILITFIKNKDAPSWWGFCIAVLMFLTSLVQTLILHQHFQYCFVTG----MRLRSAITGIIYRKSLVITNSAKRSSTVGEVVNLMSVDAQRFQDLTTFLNMLWSAPLQICLALYFLWQALGPSVLAGVAVMVLLIPINAFIAMKTRAFQVEQMQYKDSRIKLMNEILNGIKVLKLYAWEPSFAQKVLEIRNKELNILKKAAYLNALSTFAWTSAPFLVALTTFAVYVTVDEKNILDAEKAFVSLSLFNILRFPLNMLPQVISNLAQASVSIKRIQNFL--ANDELDLNAVTKDKTLPGNAITVHNGTFSWAKNGGAILQNINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEVSVRGSVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVLVD-GRVTEMGSYQELLKQNGAFSEFLRNYAFDDEVEEEDITIPDEEEVLLAEETLSTHTDLADNEPVANEARKKFIRQISILSDGEPSHAMSTRRRFTEKKPSENLVAKQPPTEKLIQTETTETGRVKMTVFWQYMKAVGLAI---SVFICFLYSCQNAAAIGANVWLS------DWTNEPVINQTQQNTQMRVGVYAALGILQGLLVMTSSFSLAIAGIGAARKLHSALLDNKMHTPQSFYDTTPIGRIINRFSKDIYVIDEVIPGTILMFLATFFTSLSTMIVIVASTPLFAVVIIPLAIAYIFVQRFYVATSRQLKRLESVSRSPIYSHFSETITGASIIRAYGRQNSFIVLSDNKVDENQKSYYPGIVSNRWLGVRVEFVGNCVVLFAALFAVLGREHLSPGLVGLSVSYALQVTMSLNWMVRMTSDLETNIVAVERVKEYAENETEAPWHIEDTKP--PEDWPSKGEVELSNYSVRYRAGLDLVLKNLNLKVNGGEKVGIVGRTGAGKSSMTLCLFRILEPAEGIVKIDNVNISEIGLQDLRSRLTIIPQDPVLFSGTLRMNLDPFNKYSDDEIWKALELSNLKKFVAGQPSQLEYECSEGGENLSVGQRQLVCLARALLRKTRILILDEATAAIDLETDDLIQMTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGRIAEFDTPTNLIA-LKGIFYGMAK 1527          

HSP 2 Score: 92.4337 bits (228), Expect = 4.286e-18
Identity = 78/299 (26.09%), Postives = 137/299 (45.82%), Query Frame = 2
Query: 3038 LNWLTRQCAEFETNAVSIERIRQYTMIPVESINETN-NYISENWVSNGN-INLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAI---KFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQA--DEYIKHED 3913
            LN L +  +     +VSI+RI+ +      + +E + N ++++    GN I + N +  +  N   +L+NI + +  G  + VVG+ G GKSSL  AL   +E   G + + G              +  +PQ   I + TLK N+       +    K LE   ++  +  L  G   + G  G NLS GQKQ + LAR +   + + +LD+  ++VD    + + + +          T +++ H +  +   D I+ L DG + E GS +ELL  +    + L     D+ ++ ED
Sbjct:  591 LNMLPQVISNLAQASVSIKRIQNFL-----ANDELDLNAVTKDKTLPGNAITVHNGTFSWAKNGGAILQNINLLVPSGSLVAVVGQVGCGKSSLVSALLGEMEKEEGEVSVRG-------------SVAYVPQQAWIQNCTLKDNILFGRAANEKNYKKVLEACALVTDLEVLPGGDQTEIGEKGINLSGGQKQRVSLARAVFSNADVYLLDDPLSAVDAHVAKHIFDNVIGPDGLLRGKTRVLVTHGISFLPQVDHIVVLVDGRVTEMGSYQELLKQNGAFSEFLRNYAFDDEVEEED 871          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Match: ABCC1 (ATP binding cassette subfamily C member 1 [Source:HGNC Symbol;Acc:HGNC:51])

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 515/1312 (39.25%), Postives = 784/1312 (59.76%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETS-------SENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEE-----FKYSGK----FVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSA-PNKRKR-------------SRLSTSG-SQGFDGNENAEENY-EKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISE-NWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHF 3871
            PE+ +S LSQIT+ W+ + + Q FK  ++ +  + LN  + S       S+N EK  +Y K   +   ++      +  K L  K++  EE      K + K     ++K+L + + P  F     K F D+L+ + P +L+LL+ ++ +KD    W G L   L FF     +L  +  F I     +R++ A+ G++Y+K L ++  AR   + G+IVN+ SVD ++ M+  TY  +  S P Q+ILA  LL+  LG S+ AG+  +  ++P+N +I   ++K+   ++  KD R+ ++ EI +G+K++K+YAWE  F +K+  IR DE+K ++  +    + +  W   PF V   TF  ++     +++  EK FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E E +S    P+K      I +++ +FSW+ +  P+L +IN+++    L+AVVG+VG GKSSLLSA+LGEM   +G V  +G + YV Q+AWIQN +L++N+L  +  N+  Y KV++AC L  D+E LP  D+TEIGE+GVNLSGGQKQRVSLARAVY ++DIYLLDDPLSAVD +VG+ +F+K+I  +G+LK+KTR+LVTHG+ +LP +D I V+ D G+I+E G+Y+ L+     F  FL   ++  ++N++    PS  P++ KR              +LS S  ++  + N+  + N  EK    ++  ++  +GRV L     Y KA G+F+   SI   +   V     N WL +  D      +   N ++ +    ++ YG +G  Q +AV  +      GG+ AS+ +H+ LL  VLR  + FF  TPSG ++NRF+K++  ID+T+   I   +     +I + V+I   TP   ++  P+ + Y  +Q FY+++SRQ +RL+S + S V +H  ET  GSS+IR+   +  F  I    +D++ +      +S RWL +RL+ +GN IV  + +FAV++R +LS  LVGLS+SYALQVT  LNWL R  +E ETN V++ER+++Y  +  E+         E  W   G I    + L+Y  +L   LKNI + I GGEK+G+VGRTGAGKSSL L LFR+ E  +G I IDG N+  IGLH LR ++TI+PQDPV+FSGTL+ NLDPFD+YTDD +  SLE++ +  +V +L + +N++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ +F   TVI IAHRL TI+D  K+I LD G ++EF SP  LL      F
Sbjct:  168 PESSASFLSQITFWWISRMMVQGFKRPLEAKDLWSLNKEDKSLEVVPVLSKNWEK--EYNKAKAKKVPLKMVYSPKKQTKKLNSKEDVREEAEALIVKPAPKELEPSLLKALYKTFGPYFFISCFFKFFHDVLMFSGPQLLQLLIKFVGDKDAP-DWHGYLYTFLLFFCACLQTLILHKYFHICFVTGMRLKTAVVGLVYRKALVINNSARRTSTIGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILAFYLLWQNLGPSVLAGIAVMVLLVPVNAVIAMKTKKYQVVQMKCKDNRIKLMNEILNGIKVLKLYAWELAFKEKVLGIRKDELKVLKKSAYLAAVGTFTWVCAPFLVALSTFAVYVLIDKQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELEPESIIREPQKTE--GSINMKDATFSWSRNDLPSLKDINISIPEGSLVAVVGQVGCGKSSLLSALLGEMEKQDGYVAMKGSVGYVSQQAWIQNASLKDNVLFGRESNESMYKKVIEACALLPDLEILPTGDRTEIGEKGVNLSGGQKQRVSLARAVYCNTDIYLLDDPLSAVDAHVGKHIFDKVIGPKGMLKNKTRILVTHGVSYLPQMDSIIVMVD-GKITEVGSYQDLLMQDGAFAEFLRTYAN-AEQNKDQEEAPSPVPSEEKRLENGILRNERNLQRQLSASSETKSLNQNKTGDLNSSEKDDWKLTEADKAKTGRVKLAVFWEYMKAIGLFLCFLSIFLFMCNHVASLASNYWLSLWTD------DKVVNGTQQNTTMRLSVYGALGFSQGIAVYGYSTAVSLGGILASRFLHTDLLHNVLRFPMSFFERTPSGNLVNRFSKEIDTIDNTIPQIIKMFMGSLFNVIGACVIILTATPIVAVIIPPLGLVYFFVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGSSVIRAFGEQKRFIQISDFKVDENQRAYYPSIVSNRWLAIRLEFVGNCIVLFASLFAVISRTTLSPGLVGLSVSYALQVTTYLNWLVRMSSELETNIVAVERVKEYADLKQEAAWTVQETAPEATWPHEGKIEFRGYGLRYREDLDLALKNINVTIQGGEKVGIVGRTGAGKSSLTLGLFRINEAAAGEIVIDGCNLAKIGLHDLRFRVTIIPQDPVLFSGTLRMNLDPFDKYTDDDIWTSLELAHLKRFVANLPDRLNHECAEGGENLSIGQRQLVCLARALLRKTKILVLDEATAAVDLETDGLIQSTIRKEFQDCTVITIAHRLNTIMDYTKVIVLDKGQVVEFDSPSNLLQQQGIFF 1466          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc1 (ATP-binding cassette, sub-family C (CFTR/MRP), member 1 [Source:MGI Symbol;Acc:MGI:102676])

HSP 1 Score: 829.706 bits (2142), Expect = 0.000e+0
Identity = 505/1330 (37.97%), Postives = 776/1330 (58.35%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSEN--------SEKCLKYLKENLR----------SPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL----NESSDKVDKN-------------QNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHE-------EEIMSGRVSLNSIVW-YFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES---INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE+ +S LS+IT+ W+   +   +++ ++    + LN  +TS E          ++C K  K+ +R           P   S++   E+ + LI K    +        + K L + + P     ++ K   D+++   P +L+L++N++ +++    W+G     L F      +L  +  F I     +R++ A+ G +Y+K L ++  AR   + G+IVN+ SVD ++ M+  TY  +  S P Q+ILA+  L+L LG S+ AGV  +  ++PLN ++   ++ +    +  KD R+ ++ EI +G+K++K+YAWE  F  K+  IR +E+K ++  +    + +  W   PF V   TF  F+     +++  +K FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E E DS      K   G  I ++N +F+W     PTLN I  ++    L+AVVG+VG GKSSLLSA+L EM  + G V  +G +AYVPQ+AWIQN++LR NIL      + +Y  V++AC L  D+E LP+ D+TEIGE+GVNLSGGQKQRVSLARAVY +SDIYL DDPLSAVD +VG+ +F K++   GLLK+KTR+LVTHG+ +LP VD I V++  G+ISE G+Y+ L+D    F  FL    N   D   ++             +N ++      K  +  LS S S   D ++      E        E       ++  +G+V L S+ W Y KA G+F+   SI   +   V     N WL +  D   ++N +  N++     F ++ YG +G+ Q  A+  +      GG+ AS+++H  LL  VLRS + FF  TPSG ++NRF+K+L  +D  +   I   +     +I ++++I + TP   ++  P+ + Y  +Q FY++SSRQ +RL+S + S V +H  ET  G S+IR+ E +  F       +D++ K      ++ RWL +RL+ +GN IV  + +FAV++R SLSA LVGLS+SY+LQ+T  LNWL R  +E ETN V++ER+++Y+    E+   I ET       W  +G +   ++ L+Y  +L  VLK+I + I GGEK+G+VGRTGAGKSSL L LFR+ E   G I IDGVNI  IGLH LR ++TI+PQDPV+FSG+L+ NLDPF +Y+D+++  +LE++ +  +V++L + +N++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF   TV+ IAHRL TI+D  ++I LD G + E G+P ELL    G F ++A+
Sbjct:  209 PESSASFLSRITFWWITGMMVHGYRQPLESSDLWSLNKEDTSEEVVPVLVNNWKKECDKSRKQPVRIVYAPPKDPSKPKGSSQLDVNEEVEALIVKSPHKDR----EPSLFKVLYKTFGPYFLMSFLYKALHDLMMFAGPKILELIINFVNDREAP-DWQGYFYTALLFVSACLQTLALHQYFHICFVSGMRIKTAVVGAVYRKALLITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYFLWLSLGPSVLAGVAVMILMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMSIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDERNILDAKKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRSIKSGEGNSITVKNATFTWARGEPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFGHPLQENYYKAVMEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNSDIYLFDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVMSG-GKISEMGSYQELLDRDGAFAEFLRTYANAEQDLASEDDSVSGSGKESKPVENGMLVTDTVGKHLQRHLSNSSSHSGDTSQQHSSIAELQKAGAKEETWKLMEADKAQTGQVQL-SVYWNYMKAIGLFITFLSIFLFLCNHVSALASNYWLSLWTDDPPVVNGTQANRN-----FRLSVYGALGILQGAAIFGYSMAVSIGGIFASRRLHLDLLYNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLVYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAP--PSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGVNIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEVRECGAPSELL-QQRGIFYSMAK 1523          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:MGI Symbol;Acc:MGI:1923658])

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 462/1188 (38.89%), Postives = 721/1188 (60.69%), Query Frame = 2
Query:  452 TWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQ-----------------------PSAPNKRKR--SRLSTSGSQGFDGNENAEENY------------EKYFNDISHEEEIMSGRVSLNSIVW-YFKATGIFVFGSSILACVIFGVLQAF---GNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES--INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            TW G L+A L F      +L  +  +     + +R+R A+ G+IY+K L ++   +   + G++VN+ SVD ++ M+   +  +  S P Q+ILAI  L+  LG S  AGV  I  +IPLN  +    + +  +++ FKD R+ +++EI +G+K++K+YAWE  F ++++ IR  E++ +R  +    I + +W   PF V  IT   ++Y   ++++  EK FVSL LFN L++P+ +LP  +S    A VS  RI++FL  ++ E D      + +SPG  I I NG+F+W +D  PTL+++N+ +    L+AVVG VG GKSSL+SA+LGEM  L G V  +G +AYVPQ+AWIQN TL+ N+L  +  N   Y + L+ C L  D++ LP  DQTEIGE+G+NLSGGQ+QRVSLARAVY D++I+LLDDPLSAVD +V + +F+++I  +G+L  KTRVLVTHG+ +LP  D I V+   GQ+SE G Y  L+     F +FL   +   D+  +  +Q                       P+    RK+    +S+  S+G   N    + +             K    +  EE   +G V L S+ W Y K+ G+    +++  C+++G   A     NVWL   +      N++  +  +N     +  Y  +G+ Q L V+L     + G ++A++ +H  LL   +RS   FF+ TPSGRILNRF+KD+++ID  L   I  ++N     I++++VI   TP F +V +P+ + Y  +Q FY+++SRQ +RL+S + S + +H  ET +G+S+IR+     DF+ +    +D + K       S RWL + ++ +GN +V  + +FAV+ R SL+  LVGLS+SYALQVT  LNW+ R  ++ E+N +++ER+++Y+    E+  + E+N    E W + G +   N+S++Y   L  VLKN+T+++ GGEK+G+VGRTGAGKSS+ L LFR++E   G I IDG+N+  IGLH LR QLTI+PQDP++FSGTL+ NLDPF  Y+++ + ++LE+S +  +V+S   G+++ C   G NLS+GQ+QL+CLAR LL+KS++++LDEATA++D ETD  +   I+ QF   TV+ IAHRL TI+D ++++ LD G + EF SP  L++ + G F  +A+
Sbjct:  345 TWWGFLLAGLMFLSSTMQTLILHQYYHCIFVMALRLRTAIIGVIYRKALVITNSVKRESTVGEMVNLMSVDAQRFMDVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVKQMKFKDSRIKLMSEILNGIKVLKLYAWEPSFLEQVKGIRQSELQLLRKGAYLQAISTFIWICTPFLVTLITLGVYVYVDESNVLDAEKAFVSLSLFNILKIPLNMLPQLISGLTQASVSLKRIQDFL--NQNELDPQCVERKTISPGYAITIHNGTFTWAQDLPPTLHSLNIQIPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGVVSVKGSVAYVPQQAWIQNCTLQENVLFGQPMNPKRYQQALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANIFLLDDPLSAVDSHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLAG-GQVSEMGHYSALLQHDGSFANFLRNYAPDEDQEDHEALQNANEEVLLLEDTLSTHTDLTDNEPAIYEVRKQFMREMSSLSSEGEVQNRTMPKKHTNSLEKEALVTKTKETGALIKEEIAETGNVKL-SVYWDYAKSMGL---CTTLSICLLYGGQSAAAIGANVWLSAWS------NDAEEHGQQNKTSVRLGVYAALGILQGLLVMLSAFTMVVGAIQAARLLHEALLHNKIRSPQSFFDTTPSGRILNRFSKDIYVIDEVLAPTILMLLNSFFTSISTIMVIVASTPLFMVVVLPLAVLYGFVQRFYVATSRQLKRLESISRSPIFSHFSETVTGTSVIRAYGRIQDFKVLSDTKVDNNQKSSYPYIASNRWLGVHVEFVGNCVVLFAALFAVIGRNSLNPGLVGLSVSYALQVTMALNWMIRMISDLESNIIAVERVKEYSKTKTEAPWVVESNR-APEGWPTRGMVEFRNYSVRYRPGLELVLKNVTVHVQGGEKVGIVGRTGAGKSSMTLCLFRILEAAEGEIVIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGRYSEEDIWRALELSHLNTFVSSQPAGLDFQCAEGGDNLSVGQRQLVCLARALLRKSRVLVLDEATAAIDLETDDLIQGTIRTQFEDCTVLTIAHRLNTIMDYNRVLVLDKGVVAEFDSPVNLIA-AGGIFYGMAK 1517          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:MGI Symbol;Acc:MGI:1923658])

HSP 1 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 463/1189 (38.94%), Postives = 723/1189 (60.81%), Query Frame = 2
Query:  452 TWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL-NESSDKVDKNQNNLIQ-----------------------PSAPNKRKR--SRLSTSGSQGFDGNENAEENY------------EKYFNDISHEEEIMSGRVSLNSIVW-YFKATGIFVFGSSILACVIFGVLQAF---GNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES--INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            TW G L+A L F      +L  +  +     + +R+R A+ G+IY+K L ++   +   + G++VN+ SVD ++ M+   +  +  S P Q+ILAI  L+  LG S  AGV  I  +IPLN  +    + +  +++ FKD R+ +++EI +G+K++K+YAWE  F ++++ IR  E++ +R  +    I + +W   PF V  IT   ++Y   ++++  EK FVSL LFN L++P+ +LP  +S    A VS  RI++FL  ++ E D      + +SPG  I I NG+F+W +D  PTL+++N+ +    L+AVVG VG GKSSL+SA+LGEM  L G V  +G +AYVPQ+AWIQN TL+ N+L  +  N   Y + L+ C L  D++ LP  DQTEIGE+G+NLSGGQ+QRVSLARAVY D++I+LLDDPLSAVD +V + +F+++I  +G+L  KTRVLVTHG+ +LP  D I V+   GQ+SE G Y  L+     F +FL N + D+  ++    +Q                       P+    RK+    +S+  S+G   N    + +             K    +  EE   +G V L S+ W Y K+ G+    +++  C+++G   A     NVWL   +      N++  +  +N     +  Y  +G+ Q L V+L     + G ++A++ +H  LL   +RS   FF+ TPSGRILNRF+KD+++ID  L   I  ++N     I++++VI   TP F +V +P+ + Y  +Q FY+++SRQ +RL+S + S + +H  ET +G+S+IR+     DF+ +    +D + K       S RWL + ++ +GN +V  + +FAV+ R SL+  LVGLS+SYALQVT  LNW+ R  ++ E+N +++ER+++Y+    E+  + E+N    E W + G +   N+S++Y   L  VLKN+T+++ GGEK+G+VGRTGAGKSS+ L LFR++E   G I IDG+N+  IGLH LR QLTI+PQDP++FSGTL+ NLDPF  Y+++ + ++LE+S +  +V+S   G+++ C   G NLS+GQ+QL+CLAR LL+KS++++LDEATA++D ETD  +   I+ QF   TV+ IAHRL TI+D ++++ LD G + EF SP  L++ + G F  +A+
Sbjct:  345 TWWGFLLAGLMFLSSTMQTLILHQYYHCIFVMALRLRTAIIGVIYRKALVITNSVKRESTVGEMVNLMSVDAQRFMDVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVIVLLIPLNGAVSMKMKTYQVKQMKFKDSRIKLMSEILNGIKVLKLYAWEPSFLEQVKGIRQSELQLLRKGAYLQAISTFIWICTPFLVTLITLGVYVYVDESNVLDAEKAFVSLSLFNILKIPLNMLPQLISGLTQASVSLKRIQDFL--NQNELDPQCVERKTISPGYAITIHNGTFTWAQDLPPTLHSLNIQIPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGVVSVKGSVAYVPQQAWIQNCTLQENVLFGQPMNPKRYQQALETCALLADLDVLPGGDQTEIGEKGINLSGGQRQRVSLARAVYSDANIFLLDDPLSAVDSHVAKHIFDQVIGPEGVLAGKTRVLVTHGISFLPQTDFIIVLAG-GQVSEMGHYSALLQHDGSFANFLRNYAPDEDQEDHEAALQNANEEVLLLEDTLSTHTDLTDNEPAIYEVRKQFMREMSSLSSEGEVQNRTMPKKHTNSLEKEALVTKTKETGALIKEEIAETGNVKL-SVYWDYAKSMGL---CTTLSICLLYGGQSAAAIGANVWLSAWS------NDAEEHGQQNKTSVRLGVYAALGILQGLLVMLSAFTMVVGAIQAARLLHEALLHNKIRSPQSFFDTTPSGRILNRFSKDIYVIDEVLAPTILMLLNSFFTSISTIMVIVASTPLFMVVVLPLAVLYGFVQRFYVATSRQLKRLESISRSPIFSHFSETVTGTSVIRAYGRIQDFKVLSDTKVDNNQKSSYPYIASNRWLGVHVEFVGNCVVLFAALFAVIGRNSLNPGLVGLSVSYALQVTMALNWMIRMISDLESNIIAVERVKEYSKTKTEAPWVVESNR-APEGWPTRGMVEFRNYSVRYRPGLELVLKNVTVHVQGGEKVGIVGRTGAGKSSMTLCLFRILEAAEGEIVIDGLNVAHIGLHDLRSQLTIIPQDPILFSGTLRMNLDPFGRYSEEDIWRALELSHLNTFVSSQPAGLDFQCAEGGDNLSVGQRQLVCLARALLRKSRVLVLDEATAAIDLETDDLIQGTIRTQFEDCTVLTIAHRLNTIMDYNRVLVLDKGVVAEFDSPVNLIA-AGGIFYGMAK 1518          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc2 (ATP-binding cassette, sub-family C (CFTR/MRP), member 2 [Source:MGI Symbol;Acc:MGI:1352447])

HSP 1 Score: 758.829 bits (1958), Expect = 0.000e+0
Identity = 513/1361 (37.69%), Postives = 784/1361 (57.60%), Query Frame = 2
Query:   26 TENPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNN---------------TETSSENSEKCLKYLKENLRSP--------NIESEIHDI---EDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKG----ILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSP-GAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMD----FGTEFKSFLNESSDKVDKNQNN----------LI--------QPSAPNKRKRSRLSTSGSQGFDGNENAEENYE-----KYFNDISHEEEIM------------SGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQ--AF--GNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            T  P   +S LS +T+ W D  + + +K  +  E  +D+                 T+   +  +   + LK++ +SP          +S+  D+   ED K    K    ++F  S  +++K+L + ++ +I   +ILK+  DIL+   P +LK L+ ++K+ D SY W G    ILM  +   Q  F      +CF +     + VR  +   +YKK L LS  AR  ++ G+ VN+ SVD +++M+   Y  +  S   QI L+I  L+ ELG SI AGV  +  ++P+N ++    RK   + +  KDKR+ I+ EI  G+KI+K +AWE  F +++  IR  E++N+   S    I+  +  L P  V  ITF+ ++     +++  EK F S+ LFN L+ P+ +LP  +S  I A VS  R+E +L      +D + S  R +      ++    SF+W  D   T+ ++NL+++  +L+AVVG VG GKSSL+SA+LGEM  ++G +  +G IAYVPQ+AWIQN T+++NIL    +++  Y +V++AC L  D+E LP  D  EIGE+G+NLSGGQK RVSLARA YQD+DIY+LDDPLSAVD +VG+ +FNK++   GLL  KTR+LVTHG+ +LP VDEI V+  +G I E+G+Y  LMD    F   +K+F+  S  + +   +N          LI          ++   R+ + L  + S+         ++ +     K  N ++ +EE++            +G+V  +  + Y +A G +    S+L  VIF VL   AF   N+WL          N +  + S+   +  I  +G +G+ Q + ++      I+    ASK +H  LL  +LR+ + FF+ TP+GRI+NRF  D+  +D TL   +   +     ++++LV+I + TP F I+ IP+ I Y+ +QVFY+++SRQ RRLDS   S + +H  ET SG  +IR+ E +  F +   + ID + K       S RWL +RL+++GNLIVF S +  V+ + SL+   VG  +S AL +T  LNWL R  +E ETN V++ERI +Y  +  E+   T+     +W   G I   N+ ++Y   L  VLK IT NI   EK+GVVGRTGAGKSSL   LFR++E   G+I IDG++I SIGLH LR +LTI+PQDP++FSG L+ NLDPF++Y+D+++ ++LE++ +  +V  L  G+ ++    G NLS+GQ+QL+CL R +L+KSKI++LDEATA+VD ETD  +   I+ +F   TVI IAHRL TI+D DKI+ LD G I+E+GSP+ELLSN  G F  +A+
Sbjct:  190 THAPSATASFLSSVTFSWYDSTVLKGYKHPLTIEDVWDIEENLKAKSLTSKFKTIMTKDLQKARQALQRRLKKSQQSPEGTSHGLTKKQSQSQDVLVLEDSKKKKKKSEATKDFPKS--WLVKALFKTFYVVILKSFILKLAHDILLFLNPQLLKFLIGFVKDPD-SYPWVGYIYAILMFSVTLIQSFFLQCYFQFCFVLG----MTVRTTIIASVYKKALTLSNLARRQYTIGETVNLMSVDSQKLMDVTNYIHLLWSSVLQIALSIFFLWRELGPSILAGVGLMVLLVPVNGVLATKIRKIQVQNMKNKDKRLKIMNEILSGIKILKYFAWEPSFKEQVNSIRKKELRNLLRFSQLQTILIFILHLTPTLVSVITFSVYVLVDSQNVLNAEKAFTSITLFNILRFPLAMLPMVISSVIQASVSVDRLEQYL----GSDDLDLSAIRHVCHFDKAVQFSEASFTWDRDLEATIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIAYVPQQAWIQNGTIKDNILFGSEYDEKKYQRVIEACALLPDLEMLPGGDMAEIGEKGINLSGGQKHRVSLARATYQDADIYILDDPLSAVDTHVGKHIFNKVVGPNGLLSGKTRILVTHGIHFLPQVDEIVVLG-KGTILEKGSYSDLMDKKGVFAKNWKTFMKHSGPEGEATVDNDSEEEDGDCGLIPTVEEIPDDAASLTMRRENSLRRTLSRSSRSGSRRGKSLKSSLKIKSVNALNKKEEVVKGQKLIKKEFVETGKVKFSIYLKYLQAVGWW----SLLFIVIFYVLNYVAFIGTNLWLSAWTSDSEKQNGTDNSPSQRDMR--IGVFGALGIAQGIFLLSSSLWSIYACRNASKTLHRQLLTNILRAPMSFFDTTPTGRIVNRFAGDISTVDDTLPQTLRSWLLCFFGIVSTLVMICMATPIFIIIIIPLSILYVSVQVFYVATSRQLRRLDSVTKSPIYSHFSETVSGLPVIRAFEHQQRFLANSEKQIDTNQKCVFSWITSNRWLAIRLELVGNLIVFCSALLLVIYKNSLTGDTVGFVLSNALNITQTLNWLVRMTSEVETNIVAVERINEYINVDNEAPWVTDKKPPADWPKKGEIQFNNYQVRYRPELDLVLKGITCNIKSTEKVGVVGRTGAGKSSLTNCLFRILESAGGQIIIDGIDIASIGLHDLRGRLTIIPQDPILFSGNLRMNLDPFNKYSDEEIWRALELAHLKSFVAGLQLGLLHEVTEGGDNLSIGQRQLLCLGRAVLRKSKILVLDEATAAVDLETDSLIQTTIRNEFSQCTVITIAHRLHTIMDSDKIMVLDSGKIVEYGSPEELLSN-MGPFYLMAK 1531          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Match: Abcc6 (ATP-binding cassette, sub-family C (CFTR/MRP), member 6 [Source:MGI Symbol;Acc:MGI:1351634])

HSP 1 Score: 648.662 bits (1672), Expect = 0.000e+0
Identity = 402/1169 (34.39%), Postives = 638/1169 (54.58%), Query Frame = 2
Query:  446 SYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYS--------WIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQ-------NNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFND------ISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISEN-WVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            S  W G L+A+L F      +L E         + +R+R A+ G++Y+K L LS+ +R   +AGD+VN+ SVD++++  +I Y         WIF+   +        L+  LG S    V    +++PLN  I K      E ++  K  R  + + +   ++ IK + WE  F +++  IR  E+  ++  ++ + +  V + +  F V  + F        ++ +  EK FV+L + + L      LP+ +   + A VSF R+  FL   E + +   +   + S    I + NG+F+W+++  P L+ INL V    L+AVVG VG GKSSLLSA+LGE+  + G+V  EG +AYVPQEAW+QN ++  N+   +  +  +  KVLDAC L  D+ S P    T IGE+G+NLSGGQKQR+SLARAVY+ + IYLLDDPL+A+D +V Q +F ++I   GLL+  TR+LVTH L  LP  D I V+ + G I+E G+Y+ L+         L+ +      +                P  R   R   + +    G   +E   E   +D       + E+ +  GRV     + Y +A G  +   ++   +   V       WL + AD      +   +  +  A      +G++G  Q + +         GG RAS  +   LL  V RS + FF  TP G +LNRF+K+   +D  +   +  ++     L+   + +++ TP   +  +P+++ Y   Q  Y+++S Q RRL+S   S V +H+ ET+ GS ++R+  A++ F +     +D++ +    + ++ RWL   L++LGN +VF +   AVL++  LSA LVG S+S ALQVT  L W+ R   + E + V++ER++ Y  IP E+        ++  W   G I   +F L++   LP  ++ +++ I+ GEK+G+VGRTGAGKSSLA  L RL E   G I+IDGV I  +GLH LR ++TI+PQDPV+F G+L+ NLD   E+TD+ +  +LE   +  +V SL   + Y+C   G +LS+GQKQL+CLAR LL+K++I+ILDEATASVD  T+ ++  A++  F   TV++IAHRL++++DC +++ +D+G + E GSP +LL+   G F  LA 
Sbjct:  342 SSAWTGWLLAVLMFAAACLQTLFEQQHMYRAKVLQMRLRTAITGLVYRKVLVLSSGSRKSSAAGDVVNLVSVDIQRLAESIIYLNGLWLLFLWIFVCFVY--------LWQLLGPSALTAVAVFLSLLPLNFFITKKRGFHQEEQMRQKASRARLTSSMLRTVRTIKSHGWEHAFLERLLHIRGQELSALKTSTLLFSVSLVSFQVSTFLVALVVFAVHTLVAEDNAMDAEKAFVTLTVLSILNKAQAFLPFSVHCIVQARVSFDRLAAFLCLEEVDPNGMIASNSRRSSKDRISVHNGTFAWSQESPPCLHGINLTVPQGCLLAVVGPVGAGKSSLLSALLGELLKVEGSVSIEGSVAYVPQEAWVQNTSVVENVCFRQELDLPWLQKVLDACALGSDVASFPAGVHTPIGEQGMNLSGGQKQRLSLARAVYKKAAIYLLDDPLAALDAHVSQQVFKQVIGPSGLLQGTTRILVTHTLHVLPQADRILVLAN-GTIAEMGSYQDLLQRNGALVGLLDGARQPAGTHDAATSDDLGGFPGGGRPTCRP-DRPRPTEAAPVKGRSTSEVQMEASLDDPEATGLTAEEDSVRYGRVKTTIYLSYLRAVGTPLCTYTLFLFLCQQVASFSQGYWLSLWAD------DPVVDGRQMHAALRGWVFGLLGCLQAIGLFASMAAVFLGGARASGLLFRSLLWDVARSPIGFFERTPVGNLLNRFSKETDTVDVDIPDKLRSLLTYAFGLLEVGLAVTMATPLAIVAILPLMVLYAGFQSLYVATSCQLRRLESARYSSVCSHMAETFQGSLVVRAFRAQASFTAQHDALMDENQRVSFPKLVADRWLATNLELLGNGLVFVAATCAVLSKAHLSAGLVGFSVSAALQVTQTLQWVVRSWTDLENSMVAVERVQDYARIPKEAPWRLPTCAAQPLWPCGGQIEFRDFGLRHRPELPLAVQGVSLKIHAGEKVGIVGRTGAGKSSLAWGLLRLQEAAEGNIWIDGVPITHVGLHTLRSRITIIPQDPVLFPGSLRMNLDLLQEHTDEGIWAALETVQLKAFVTSLPGQLQYECAGQGDDLSVGQKQLLCLARALLRKTQILILDEATASVDPGTEMQMQAALERWFTQCTVLLIAHRLRSVMDCARVLVMDEGQVAESGSPAQLLAQ-KGLFYRLAH 1493          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q8CG09|MRP1_RAT (Multidrug resistance-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Abcc1 PE=1 SV=2)

HSP 1 Score: 834.328 bits (2154), Expect = 0.000e+0
Identity = 511/1334 (38.31%), Postives = 784/1334 (58.77%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSEN--------SEKCLKYLKENLR----------SPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGA-PIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNE--------SSDKVDKN------------QNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHE-------EEIMSGRVSLNSIVW-YFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES---INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE+ +S LS+IT+ W+   + Q +++ +K    + LN  +TS E          ++C+K  K+ +R           P   S++   E+ + LI K +  +        + K L + + P     ++ K   D+++   P +L+L++N++ +++    W+G L   L F      +L  +  F I     +R++ A+ G +Y+K L ++  AR   + G+IVN+ SVD ++ M+  TY  +  S P Q+ LA+  L+L LG S+ AGV  +  ++P N ++   ++ +    +  KD R+ ++ EI +G+K++K+YAWE  F  K+  IR +E+K ++  +    + +  W   PF V   TF  F+     +++  +K FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E E DS      K   G   I ++N +F+W  D  PTLN I   + +  L+AVVG+VG GKSSLLSA+L EM  + G V  +G +AYVPQ+AWIQN++LR NIL  +   +  Y  V++AC L  D+E LP+ D TEIGE+GVNLSGGQKQRVSLARAVY +SDIYLLDDPLSAVD +VG+ +F K++   GLLK+KTR+LVTHG+ +LP VD I V++  G+ISE G+Y+ L+D    F  F+          +S+   KN            +N ++   A  K  +  LS S S     N+      E   + +  E       ++  +G+V L S+ W Y KA G+ +   SI   +   V     N WL +  D +  +N +   ++RN   F ++ YG +G+ Q +AV  +      GG+ AS+++H  LL  VLRS + FF  TPSG ++NRF+K+L  +D  +   I   +     +I ++++I + TP   ++  P+ + Y  +Q FY++SSRQ +RL+S + S V +H  ET  G S+IR+ E +  F       +D++ K      ++ RWL +RL+ +GN IV  + +FAV++R SLSA LVGLS+SY+LQ+T  LNWL R  +E ETN V++ER+++Y+    E+   I ET       W  +G +   ++ L+Y  +L  VLK+I + I GGEK+G+VGRTGAGKSSL L LFR+ E   G I IDG+NI  IGLH LR ++TI+PQDPV+FSG+L+ NLDPF +Y+D+++  +LE++ +  +V++L + +N++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF  STV+ IAHRL TI+D  ++I LD G I E G+P ELL    G F ++A+
Sbjct:  209 PESSASFLSRITFWWITGMMVQGYRQPLKSSDLWSLNKEDTSEEVVPVLVNNWKKECVKSRKQPVRIVYAPPKDPTKPKGSSQLDVNEEVEALIVKSSHKDR----DPSLFKVLYKTFGPYFLMSFLYKALHDLMMFAGPEILELIINFVNDREAP-DWQGYLYTALLFVSACLQTLALHQYFHICFVTGMRIKTAVVGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVTLALYFLWLNLGPSVLAGVAVMILMVPFNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMNIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDEKNILDAKKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERWSIKDGGGMNSITVKNATFTWARDEPPTLNGITFAIPDGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFGRPLQEHCYKAVMEACALLPDLEILPSGDLTEIGEKGVNLSGGQKQRVSLARAVYCNSDIYLLDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVMSG-GKISEMGSYQELLDRDGAFAEFVRTYANTEQDLASEDDSKNGVSGLGKESKPVENGILVTDAVGKPLQRHLSNSSSHSVVTNQQHSSTAELQKSGVKEETWKLMEADKAQTGQVKL-SVYWNYMKAIGLCISFLSIFLFLCNHVSALASNYWLSLWTDDRPAVNGT--QENRN---FRLSVYGALGILQGVAVFGYSMAVSIGGIFASRRLHLDLLQNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLVYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIRQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVERLKEYSETEKEASWQIQETAP--PSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDSTVLTIAHRLNTIMDYTRVIVLDKGEIRECGAPSELL-QQRGVFYSMAK 1527          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|O35379|MRP1_MOUSE (Multidrug resistance-associated protein 1 OS=Mus musculus OX=10090 GN=Abcc1 PE=1 SV=1)

HSP 1 Score: 829.706 bits (2142), Expect = 0.000e+0
Identity = 505/1330 (37.97%), Postives = 776/1330 (58.35%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSEN--------SEKCLKYLKENLR----------SPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL----NESSDKVDKN-------------QNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHE-------EEIMSGRVSLNSIVW-YFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES---INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE+ +S LS+IT+ W+   +   +++ ++    + LN  +TS E          ++C K  K+ +R           P   S++   E+ + LI K    +        + K L + + P     ++ K   D+++   P +L+L++N++ +++    W+G     L F      +L  +  F I     +R++ A+ G +Y+K L ++  AR   + G+IVN+ SVD ++ M+  TY  +  S P Q+ILA+  L+L LG S+ AGV  +  ++PLN ++   ++ +    +  KD R+ ++ EI +G+K++K+YAWE  F  K+  IR +E+K ++  +    + +  W   PF V   TF  F+     +++  +K FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E E DS      K   G  I ++N +F+W     PTLN I  ++    L+AVVG+VG GKSSLLSA+L EM  + G V  +G +AYVPQ+AWIQN++LR NIL      + +Y  V++AC L  D+E LP+ D+TEIGE+GVNLSGGQKQRVSLARAVY +SDIYL DDPLSAVD +VG+ +F K++   GLLK+KTR+LVTHG+ +LP VD I V++  G+ISE G+Y+ L+D    F  FL    N   D   ++             +N ++      K  +  LS S S   D ++      E        E       ++  +G+V L S+ W Y KA G+F+   SI   +   V     N WL +  D   ++N +  N++     F ++ YG +G+ Q  A+  +      GG+ AS+++H  LL  VLRS + FF  TPSG ++NRF+K+L  +D  +   I   +     +I ++++I + TP   ++  P+ + Y  +Q FY++SSRQ +RL+S + S V +H  ET  G S+IR+ E +  F       +D++ K      ++ RWL +RL+ +GN IV  + +FAV++R SLSA LVGLS+SY+LQ+T  LNWL R  +E ETN V++ER+++Y+    E+   I ET       W  +G +   ++ L+Y  +L  VLK+I + I GGEK+G+VGRTGAGKSSL L LFR+ E   G I IDGVNI  IGLH LR ++TI+PQDPV+FSG+L+ NLDPF +Y+D+++  +LE++ +  +V++L + +N++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF   TV+ IAHRL TI+D  ++I LD G + E G+P ELL    G F ++A+
Sbjct:  209 PESSASFLSRITFWWITGMMVHGYRQPLESSDLWSLNKEDTSEEVVPVLVNNWKKECDKSRKQPVRIVYAPPKDPSKPKGSSQLDVNEEVEALIVKSPHKDR----EPSLFKVLYKTFGPYFLMSFLYKALHDLMMFAGPKILELIINFVNDREAP-DWQGYFYTALLFVSACLQTLALHQYFHICFVSGMRIKTAVVGAVYRKALLITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYFLWLSLGPSVLAGVAVMILMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFQDKVMSIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVFVTVDERNILDAKKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRSIKSGEGNSITVKNATFTWARGEPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVTLKGSVAYVPQQAWIQNDSLRENILFGHPLQENYYKAVMEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNSDIYLFDDPLSAVDAHVGKHIFEKVVGPMGLLKNKTRILVTHGISYLPQVDVIIVMSG-GKISEMGSYQELLDRDGAFAEFLRTYANAEQDLASEDDSVSGSGKESKPVENGMLVTDTVGKHLQRHLSNSSSHSGDTSQQHSSIAELQKAGAKEETWKLMEADKAQTGQVQL-SVYWNYMKAIGLFITFLSIFLFLCNHVSALASNYWLSLWTDDPPVVNGTQANRN-----FRLSVYGALGILQGAAIFGYSMAVSIGGIFASRRLHLDLLYNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFSVIGAVIIILLATPIAAVIIPPLGLVYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQITAYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAP--PSTWPHSGRVEFRDYCLRYREDLDLVLKHINVTIEGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGVNIAKIGLHNLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWMALELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEVRECGAPSELL-QQRGIFYSMAK 1523          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|P33527|MRP1_HUMAN (Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3)

HSP 1 Score: 822.387 bits (2123), Expect = 0.000e+0
Identity = 505/1339 (37.71%), Postives = 778/1339 (58.10%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSEN--------SEKCLKYLKENLR---------SPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGA-PIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLN---ESSDKVDKNQNNLIQPSAPNKRKR------------------------------SRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVW-YFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES---INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE+ +S LS+IT+ W+   I + +++ ++    + LN  +TS +          ++C K  K+ ++          P   S++   E+ + LI K    +E+  S   + K L + + P     +  K   D+++ + P +LKLL+ ++ +      W+G    +L F      +L  +  F I     +R++ A+ G +Y+K L ++  AR   + G+IVN+ SVD ++ M+  TY  +  S P Q+ILA+ LL+L LG S+ AGV  +  ++P+N ++   ++ +    +  KD R+ ++ EI +G+K++K+YAWE  F  K+  IR +E+K ++  +    + +  W   PF V   TF  ++    N+++  +  FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E E DS    P K   G   I ++N +F+W     PTLN I  ++    L+AVVG+VG GKSSLLSA+L EM  + G V  +G +AYVPQ+AWIQN++LR NIL      + +Y  V+ AC L  D+E LP+ D+TEIGE+GVNLSGGQKQRVSLARAVY ++DIYL DDPLSAVD +VG+ +F  +I  +G+LK+KTR+LVTH + +LP VD I V++  G+ISE G+Y+ L+     F  FL     +  + D  +N +   S P K  +                              SR   S ++        EE ++     +   ++  +G+V L S+ W Y KA G+F+   SI   +   V     N WL +  D      +   N ++   K  ++ YG +G+ Q +AV  +      GG+ AS+ +H  LL ++LRS + FF  TPSG ++NRF+K+L  +D  +   I   +     +I + +VI + TP   I+  P+ + Y  +Q FY++SSRQ +RL+S + S V +H  ET  G S+IR+ E +  F       +D++ K      ++ RWL +RL+ +GN IV  + +FAV++R SLSA LVGLS+SY+LQVT  LNWL R  +E ETN V++ER+++Y+    E+   I ET      +W   G +   N+ L+Y  +L  VL++I + INGGEK+G+VGRTGAGKSSL L LFR+ E   G I IDG+NI  IGLH LR ++TI+PQDPV+FSG+L+ NLDPF +Y+D+++  SLE++ + D+V++L + ++++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF   TV+ IAHRL TI+D  ++I LD G I E+G+P +LL    G F ++A+
Sbjct:  209 PESSASFLSRITFWWITGLIVRGYRQPLEGSDLWSLNKEDTSEQVVPVLVKNWKKECAKTRKQPVKVVYSSKDPAQPKESSKVDANEEVEALIVKSP-QKEWNPS---LFKVLYKTFGPYFLMSFFFKAIHDLMMFSGPQILKLLIKFVNDTKAP-DWQGYFYTVLLFVTACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMVLMVPVNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLSAVGTFTWVCTPFLVALCTFAVYVTIDENNILDAQTAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGTNSITVRNATFTWARSDPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVDVIIVMSG-GKISEMGSYQELLARDGAFAEFLRTYASTEQEQDAEENGVTGVSGPGKEAKQMENGMLVTDSAGKQLQRQLSSSSSYSGDISRHHNSTAELQKAEAKKEETWK-----LMEADKAQTGQVKL-SVYWDYMKAIGLFISFLSIFLFMCNHVSALASNYWLSLWTD------DPIVNGTQEHTKVRLSVYGALGISQGIAVFGYSMAVSIGGILASRCLHVDLLHSILRSPMSFFERTPSGNLVNRFSKELDTVDSMIPEVIKMFMGSLFNVIGACIVILLATPIAAIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIHQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYSETEKEAPWQIQETAP--PSSWPQVGRVEFRNYCLRYREDLDFVLRHINVTINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDGINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSALPDKLDHECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEYGAPSDLL-QQRGLFYSMAK 1526          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q6UR05|MRP1_CANLF (Multidrug resistance-associated protein 1 OS=Canis lupus familiaris OX=9615 GN=ABCC1 PE=1 SV=1)

HSP 1 Score: 822.002 bits (2122), Expect = 0.000e+0
Identity = 510/1336 (38.17%), Postives = 775/1336 (58.01%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETS-----------------SENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGA-PIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLN----------ESSD----------KVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEE--------EIMSGRVSLNSIVW-YFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISE-----NWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE+ +S LS++T+ W+   + + +++ ++    + LN  +TS                 S+  ++ + Y  ++   P   S++   E+ + LI K    E        + K L + + P     ++ K   D+++   P +LKLL+N++ +K     W+G L   L F      +L  +  F I     +R++ A+ G +Y+K L ++  AR   + G+IVN+ SVD ++ M+  TY  +  S P Q+ILA+ LL+L LG S+ AGV  +  ++PLN ++   ++ +    +  KD R+ ++ EI +G+K++K+YAWE  F  K+  IR +E+K ++  +    + +  W   PF V   TF  ++    N+++  +K FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E E DS    P K   GA  I ++N +F+W     PTL+ I  ++    L+AVVG+VG GKSSLLSA+L EM  + G V  +G +AYVPQ+AWIQN++LR NIL  +   + +Y  V++AC L  D+E LP+ D+TEIGE+GVNLSGGQKQRVSLARAVY DSDIYL DDPLSAVD +VG+ +F  +I  +G+LK+KTR+LVTH + +LP VD I V+   G+ISE G+Y+ L+     F  FL           E  D          +V + +N ++      K+ + +LS S S   D + +     E       +E+        +  +G+V L S+ W Y KA G+F+   SI   +   V     N WL +  D      +   N ++   K  ++ YG +G+ Q + V  +      GG+ AS+++H  LL  VLRS + FF  TPSG ++NRF+K+L  +D  +   I   +     +I + ++I + TP   I+  P+ + Y  +Q FY++SSRQ +RL+S + S V +H  ET  G S+IR+ E +  F       +D++ K      ++ RWL +RL+ +GN IV  + +F+V++R SLSA LVGLS+SY+LQVT  LNWL R  +E ETN V++ER+++Y+    E+  E    I E      W   G +   ++ L+Y  NL  VLK+I I INGGEK+G+VGRTGAGKSSL L LFR+ E   G I ID +NI  IGLH LR ++TI+PQDPV+FSG+L+ NLDPF +Y+D+++  SLE++ + D+V+ L + +N +C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF   TV+ IAHRL TI+D  ++I LD G I E G P +LL    G F ++A+
Sbjct:  209 PESSASFLSRVTFWWITGLMVRGYRQPLESTDLWSLNKEDTSEQVVPVLVKNWKKECAKSKRQQRKITYSSKDPAKPKGGSQVDVNEEAEVLIVKTPQKER----EPSLFKVLYKTFGPYFLMSFLFKALHDLMMFAGPEILKLLINFVNDKKAP-DWQGYLYTALLFICACLQTLVLHQYFHICFVSGMRIKTAVIGAVYRKALVITNSARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMILMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAYLAAVGTFTWVCTPFLVALSTFAVYVTVDKNNILDAQKAFVSLALFNILRFPLNILPMVISSIVQASVSLKRLRIFLSHEELEPDSIERRPVKDGGGANSITVKNATFTWARSDPPTLSGITFSIPEGSLVAVVGQVGCGKSSLLSALLAEMDKVEGHVAIKGSVAYVPQQAWIQNDSLRENILFGRQLQERYYKAVIEACALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYCDSDIYLFDDPLSAVDAHVGKHIFENVIGPKGMLKNKTRLLVTHSISYLPQVDVIIVMTG-GKISEMGSYQELLARDGAFAEFLRTYASGDQEQAEQDDGLTGVSSPGKEVKQMENGMLVTDVAGKQLQRQLSNSSSYSGDVSRHHTSTAELQKAGPKNEDAWKLVEADKAQTGQVKL-SVYWDYMKAIGLFISFLSIFLFLCNHVASLVSNYWLSLWTD------DPIVNGTQEHTKIRLSVYGALGISQGITVFGYSMAVSIGGIFASRRLHVDLLQNVLRSPMSFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFNVIGACIIILLATPIASIIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIRQSDLKVDENQKAYYPSIVANRWLAVRLECVGNCIVLFAALFSVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSEMETNIVAVERLKEYS----ETEKEAPWQIQEMAPPSTWPQVGRVEFRDYGLRYRENLDLVLKHINITINGGEKVGIVGRTGAGKSSLTLGLFRINESAEGEIIIDDINIAKIGLHDLRVKITIIPQDPVLFSGSLRMNLDPFSQYSDEEVWTSLELAHLKDFVSGLPDKLNQECAEGGENLSVGQRQLVCLARALLRKTKILVLDEATAAVDLETDDLIQSTIRTQFDDCTVLTIAHRLNTIMDYTRVIVLDKGEIRECGQPSDLL-QQRGLFYSMAK 1526          
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q5F364|MRP1_CHICK (Multidrug resistance-associated protein 1 OS=Gallus gallus OX=9031 GN=ABCC1 PE=2 SV=1)

HSP 1 Score: 819.691 bits (2116), Expect = 0.000e+0
Identity = 512/1330 (38.50%), Postives = 781/1330 (58.72%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSE---------------NSEKCLKYL---KENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLN---------ESSDKVDKN-------QNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEEN---------YEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVE---SINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE  +S LS+IT+ W+   + Q  +  ++ +  + LN  +TS E                  + L  L   K+  +S +   E+  +E+ + LI K +     + S   + K L + + P     ++ K   D+L+ T P +LKLL+N++ NK     W+G     L F      +L  +  F I     +R++ A+ G+IY+K L ++  AR   + G+IVN+ SVD ++ M+  TY  +  S P Q+ILA+ LL+  LG S+ AGV  +  ++P+N ++   ++ +   ++  KD R+ ++ EI +G+K++K+YAWE  F +K+ EIR  E+K ++  +    + +  W   PF V   TF  ++    N+++  +K FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E + DS    P   + G+ I ++N +FSW++   P+LN+IN  V    LIAVVG+VG GKSSLLSA+LGEM    G V  +G IAYVPQ+AWIQN TL +NI+  +  N+  Y +V++AC L  D+E LP  D+TEIGE+GVNLSGGQKQRVSLARAVY ++D YL DDPLSAVD +VG+ +F K+I  +G+LK+KTRVLVTH + +LP +D I V+ D G+ISE G+Y+ L+     F  FL          ESSD    +       +N ++   A  K    +LS S +   +  ++  ++          EK    ++  +   +GRV       Y KA G+++   S+   +   +     N WL +  D      +   N ++      +  YG +G+ Q +AV  +      GG+ AS+ +H  LL  VLRS + FF  TPSG +++RF+K++  ID T+   I   +  T  +I + ++I + TP   +V  P+ + Y+L+Q FY+++SRQ +RL+S + S V +H  ET  G S+IR+ E +  F       +D++ K      ++ RWL +RL+ +GN IV  + +FAV+ R  LS  L+GLS+SY+LQ+T  LNWL R  ++ ETN V++ER+++Y  +  E   SI ET    +  W   G +    F L+Y  +L  VLKNI I INGGEK+G+VGRTGAGKSSL L LFR+ E   G I IDG+NI  IGLH LR ++TI+PQDP++FSG+L+ NLDPFD+++D+ + +SLE++ + ++V+SL + +N++C   G NLS+GQ+QL+CLAR LL+KSKI++LDEATA+VD ETD  +   IK QF   TV+ IAHRL TI+D  +++ LD G ++E  SP  LL  + G F ++A+
Sbjct:  209 PEFSASFLSRITFWWITGLMIQGHRRPLEAKDLWSLNKEDTSEEIVPGLAKNWAKEWAKTKRQPLNMLYSSKKQQKSSDSNGEV--MEEAEALIIKPSQ----RSSEASLSKVLYKTFGPYFLMSFLFKAAHDLLMFTGPEILKLLINFVNNKSAP-NWQGYFYTGLLFVCACLQTLILHQYFHICFVTGMRLKTAIVGVIYRKALVITNSARKTSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWRNLGPSVLAGVAVMILLVPINAVMAMKTKTYQVAQMKSKDNRIKLMNEILNGIKVLKLYAWELAFREKVLEIRQKELKVLKKSAYLAAMGTFTWVCAPFLVALSTFAVYVKVNKNNILDAQKAFVSLALFNILRFPLNILPMVISSIVEASVSLKRLRVFLSHEELDPDSIIRGPITNAEGS-IVVKNATFSWSKTDPPSLNSINFTVPEGSLIAVVGQVGCGKSSLLSALLGEMDKKEGYVVVKGSIAYVPQQAWIQNATLEDNIIFGREMNESRYKRVIEACALLPDLEILPMGDRTEIGEKGVNLSGGQKQRVSLARAVYCNADTYLFDDPLSAVDAHVGKHIFEKVIGPKGILKNKTRVLVTHAVNYLPQMDTILVMTD-GEISEMGSYQELLKQDGAFAEFLRTYANAEQSMESSDASSPSGKEGKPVENGVLVNDATGKLMHRQLSNSSTYSRETGKSQHQSSTAELQKPLAEKNSWKLTEADTAKTGRVKATVYWEYMKAIGLYISFLSVFLFMCNHIASLASNYWLSLWTD------DPVVNGTQQYTNVRLGVYGALGISQGIAVFGYSMAVSIGGIFASRHLHLDLLHNVLRSPMSFFERTPSGNLVSRFSKEIDTIDSTIPPIIKMFMGSTFNVIGACIIILLATPIAAVVIPPLGLVYLLVQRFYVATSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQKRFIKQNDMKVDENQKAYYPSIVANRWLAVRLEFVGNCIVLFAALFAVIARNKLSPGLIGLSVSYSLQITAYLNWLVRMTSDLETNIVAVERVKEYAEMEKEAEWSIEETAP--ASTWPQEGKVEFRGFGLRYREDLDLVLKNINITINGGEKVGIVGRTGAGKSSLTLGLFRINEAAEGEIIIDGINIAKIGLHDLRFKITIIPQDPILFSGSLRMNLDPFDQHSDEDIWRSLELAHLKNFVSSLPDKLNHECSEGGENLSVGQRQLVCLARALLRKSKILVLDEATAAVDLETDNLIQSTIKSQFEECTVLTIAHRLNTIMDYTRVLVLDRGEVVECDSPDNLL-QAKGLFYSMAK 1520          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: R7VJB8 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_229313 PE=4 SV=1)

HSP 1 Score: 868.226 bits (2242), Expect = 0.000e+0
Identity = 514/1278 (40.22%), Postives = 764/1278 (59.78%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKE--NDSNNSMPRKMSPGAPIEIQNGSFSWT--EDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL-----NESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFND---ISHEEEIMSGRVSLNS--------IVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAK--FYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES---INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDK 3793
            PE  +S +S+IT+ W++  +   +K+ +K+E  + LN  + +S       K  K+ L+  N ++ +     KK +     F             +L +VY P +    + K   D+L    P++  LL+ Y +  D+   WKG L A LFF   +  S+  +  F I   + +RV+AAL   IYKK L +S EAR   + G+IVN+ SVD +++ + + Y W+  S P QI++A+ +L+  +G S+ AG+  +  +IP+N ++    RK   +++  KD+R+ ++ E+  G+K++K+YAWE  F  K+ EIR  E++ ++  +    + +  W   PF V   +F  ++    N  +  +  FVSL LFN L+ PI ++P  +S  ++A VS  RI  FL   + +  N  +NS        API ++NG+F+W   ED  P L +I+L V++  L AVVG VG GKSSL+SAILGEM  + G V   G  AYVPQ+AWIQN +LR+NIL  K F+   Y KV++AC L  D+E LP  D TEIGE+G+NLSGGQKQRVSLARAVY D DIYLLDDPLSAVD +VG+ +F+ ++  +GLL+ KTR+LVTHG+ WLP VDE+ VI + G+ISE+G+YE L+     F  FL      E+SD  D++++         + +R R +T       G +  EE       D   +  +E    GRV +           + Y KA G+F+    +L+ +++       N+WL    +   L N S  N ++   +   Y+  YG +G+ Q   V+L+        +RA+ K+H  +L  +LRS + FF+ TP GRILNRF++D+  +D+ L   I   +N    +++++ VIS  TP F  V IP++I Y  +Q FYI +SRQ +R++S   S +  H  ET +G+S IR+ +A+  F +     +D +  F      S RWL  RL+ +G L+V  + IFAV+ + +LS  LVGLSISYALQVT  LNW+ R  ++ ETN VS+ERI +Y+  P E+   +  +   IS  W   G +  E++S +Y   +  VL+ IT NI  GEK+G+VGRTGAGKSSL ++LFR++E   G I IDG+N++ +GLHQLR +LTILPQDPV+F+GTL+ NLDPFD+YTDDKL  SL+ + + +++ SL  G+ Y+CG  G NLS+GQ+QL+CLARTLL+K+KI+ILDEATA+VD ETD  +   I+  F S T++ IAHRL TI+D D+
Sbjct:  199 PEVSASFISRITFFWINSLVRTGYKKSLKEEDVWALNPRDITSNTFHPFEKQWKKELQKCNWKASL-----KKAIPDPSLF------------ATLTKVYGPTLLIAHLCKFVCDLLTFVGPMLQSLLIEYTETPDMP-EWKGYLYAALFFITTVLTSVFFHQLFHIGMTLGMRVKAALIAAIYKKALTMSNEARKTSTVGEIVNLMSVDAQRMQDVVGYLWMVWSSPLQIVIAVYMLWNIMGPSVLAGLAVMILLIPINGVLASIQRKLQIQQMHLKDQRIKLMNEVLGGIKVLKLYAWELSFKDKVNEIRTKEMQTLKKYAYLGAVGTFTWTCAPFLVTLASFATYVLLGNN--LDADTAFVSLSLFNILRFPINMMPNMVSYMVTASVSIKRIGRFLATGDIDLKNVLHNS-----RADAPITVENGNFAWGMGEDDLPILKDIDLQVKDNSLTAVVGAVGAGKSSLISAILGEMEKITGFVNVRGTTAYVPQQAWIQNASLRDNILFGKDFDAQKYNKVIEACALGPDLEILPGGDMTEIGEKGINLSGGQKQRVSLARAVYHDCDIYLLDDPLSAVDSHVGKHIFDHVVGPEGLLRKKTRILVTHGVHWLPKVDEVVVILN-GKISEKGSYEELVSHDGAFAQFLKQYLLQEASDN-DESEDE--------ESRRKRHNTLRQTSLLGQKTVEEKDPDKNKDKERLVQDETSEVGRVRIPCRYLTRDTFYMAYCKALGVFMAIFLLLSFLVYQAASVASNIWLSAWTEDSYLKNESLSNTTQYGKRRDMYLGIYGALGIAQAFFVLLYAMVAAVSQVRAAAKLHEYMLHNILRSPMSFFDTTPIGRILNRFSRDIETVDNLLPQLIRSWLNTFFSVVSTIAVISYSTPIFLSVIIPLVIIYYFVQRFYIPTSRQLKRIESTTRSPIYVHFSETVTGASTIRAFDAQHRFINQSEDKVDHNLSFYFASIASNRWLGFRLEFIGALVVASAAIFAVVGKSTLSGGLVGLSISYALQVTSSLNWMVRMTSDLETNIVSVERINEYSETPPEADWYVQRSAPPIS--WPDEGKVAFEDYSTRYRPGMDLVLRGITANIAAGEKVGIVGRTGAGKSSLTMSLFRIIEAAGGSITIDGLNVSHLGLHQLRSKLTILPQDPVLFAGTLRMNLDPFDQYTDDKLWDSLKNAHLSEFIKSLANGLEYECGEGGQNLSVGQRQLVCLARTLLRKTKILILDEATAAVDLETDELIQRTIRQVFASCTILTIAHRLNTIMDNDR 1439          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A1B6E1F3 (Uncharacterized protein OS=Clastoptera arizonana OX=38151 GN=g.30401 PE=4 SV=1)

HSP 1 Score: 866.685 bits (2238), Expect = 0.000e+0
Identity = 506/1319 (38.36%), Postives = 789/1319 (59.82%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRS----PNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSW--TEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL--------NESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEEN---------------------YEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE  +S  S++T+ W D      FK+ ++    + L   +TS+E      KY  E++R     P  ++          +IG    N   K+    ++ +LC+ + P   FG  LK+ +D+L    P +L LL+ ++K K+    W+G L A++        ++     F   S + +R+R AL   IY+K LR+S  AR   + G+IVN+ +VD ++ M+   Y  +  S P QI LA+  L+  LG S+ AG+  +  +IP+N +I   ++    R++  KD+R+ ++ EI  G+K++K+YAWE  F +++  IRN E+K ++  +      S +W   PF V  +TF  ++    N+++  +K FVSL LFN L+ P+ +LP  +S  +   VS  RI  F+ + E +    NS+    S   P+ ++NG+FSW  +++    L NIN+ V+   L+AVVG VG GKSSL+SA LGEM  + G V T+G +AYVPQ+AWIQN T++ NI+  KSF++  Y +++  C L+ D++ LP  D+TEIGE+G+NLSGGQKQRVSLARAVY DSD+Y LDDPLSAVD +VG+ +F  +I  +G+LK KTRVLVTH + +LP VD I V+ D G +SE GTY+ L+     F  FL         E+  ++D  +  LI+ +   ++K  R  ++ S       N  E+                      +K  + +   E+  +G V     ++Y K+ G  +  ++I   +++ V     NVWL   +   S++ N T + S+     Y+  Y   GLGQ++ +++       G L A++ +H  +L  +LR+ ++FF+ TP GRILNRF+KD+  +D TL   I   ++  + ++ ++VVIS +TP F +V IPI I Y  +Q FY+++SRQ +RL+S + S + +H  E+  G+S IR+   +S F +   + +D +        +S RWL +RL+ +GNLI+F S +FAVL+R + +A LVGLS+SYALQ+T  LNWL R  ++ ETN V++ERI++Y   P E+  E +    ++W + G ++  ++ ++Y   L  VLK I   +NGGEK+G+VGRTGAGKSSL L+LFR++E  +G+I IDG++I+S+GLH LR +LTI+PQDPV+FSGTL+ NLDPF +  D+ + ++LE S + ++V  L+ G+ +     G NLS+GQ+QLICL R LL+K+K++ILDEATA+VD ETD  +   I+ +F   TV+ IAHRL TI+D D+++ LD G+I+E+ SP  LL N S  F ++A+
Sbjct:  208 PEVSASFPSKLTFSWFDSLALLGFKQPLEANNLWHLKYEDTSTEVVPLFEKYWSESVRKAANVPQHKASFLKRSGSVDIIGNSTGNTPTKHQAS-ILPALCKAFGPTFLFGSFLKLMQDLLSFVSPQILSLLIAFIKGKES--MWRGYLYAIVLLLAASCQTIFLAQYFFRMSIVGLRIRTALISAIYRKALRMSNSARKESTVGEIVNLMAVDAQRFMDLTAYLNMIWSAPLQIALALFFLWQTLGPSVLAGLAVMIVLIPVNGVIASKAKGLQIRQMKNKDERVKLMNEILSGIKVLKLYAWEPSFEQQVLRIRNKEMKVLKQAAYLNAATSFIWACAPFMVSLVTFAVYVLVDENNVLDAQKAFVSLSLFNILRFPLSMLPMLISNMVQTSVSVKRINKFMNSEELDP---NSVTHDHSEKDPLVMENGTFSWGDSQEDAVILRNINIRVKQGALVAVVGTVGSGKSSLVSAFLGEMDRITGRVNTKGSVAYVPQQAWIQNATMKENIIFGKSFDQNSYNRIVKGCALQQDLDMLPAGDKTEIGEKGINLSGGQKQRVSLARAVYNDSDVYFLDDPLSAVDSHVGKHIFENVIGPKGILKKKTRVLVTHSITFLPEVDLILVMKD-GTVSESGTYKELLAKKGAFSDFLIQHLQEVDEETESELDDLKQQLIESNTELRKKFERQKSTESGSLRQRSNHSESGSVASLNRRRSSSSSEEKVPIEKKPGDKLIEAEKAETGGVKKQVYLYYLKSVGGLLTIATIALNIVYQVFSIGSNVWLSEWSSDTSIIVNGTQDTSKRD--MYLGVYAGFGLGQVVTILVATLTLYLGLLSAARLLHYAVLINILRTPMEFFDVTPVGRILNRFSKDVEAVDQTLPDVIRGWLSCFMSVVATMVVISSITPIFLVVIIPIGIIYFFVQRFYVATSRQLKRLESISRSPIYSHFGESIQGASSIRAYGVQSKFITESEQKVDFNQVCLYPSLISNRWLAVRLETVGNLIIFFSSLFAVLSRDTTNAGLVGLSVSYALQITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEAPWEKSPGPPDDWPNKGQVDFLDYQVRYREGLDLVLKGINFRVNGGEKVGIVGRTGAGKSSLTLSLFRILEAANGQILIDGIDISSLGLHALRSRLTIIPQDPVLFSGTLRMNLDPFGKEKDEDIWRALEHSHLKNFVKGLSAGLQHQVSEGGENLSVGQRQLICLGRALLRKTKVLILDEATAAVDLETDDLIQRTIRTEFKDCTVLTIAHRLNTIMDSDRVVVLDKGAIVEYDSPPNLLKNRSSIFFSMAK 1517          

HSP 2 Score: 100.138 bits (248), Expect = 3.256e-17
Identity = 107/434 (24.65%), Postives = 188/434 (43.32%), Query Frame = 2
Query: 2657 IVGIPILICYILLQVFYISSSR--QARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNK-FKLIQYL----SLRWLCLRLDILGNLIVFGSVIFAVLNR-FSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLEN--FSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNL---DPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAI---KFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKHE 3910
            + G+ ++I  I +     S ++  Q R++ +K     L +  E  SG  +++    E  FE    R  +K  K  K   YL    S  W C    +  +L+ F   +    N       + V LS+   L+    L+ L    +     +VS++RI ++    + S     N ++ +      + +EN  FS   +     +L+NI I +  G  + VVG  G+GKSSL  A    ++  +GR+   G              +  +PQ   I + T+K N+     FD+ + ++++K   +   LD    L  G   + G  G NLS GQKQ + LAR +   S +  LD+  ++VD    + + E +   K      T +++ H +  + + D I+ + DG++ E G+ KELL+        L Q  + +  E
Sbjct:  455 LAGLAVMIVLIPVNGVIASKAKGLQIRQMKNKDERVKLMN--EILSGIKVLKLYAWEPSFEQQVLRIRNKEMKVLKQAAYLNAATSFIWACAPFMV--SLVTFAVYVLVDENNVLDAQKAFVSLSLFNILRFP--LSMLPMLISNMVQTSVSVKRINKF----MNSEELDPNSVTHDHSEKDPLVMENGTFSWGDSQEDAVILRNINIRVKQGALVAVVGTVGSGKSSLVSAFLGEMDRITGRVNTKG-------------SVAYVPQQAWIQNATMKENIIFGKSFDQNSYNRIVKGCALQQDLD---MLPAGDKTEIGEKGINLSGGQKQRVSLARAVYNDSDVYFLDDPLSAVDSHVGKHIFENVIGPKGILKKKTRVLVTHSITFLPEVDLILVMKDGTVSESGTYKELLAKKGAFSDFLIQHLQEVDEE 862          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A1B6EGY9 (Uncharacterized protein OS=Clastoptera arizonana OX=38151 GN=g.30404 PE=4 SV=1)

HSP 1 Score: 866.3 bits (2237), Expect = 0.000e+0
Identity = 506/1319 (38.36%), Postives = 789/1319 (59.82%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRS----PNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSW--TEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL--------NESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEEN---------------------YEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE  +S  S++T+ W D      FK+ ++    + L   +TS+E      KY  E++R     P  ++          +IG    N   K+    ++ +LC+ + P   FG  LK+ +D+L    P +L LL+ ++K K+    W+G L A++        ++     F   S + +R+R AL   IY+K LR+S  AR   + G+IVN+ +VD ++ M+   Y  +  S P QI LA+  L+  LG S+ AG+  +  +IP+N +I   ++    R++  KD+R+ ++ EI  G+K++K+YAWE  F +++  IRN E+K ++  +      S +W   PF V  +TF  ++    N+++  +K FVSL LFN L+ P+ +LP  +S  +   VS  RI  F+ + E +    NS+    S   P+ ++NG+FSW  +++    L NIN+ V+   L+AVVG VG GKSSL+SA LGEM  + G V T+G +AYVPQ+AWIQN T++ NI+  KSF++  Y +++  C L+ D++ LP  D+TEIGE+G+NLSGGQKQRVSLARAVY DSD+Y LDDPLSAVD +VG+ +F  +I  +G+LK KTRVLVTH + +LP VD I V+ D G +SE GTY+ L+     F  FL         E+  ++D  +  LI+ +   ++K  R  ++ S       N  E+                      +K  + +   E+  +G V     ++Y K+ G  +  ++I   +++ V     NVWL   +   S++ N T + S+     Y+  Y   GLGQ++ +++       G L A++ +H  +L  +LR+ ++FF+ TP GRILNRF+KD+  +D TL   I   ++  + ++ ++VVIS +TP F +V IPI I Y  +Q FY+++SRQ +RL+S + S + +H  E+  G+S IR+   +S F +   + +D +        +S RWL +RL+ +GNLI+F S +FAVL+R + +A LVGLS+SYALQ+T  LNWL R  ++ ETN V++ERI++Y   P E+  E +    ++W + G ++  ++ ++Y   L  VLK I   +NGGEK+G+VGRTGAGKSSL L+LFR++E  +G+I IDG++I+S+GLH LR +LTI+PQDPV+FSGTL+ NLDPF +  D+ + ++LE S + ++V  L+ G+ +     G NLS+GQ+QLICL R LL+K+K++ILDEATA+VD ETD  +   I+ +F   TV+ IAHRL TI+D D+++ LD G+I+E+ SP  LL N S  F ++A+
Sbjct:  208 PEVSASFPSKLTFSWFDSLALLGFKQPLEANNLWHLKYEDTSTEVVPLFEKYWSESVRKAANVPQHKASFLKRSGSVDIIGNSTGNTPTKHQAS-ILPALCKAFGPTFLFGSFLKLMQDLLSFVSPQILSLLIAFIKGKES--MWRGYLYAIVLLLAASCQTIFLAQYFFRMSIVGLRIRTALISAIYRKALRMSNSARKESTVGEIVNLMAVDAQRFMDLTAYLNMIWSAPLQIALALFFLWQTLGPSVLAGLAVMIVLIPVNGVIASKAKGLQIRQMKNKDERVKLMNEILSGIKVLKLYAWEPSFEQQVLRIRNKEMKVLKQAAYLNAATSFIWACAPFMVSLVTFAVYVLVDENNVLDAQKAFVSLSLFNILRFPLSMLPMLISNMVQTSVSVKRINKFMNSEELDP---NSVTHDHSEKDPLVMENGTFSWGDSQEDAVILRNINIRVKQGALVAVVGTVGSGKSSLVSAFLGEMDRITGRVNTKGSVAYVPQQAWIQNATMKENIIFGKSFDQNSYNRIVKGCALQQDLDMLPAGDKTEIGEKGINLSGGQKQRVSLARAVYNDSDVYFLDDPLSAVDSHVGKHIFENVIGPKGILKKKTRVLVTHSITFLPEVDLILVMKD-GTVSESGTYKELLAKKGAFSDFLIQHLQEVDEETESELDDLKQQLIESNTELRKKFERQKSTESGSLRQRSNHSESGSVASLNRRRSSSSSEEKVPIEKKPGDKLIEAEKAETGGVKKQVYLYYLKSVGGLLTIATIALNIVYQVFSIGSNVWLSEWSSDTSIIVNGTQDTSKRD--MYLGVYAGFGLGQVVTILVATLTLYLGLLSAARLLHYAVLINILRTPMEFFDVTPVGRILNRFSKDVEAVDQTLPDVIRGWLSCFMSVVATMVVISSITPIFLVVIIPIGIIYFFVQRFYVATSRQLKRLESISRSPIYSHFGESIQGASSIRAYGVQSKFITESEQKVDFNQVCLYPSLISNRWLAVRLETVGNLIIFFSSLFAVLSRDTTNAGLVGLSVSYALQITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEAPWEKSPGPPDDWPNKGQVDFLDYQVRYREGLDLVLKGINFRVNGGEKVGIVGRTGAGKSSLTLSLFRILEAANGQILIDGIDISSLGLHALRSRLTIIPQDPVLFSGTLRMNLDPFGKEKDEDIWRALEHSHLKNFVKGLSAGLQHQVSEGGENLSVGQRQLICLGRALLRKTKVLILDEATAAVDLETDDLIQRTIRTEFKDCTVLTIAHRLNTIMDSDRVVVLDKGAIVEYDSPPNLLKNRSSIFFSMAK 1517          

HSP 2 Score: 100.138 bits (248), Expect = 3.574e-17
Identity = 107/434 (24.65%), Postives = 188/434 (43.32%), Query Frame = 2
Query: 2657 IVGIPILICYILLQVFYISSSR--QARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNK-FKLIQYL----SLRWLCLRLDILGNLIVFGSVIFAVLNR-FSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLEN--FSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNL---DPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAI---KFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKHE 3910
            + G+ ++I  I +     S ++  Q R++ +K     L +  E  SG  +++    E  FE    R  +K  K  K   YL    S  W C    +  +L+ F   +    N       + V LS+   L+    L+ L    +     +VS++RI ++    + S     N ++ +      + +EN  FS   +     +L+NI I +  G  + VVG  G+GKSSL  A    ++  +GR+   G              +  +PQ   I + T+K N+     FD+ + ++++K   +   LD    L  G   + G  G NLS GQKQ + LAR +   S +  LD+  ++VD    + + E +   K      T +++ H +  + + D I+ + DG++ E G+ KELL+        L Q  + +  E
Sbjct:  455 LAGLAVMIVLIPVNGVIASKAKGLQIRQMKNKDERVKLMN--EILSGIKVLKLYAWEPSFEQQVLRIRNKEMKVLKQAAYLNAATSFIWACAPFMV--SLVTFAVYVLVDENNVLDAQKAFVSLSLFNILRFP--LSMLPMLISNMVQTSVSVKRINKF----MNSEELDPNSVTHDHSEKDPLVMENGTFSWGDSQEDAVILRNINIRVKQGALVAVVGTVGSGKSSLVSAFLGEMDRITGRVNTKG-------------SVAYVPQQAWIQNATMKENIIFGKSFDQNSYNRIVKGCALQQDLD---MLPAGDKTEIGEKGINLSGGQKQRVSLARAVYNDSDVYFLDDPLSAVDSHVGKHIFENVIGPKGILKKKTRVLVTHSITFLPEVDLILVMKDGTVSESGTYKELLAKKGAFSDFLIQHLQEVDEE 862          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: A0A2A3EBU1 (Multidrug resistance-associated protein OS=Apis cerana cerana OX=94128 GN=APICC_09479 PE=4 SV=1)

HSP 1 Score: 865.914 bits (2236), Expect = 0.000e+0
Identity = 532/1320 (40.30%), Postives = 805/1320 (60.98%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLI----GKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDG--RPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL----------NESSDKVDKNQNNLIQPSAPNK------RKRSRLSTSGSQG--------FDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVW-----YFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYIS-ENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE  SS   +I + W D   ++ FK+ ++    + +N  +T+ E   K  KY K+NL+  N      ++++ K       G+ NFN E+K     V+  LC+ +     FG +LK  +DI+    P +L+LL++++K  +    WKG   A+L     +F +L  +  F     + +R+R AL   IY+K LR+S  AR   + G+IVN+ SVD ++ M+   Y  +  S P QI+LA+  L+  LG ++ AG+  +  +IP+N++I    +    R++  KD+R+ ++ E+ +G+K++K+YAWE  F ++I +IR  EIK ++  +      S +W   PF V  ++F  ++    N+ +   K FVSL LFN L+ P+ +LP  +   + A VS  RI  F+  + +E D NN +    S    + I+NG+F W  +   RPTL NINL VE  +L+AVVG VG GKSSLLSA+LGEM  +NG V T+G IAYV Q+AWIQN +L++N+L  KS +K  Y +V++AC L  D++ LP  DQTEIGE+G+NLSGGQKQRVSLARAVY DSDIY LDDPLSAVD +VG+ +F  +I + GLLK KTR+LVTHG+ +LP VD I V+ D G+I+E GTY+ L++    F  FL           ES   + + + +L      N+      R +SR+S S S+          +G+  +     K  +  S  + I   +    S+ W     YFK+ G F+  S+I+   IF       N WL M +D      N+T +  + +   Y+  YG +GLGQ +   L       G   A++++H ++L  V+R+ L FF+ TP+GRI++RF KD+ ++D +L   I+D I     +I +LVVIS  TP F  V IPI + Y  +Q  Y++SSRQ +RL+S + S + +H  ET SG+ +IR+   +  F +     +D +        ++ RWL +RL+++GNLI+F + +FAVLN+ ++S+ LVGLS+SYALQVT  LNWL R  ++ ETN V++ERI++Y   P E+  +  +Y   + W   G +  +++ ++Y  +L  VL+ ++ +I GGEK+G+VGRTGAGKSSL LALFR++E   G+IFID ++I  +GLH LR +LTI+PQDPV+FSG+L+ NLDPF+ YTDD++ ++LE + +  ++ +L  G+ Y+    G NLS+GQ+QLICLAR LL+K+K++ILDEATASVD ETD  + + I+ +F   T++ IAHRL TI+D D+II LD+G I+E+ SP+ LL NSS  F ++A+
Sbjct:  200 PEQKSSFPGKIFFSWFDSMAWKGFKKPLEITDLWSINPEDTAKEIVPKFEKYWKKNLQKRN------NVQNTKASFRKGSGQVNFNNEYKKKTSSVLPPLCKAFGATFLFGAVLKFIQDIITFVSPQILQLLIDFIKGHEP--LWKGYFYAVLLLITAIFQTLVLSQYFHRMFLVGLRIRTALIAAIYRKALRMSNAARKESTVGEIVNLMSVDAQRFMDLTAYINMIWSAPLQIVLALYFLWDILGPAVLAGLAVLLILIPINVLITNRVKTLQIRQMKHKDERVKLMNEVLNGIKVLKLYAWEPSFEEQILKIRTKEIKVLKETAYLNSGTSFIWSFAPFLVSLVSFATYVLIDENNRLDSTKAFVSLSLFNILRFPLSILPMMIGNMVQAYVSVKRINKFM--NTEELDPNN-VQHDSSESYTLLIENGTFIWDMENIDRPTLRNINLQVEQGQLVAVVGTVGSGKSSLLSALLGEMEKINGRVNTKGSIAYVSQQAWIQNASLQDNVLFGKSLHKNLYNRVIEACALTPDLKVLPAGDQTEIGEKGINLSGGQKQRVSLARAVYNDSDIYFLDDPLSAVDSHVGKHIFENVIGSSGLLKKKTRILVTHGITYLPEVDNIIVLKD-GEITEVGTYKQLLEKRGAFSEFLVQHLQEVHADGESEADLHEIKQHLESTIGSNELQQKLTRGKSRMSESQSESGSIADRKSLNGSLKSNIKEAKLLSPKSGGKLIEVEKTETGSVKWRVYSHYFKSIGWFLSISTIIMNAIFQGFSIGSNTWLSMWSDDNLTDVNNTVDHVKQN--MYLGVYGGLGLGQAMTSFLCDLAPQLGCWLAARQMHIMMLRVVMRAPLTFFDTTPTGRIISRFAKDVDVLDTSLPQQISDSIYCLFEVIATLVVISFSTPIFISVIIPISVIYYFVQRLYVASSRQLKRLESVSRSPIYSHFSETVSGAQMIRAFGVQERFINESESKVDFNQVCYYPSIIANRWLAVRLEMVGNLIIFFAALFAVLNKDTVSSGLVGLSVSYALQVTQTLNWLVRMTSDVETNIVAVERIKEYGETPQEASWKNPDYTPPKEWPVQGRVEFKDYKVRYREDLELVLRGLSFSIKGGEKVGIVGRTGAGKSSLTLALFRIIEAADGQIFIDDIDIAKLGLHDLRSRLTIIPQDPVLFSGSLRINLDPFNCYTDDEVWRALEHAHLKSFIKNLPNGLLYEVSEGGENLSIGQRQLICLARALLRKTKVLILDEATASVDLETDDLIQQTIRQEFKDCTILTIAHRLNTILDSDRIIVLDNGRIVEYDSPESLLRNSSSLFSSIAK 1505          
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Match: K7J1C7 (Uncharacterized protein OS=Nasonia vitripennis OX=7425 PE=4 SV=1)

HSP 1 Score: 865.529 bits (2235), Expect = 0.000e+0
Identity = 524/1332 (39.34%), Postives = 787/1332 (59.08%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDG--RPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKV---DKNQNNLIQ-------------------------------------PSAPNKRKRSRLSTSGSQG-----FDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINE-TNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE  +S  S++T+ W D   ++ FK  ++    + +N  + + E   +  KY  ++LR  + +  +      +   G+ +FN +       V+  LC+ + PI  FG +LK+ +D++    P +L LL+N+ K+K+    WKG   A+L     +  +L  +  F     + +R+R AL   IY+K LR+S  AR   + G+IVN+ SVD ++ M+   Y  +  S P QI LA+  L+  LG S+ +G+  +  +IP+N ++    R    +++  KD+R+ ++ E+  G+K++K+YAWE  F ++I +IRN EIK ++  +      S +W   PF V  ++F  F+     +++  E  FVSL LFN L+ P+ +LP  +S  + A VS  RI  F+  + +E D NN +    S   P+ I+NG+FSW  +   +P L NINL V+  +L+AVVG VG GKSSL+SA+LGEM  L+G V T G IAYV Q+AWIQN TL++NIL  K  +K  Y +V++AC L  D + LP  DQTEIGE+G+NLSGGQKQRVSLARAVY DSDIY LDDPLSAVD +VG+ +F  LI ++GL+K KTR+LVTHG+ +LP VD I V+ D G+I+E GTY+ L++    F  FL +   +V   ++N ++LI+                                       + N   R + ST   Q       +  ++ E+   K    +   E+  +G V       Y ++ G F+  S+I    +F       NVWL   +       N TF+ +      Y+  YG +GLGQ + V+L     + G LR+S  +H  LL  +LRS + FF+ TPSGRILNRF KD+ IID+ L  NI   +   V +I +LVVIS  TP F  V +P  + Y  +Q FY+++SRQ +RL+S + S + +H  E+ +G+  IR+   +  F     + +D +        ++ RWL +RL+++GNLI+F + +FAVL R  ++A  VGLSISYALQ+T  LNWL R  ++ ETN V++ERI++Y   P E+  +   N   + W S G+++  +F ++Y   L  VL  +T ++NGGEK+G+VGRTGAGKSSL LALFR++E   G I ID +NI+ +GLH LR +LTI+PQDPV+FSG+L+ NLDPF++ +DD L ++L  + + D+V +L  G++++    G NLS+GQ+QLICLAR LL+K+K++ILDEATA+VD ETD  +   I+ +F   TV+ IAHRL TI+D D++I LD G+I+EF SP  LL      F ++A+
Sbjct:  205 PEQSASFPSRLTFSWFDALAWRGFKNPLETSDLWSMNPMDMAKEIVPQFDKYWLKSLRKVDNKDHVRAKAMFRKSSGQVDFNNDKNKKSASVLPPLCKAFGPIFMFGVMLKVLQDVMTFVSPQILSLLINFTKHKNQP-MWKGYFYAVLLLLTAILQTLVLSQYFHRMFLVGLRMRTALIAAIYRKALRMSNSARKESTVGEIVNLMSVDAQRFMDVTAYINMIWSAPLQIALALYFLWQILGPSVLSGLAVMIILIPVNALLAGKVRNLQIKQMKNKDERVKLMNEVLSGIKVLKLYAWEPSFEEQILKIRNKEIKVLKEAAYLNAGTSFIWSCAPFLVSLVSFATFVLIDEKNVLNSEIAFVSLSLFNILRFPLSMLPMMISNVVQASVSVKRINKFM--NSEELDPNN-VTHDESEANPLIIENGNFSWDSEHIEKPVLRNINLQVKQGQLVAVVGTVGSGKSSLISALLGEMEKLSGRVNTRGSIAYVSQQAWIQNATLQDNILFGKPLDKALYHRVVEACALTPDFKMLPAGDQTEIGEKGINLSGGQKQRVSLARAVYNDSDIYFLDDPLSAVDSHVGKHIFENLIGSRGLMKKKTRILVTHGITYLPEVDNIVVLKD-GEITECGTYKELLEKRGAFADFLVQHLQEVQTEEENTDDLIEIKQRLENTIGTEELQQRINQARTKVSGSISESGSIGDRKSLNGSLRRQHSTDSQQSGSLLRSNSVKDKEQIQYKTGEKLIETEKAETGSVKWRVYSHYLRSIGWFLSLSTIAMNAVFQSFSIGSNVWLSKWSSDNLTDANGTFDLAGRDQ--YLGVYGALGLGQAIFVLLAQLTMVIGCLRSSYLLHYKLLFGILRSPIGFFDTTPSGRILNRFGKDVDIIDNVLPPNIKAWLFCLVSVIATLVVISYSTPIFISVIVPTGLLYYFIQRFYVATSRQLKRLESVSRSPIYSHFGESVTGAQTIRAYGMQERFIQESEKRVDFNQVCYYPSIIANRWLAIRLEMVGNLIIFFAALFAVLGREDVAAGDVGLSISYALQITQTLNWLVRMTSDVETNIVAVERIKEYGETPQEAAWDIPENDPDKEWPSRGSVDFNDFKVRYREGLDLVLNGLTFSVNGGEKVGIVGRTGAGKSSLTLALFRIIEAAGGEILIDNINISKLGLHTLRSRLTIIPQDPVLFSGSLRLNLDPFNKCSDDDLWRALAHAHLKDFVQTLPNGLSHEVTEGGDNLSVGQRQLICLARALLRKTKVLILDEATAAVDLETDDLIQRTIREEFKECTVLTIAHRLNTILDSDRVIVLDKGAIVEFESPDSLLQKPESAFYSMAK 1529          

HSP 2 Score: 96.6709 bits (239), Expect = 4.134e-16
Identity = 140/590 (23.73%), Postives = 247/590 (41.86%), Query Frame = 2
Query: 2234 CVIFGVLQAFGNVWLGMLADTQSLLNNS------TFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNA----TPSGRILNRFTKDLFIIDHTLNLNITDIINR--TVLLITSLVVI---SIVTPWFGIVGIPILICYILLQVFYISSSR--QARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNK-FKLIQYL----SLRWLCLRLDILGNLIVFGS-VIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNL---DPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAI---KFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKHEDK 3916
            C  FG +  FG V L +L D  + ++         F + +N   +    Y ++ L   +   L    +         ++ + L+  + R  L+  N+    +  G I+N     L  +D    +++T  IN   +  L  +L +     I+ P   + G+ ++I  I +        R  Q +++ +K     L +  E  SG  +++    E  FE    +  +K  K  K   YL    S  W C     L +L+ F + V+    N  +   + V LS+   L+    L+ L    +     +VS++RI ++  +  E ++  N    E+  +   I   NFS         VL+NI + +  G+ + VVG  G+GKSSL  AL   +E  SGR+               R  +  + Q   I + TL+ N+    P D+    +++++  ++        L  G   + G  G NLS GQKQ + LAR +   S I  LD+  ++VD    + + E +   +      T I++ H +  + + D I+ L DG I E G+ KELL         L Q  + ++ E++
Sbjct:  301 CKAFGPIFMFG-VMLKVLQDVMTFVSPQILSLLINFTKHKNQPMWKGYFYAVLLLLTAILQTLVLSQYFHRMFLVGLRMRTALIAAIYRKALRMSNSARKESTVGEIVN-----LMSVDAQRFMDVTAYINMIWSAPLQIALALYFLWQILGPSV-LSGLAVMIILIPVNALLAGKVRNLQIKQMKNKDERVKLMN--EVLSGIKVLKLYAWEPSFEEQILKIRNKEIKVLKEAAYLNAGTSFIWSCA--PFLVSLVSFATFVLIDEKNVLNSEIAFVSLSLFNILRFP--LSMLPMMISNVVQASVSVKRINKF--MNSEELDPNNVTHDESEANPLIIENGNFSWDSEHIEKPVLRNINLQVKQGQLVAVVGTVGSGKSSLISALLGEMEKLSGRV-------------NTRGSIAYVSQQAWIQNATLQDNILFGKPLDKALYHRVVEACALTPDF---KMLPAGDQTEIGEKGINLSGGQKQRVSLARAVYNDSDIYFLDDPLSAVDSHVGKHIFENLIGSRGLMKKKTRILVTHGITYLPEVDNIVVLKDGEITECGTYKELLEKRGAFADFLVQHLQEVQTEEE 859          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc1 (ATP binding cassette subfamily C member 1 [Source:NCBI gene;Acc:103043969])

HSP 1 Score: 833.173 bits (2151), Expect = 0.000e+0
Identity = 502/1311 (38.29%), Postives = 764/1311 (58.28%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKS------------LCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGA-PIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNK------------RKRSRLSTSGS----QGFDGNE-NAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES-INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFK 3874
            PE  +S LS+I++ W+   + Q +K  ++++  + LN  + S     + ++             +      K+  + +K      + S   +IK+            LCR + P      I KI  D+L+   P +L+LL+ ++ + D   +W G     L F    F +L     F +     +R+R A+ G +Y+K L ++  AR   + G+IVN+ SVD ++ M+ ITY  +  S P Q+ILA+  L+  LG S+ AGV  +  ++P+N +I   ++ +   ++  KD R+ ++ E+ +G+K++K+YAWE  F  K+  IR  E++ ++  +    I +  W   PF V   TF  ++    ++++  +K FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL  S +E D N+   R ++  A  I I +G+FSW+++ RP L  IN+ +    L+AVVG VG GKSSLLSA+LGEM+   G V  +G +AYVPQ+AWIQN TLR NI+  +   + +Y KVL+AC L  D+E LP  D TEIGE+GVNLSGGQKQRVSLARAVY D  +YLLDDPLSAVD +VG+ +F K+I  QG+L+ +TRVLVTHGL +LP  D I V+ D G+I+E G+Y  L++    F  FL   ++     + + +   AP K            + +S L+T G+    Q  + N+  A++        ++  ++  +GRV L     Y KA G+F+   SIL  +   V     N WL +  D      +   N ++ S +  +  YG +GL Q +AV  +      GG+ AS+ +H  +L  VLRS + FF  TPSG ++NRF K+   ID  +   I   +     ++ S  VI I TP   I+  P+ + Y  +Q FY++SSRQ +RL+S + S V TH  ET  G+S+IR+   +  F     R +D + K      ++ RWL +RL+ +GN IV  + +FAV+ R +LS  ++GLSISYALQVT  LNWL R  +E ETN V++ER+++Y     E+      + +   W + G+I + NF L+Y  +L   + +IT+ I GGEK+G+VGRTGAGKSSL L LFR++E   G I IDGVNI ++GLH LR ++TI+PQDPV+FSG+L+ NLDPFD Y+D+ + ++LE++ + ++V+ L + +N++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF   TV+ IAHRL TI+D  +++ LD G + EF SP  L++     +K
Sbjct:  209 PEAGASFLSRISFWWITGLMVQGYKRPLEEKDLWSLNAEDRSHTVVPQLVRRWDHECSKGKRTDDKTMYSPKRPSMAEKKDGRPVEESEILLIKAPQKSGDPSLFLALCRTFGPYFLVSSIYKIIHDVLMFVGPEILRLLIQFVNDSDAP-SWHGYFYTALLFVCTCFQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGPSVLAGVAVMVLMVPVNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKDKVSTIRESELRVLKKAAYLGAISTFTWVCAPFLVALSTFAVYVLVDEHNVLDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMKRLRVFL--SHEELDENSVDRRAITGSADSIRIGDGAFSWSKEDRPALKRINVRIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGDVSIKGSVAYVPQQAWIQNATLRENIMFGQEKKESWYQKVLEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSLARAVYCDCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGVLQGRTRVLVTHGLSFLPQADLILVMVD-GEITETGSYTELLNRQGAFADFLRTYANAEQDGEPDGMTDGAPRKTLENGGPAAVLRQSQSSLNTPGAAKPQQKAESNDTQAKKTKSPDAAKLTEADKANTGRVKLAVFWEYMKAIGVFLSFISILLFLAHHVSSLGSNYWLSLWTD------DPVINGTQPSREMRLGVYGALGLSQGIAVFCYSISVSIGGILASRYLHETMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQLKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIGESDRRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARANLSPGIMGLSISYALQVTASLNWLVRMSSEVETNIVAVERVKEYEDTEKEAEWKLEQSSVPAGWPTAGHIEVRNFGLRYREDLELAIHDITVIIEGGEKVGIVGRTGAGKSSLTLGLFRIIEAAQGEICIDGVNIANLGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDGYSDEDVWRALELAHLKNFVSGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGKMAEFDSPASLIAKKGIFYK 1509          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc1 (ATP binding cassette subfamily C member 1 [Source:NCBI gene;Acc:103043969])

HSP 1 Score: 830.476 bits (2144), Expect = 0.000e+0
Identity = 505/1311 (38.52%), Postives = 764/1311 (58.28%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKS------------LCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGA-PIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL----NESSD--------KVDKNQNNLIQPSAPNKRKRSRLSTSGS----QGFDGNE-NAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES-INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFK 3874
            PE  +S LS+I++ W+   + Q +K  ++++  + LN  + S     + ++             +      K+  + +K      + S   +IK+            LCR + P      I KI  D+L+   P +L+LL+ ++ + D   +W G     L F    F +L     F +     +R+R A+ G +Y+K L ++  AR   + G+IVN+ SVD ++ M+ ITY  +  S P Q+ILA+  L+  LG S+ AGV  +  ++P+N +I   ++ +   ++  KD R+ ++ E+ +G+K++K+YAWE  F  K+  IR  E++ ++  +    I +  W   PF V   TF  ++    ++++  +K FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL  S +E D N+   R ++  A  I I +G+FSW+++ RP L  IN+ +    L+AVVG VG GKSSLLSA+LGEM+   G V  +G +AYVPQ+AWIQN TLR NI+  +   + +Y KVL+AC L  D+E LP  D TEIGE+GVNLSGGQKQRVSLARAVY D  +YLLDDPLSAVD +VG+ +F K+I  QG+L+ +TRVLVTHGL +LP  D I V+ D G+I+E G+Y  L++    F  FL    N   D        K +K Q N        ++ +S L+T G+    Q  + N+  A++        ++  ++  +GRV L     Y KA G+F+   SIL  +   V     N WL +  D      +   N ++ S +  +  YG +GL Q +AV  +      GG+ AS+ +H  +L  VLRS + FF  TPSG ++NRF K+   ID  +   I   +     ++ S  VI I TP   I+  P+ + Y  +Q FY++SSRQ +RL+S + S V TH  ET  G+S+IR+   +  F     R +D + K      ++ RWL +RL+ +GN IV  + +FAV+ R +LS  ++GLSISYALQVT  LNWL R  +E ETN V++ER+++Y     E+      + +   W + G+I + NF L+Y  +L   + +IT+ I GGEK+G+VGRTGAGKSSL L LFR++E   G I IDGVNI ++GLH LR ++TI+PQDPV+FSG+L+ NLDPFD Y+D+ + ++LE++ + ++V+ L + +N++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF   TV+ IAHRL TI+D  +++ LD G + EF SP  L++     +K
Sbjct:  209 PEAGASFLSRISFWWITGLMVQGYKRPLEEKDLWSLNAEDRSHTVVPQLVRRWDHECSKGKRTDDKTMYSPKRPSMAEKKDGRPVEESEILLIKAPQKSGDPSLFLALCRTFGPYFLVSSIYKIIHDVLMFVGPEILRLLIQFVNDSDAP-SWHGYFYTALLFVCTCFQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGPSVLAGVAVMVLMVPVNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKDKVSTIRESELRVLKKAAYLGAISTFTWVCAPFLVALSTFAVYVLVDEHNVLDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMKRLRVFL--SHEELDENSVDRRAITGSADSIRIGDGAFSWSKEDRPALKRINVRIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGDVSIKGSVAYVPQQAWIQNATLRENIMFGQEKKESWYQKVLEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSLARAVYCDCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGVLQGRTRVLVTHGLSFLPQADLILVMVD-GEITETGSYTELLNRQGAFADFLRTYANAEQDGEPDGMTGKKEKLQRNTTFVHFFPRQSQSSLNTPGAAKPQQKAESNDTQAKKTKSPDAAKLTEADKANTGRVKLAVFWEYMKAIGVFLSFISILLFLAHHVSSLGSNYWLSLWTD------DPVINGTQPSREMRLGVYGALGLSQGIAVFCYSISVSIGGILASRYLHETMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQLKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIGESDRRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARANLSPGIMGLSISYALQVTASLNWLVRMSSEVETNIVAVERVKEYEDTEKEAEWKLEQSSVPAGWPTAGHIEVRNFGLRYREDLELAIHDITVIIEGGEKVGIVGRTGAGKSSLTLGLFRIIEAAQGEICIDGVNIANLGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDGYSDEDVWRALELAHLKNFVSGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGKMAEFDSPASLIAKKGIFYK 1509          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: abcc1 (ATP binding cassette subfamily C member 1 [Source:NCBI gene;Acc:103043969])

HSP 1 Score: 825.854 bits (2132), Expect = 0.000e+0
Identity = 501/1325 (37.81%), Postives = 765/1325 (57.74%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKS------------LCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGA-PIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQ--------------------------PSAPNKRKRSRLSTSGS----QGFDGNE-NAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES-INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFK 3874
            PE  +S LS+I++ W+   + Q +K  ++++  + LN  + S     + ++             +      K+  + +K      + S   +IK+            LCR + P      I KI  D+L+   P +L+LL+ ++ + D   +W G     L F    F +L     F +     +R+R A+ G +Y+K L ++  AR   + G+IVN+ SVD ++ M+ ITY  +  S P Q+ILA+  L+  LG S+ AGV  +  ++P+N +I   ++ +   ++  KD R+ ++ E+ +G+K++K+YAWE  F  K+  IR  E++ ++  +    I +  W   PF V   TF  ++    ++++  +K FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL  S +E D N+   R ++  A  I I +G+FSW+++ RP L  IN+ +    L+AVVG VG GKSSLLSA+LGEM+   G V  +G +AYVPQ+AWIQN TLR NI+  +   + +Y KVL+AC L  D+E LP  D TEIGE+GVNLSGGQKQRVSLARAVY D  +YLLDDPLSAVD +VG+ +F K+I  QG+L+ +TRVLVTHGL +LP  D I V+ D G+I+E G+Y  L++    F  FL   ++     + + +                           P+A  ++ +S L+T G+    Q  + N+  A++        ++  ++  +GRV L     Y KA G+F+   SIL  +   V     N WL +  D      +   N ++ S +  +  YG +GL Q +AV  +      GG+ AS+ +H  +L  VLRS + FF  TPSG ++NRF K+   ID  +   I   +     ++ S  VI I TP   I+  P+ + Y  +Q FY++SSRQ +RL+S + S V TH  ET  G+S+IR+   +  F     R +D + K      ++ RWL +RL+ +GN IV  + +FAV+ R +LS  ++GLSISYALQVT  LNWL R  +E ETN V++ER+++Y     E+      + +   W + G+I + NF L+Y  +L   + +IT+ I GGEK+G+VGRTGAGKSSL L LFR++E   G I IDGVNI ++GLH LR ++TI+PQDPV+FSG+L+ NLDPFD Y+D+ + ++LE++ + ++V+ L + +N++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF   TV+ IAHRL TI+D  +++ LD G + EF SP  L++     +K
Sbjct:  209 PEAGASFLSRISFWWITGLMVQGYKRPLEEKDLWSLNAEDRSHTVVPQLVRRWDHECSKGKRTDDKTMYSPKRPSMAEKKDGRPVEESEILLIKAPQKSGDPSLFLALCRTFGPYFLVSSIYKIIHDVLMFVGPEILRLLIQFVNDSDAP-SWHGYFYTALLFVCTCFQTLILQKYFHVCFVTGMRLRTAIVGAVYRKALVITNAARRTSTVGEIVNLMSVDAQRFMDLITYINMIWSAPLQVILALYFLWQNLGPSVLAGVAVMVLMVPVNAVIAMKTKTYQVAQMKSKDNRIKLMNEVLNGIKVLKLYAWELAFKDKVSTIRESELRVLKKAAYLGAISTFTWVCAPFLVALSTFAVYVLVDEHNVLDAQKAFVSLALFNILRFPLNMLPMVISSMVQASVSMKRLRVFL--SHEELDENSVDRRAITGSADSIRIGDGAFSWSKEDRPALKRINVRIPEGALVAVVGHVGSGKSSLLSALLGEMHKQEGDVSIKGSVAYVPQQAWIQNATLRENIMFGQEKKESWYQKVLEACALLPDLEILPGGDTTEIGEKGVNLSGGQKQRVSLARAVYCDCSVYLLDDPLSAVDAHVGKHIFEKVIGPQGVLQGRTRVLVTHGLSFLPQADLILVMVD-GEITETGSYTELLNRQGAFADFLRTYANAEQDGEPDGMTEEGGEQEEESGQSEDGAPRKTLENGGPAAVLRQSQSSLNTPGAAKPQQKAESNDTQAKKTKSPDAAKLTEADKANTGRVKLAVFWEYMKAIGVFLSFISILLFLAHHVSSLGSNYWLSLWTD------DPVINGTQPSREMRLGVYGALGLSQGIAVFCYSISVSIGGILASRYLHETMLYNVLRSPMSFFERTPSGNLVNRFAKETDTIDSVIPSIIKMFMGSMFNVLGSCAVILIATPLVAIIIPPLGLLYFFVQRFYVASSRQLKRLESVSRSPVYTHFNETLLGTSVIRAFGEQQRFIGESDRRVDHNQKAYFPSIVANRWLAVRLEFVGNCIVTFAALFAVMARANLSPGIMGLSISYALQVTASLNWLVRMSSEVETNIVAVERVKEYEDTEKEAEWKLEQSSVPAGWPTAGHIEVRNFGLRYREDLELAIHDITVIIEGGEKVGIVGRTGAGKSSLTLGLFRIIEAAQGEICIDGVNIANLGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDGYSDEDVWRALELAHLKNFVSGLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDNLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVLVLDKGKMAEFDSPASLIAKKGIFYK 1523          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000030862.1 (canalicular multispecific organic anion transporter 1-like [Source:NCBI gene;Acc:103026251])

HSP 1 Score: 812.757 bits (2098), Expect = 0.000e+0
Identity = 516/1363 (37.86%), Postives = 803/1363 (58.91%), Query Frame = 2
Query:   29 ENPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPN--------------------------IESEIHDIEDKKCLIGKKNFNE------EFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAX----XXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLN---ESSDKVDKNQ-------------------NNLIQPSAPNK--RKRSRLSTSGSQGFDGNENAEENYEKYFND-----ISHEEEIMSGRVSLNSIVWYFKATGIFVFG-SSILACVIFGVLQAF--GNVWLGMLA-DTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKHE 3910
            ++PE  +  LS+IT+ W ++ I+  ++  +  E  ++L+  ++++  S +  + +K+ LR  +                          I  ++  + D+     KK+  E      E  Y   ++I S+ + +  ++    +LK+ +D+L    P +LKLL+ + ++K + +TW+G L A     +   Q +F       CF    K+ +RVRAA+   +YKK L LS +AR   + G +V + S D ++      +  +  SCP QI+L++  L++ELG S+ AG+  +  ++P+N ++   S+ +  + +++KDKRM +L EI  G+KI+K+YAWE  F  +++  R  E++ +R  +    + + ++   P FV   +F  F+    ++++  EK F S+ LFN L+ P+ +LP  +S  +   VS  R+E FL    +E+ +  ++ R +S  + + +++G+FSW  DG P L N++L V    L+AVVG VG GKSSL+SA+LGEM++L+G+V  +G +AYVPQ+AW+QN TLR+N+L     ++  + +VL+AC LE D++ LP   QTEIGE+G+NLSGGQKQRVSLARAVY  +DIYLLDDPLSAVD +VG+ LF K+I  +GLLK KTR+LVTHG+ +LP+VDEI V+ D G +SE G+Y  L      F  FL+   +  D  D+NQ                   NN+    + +   +K S    S S     N N  +  E   ++     +   E + +GRV  +  + Y  + G   +G +S+ A V F    AF   N+WL     D     N S++       +  +  YG +G+ Q   V +       G + AS+ +HS LL  +LR+ + FF+ TPSGR++NRF KD+F +D  +   +  +I + + L+ +LV+I +  P F  V +P++I Y  ++ FY+++SRQ RRLDS + S + +   ET SG S+IR+   +  F       ID + K      +S RW+ +RL++LGNL+VF S +FAV++R SL + LVGLSISYAL VT  LN L R  ++ ET+ VS+ER+++Y  IP E+   +    +E+W S G I  +++ ++Y   L  VL  IT +I+  EKIG+VGRTGAGKSSL   LFR++E   GRI IDG NI S+GLH LR +LTI+PQDPV+FSG+L+ NLDPF++++D+ + K L+++ + ++VNSL  G+ ++    G NLS+GQ+QL+CLAR LL+KSKI+ILDEATA+VD ETD  +   I+ +F   TV+ IAHR+ TI+D  +++ LD G I+EFG P  LL    GHF ALA+     K E
Sbjct:  206 KSPEVGAPFLSRITFNWFNRMIFTGYRRPLVQEDMWELSEKDSTNFISREFEEMMKQELRKAHSRLQKKKMKMKKISRPEHQQNGLNKGISQDVLVLVDQSEKSEKKSKRENNLDSGEEDYPHSWLILSIAKTFKWVLLESAVLKLVQDLLSFVSPQLLKLLIGFTQDKSV-FTWRGYLYASLLLIVAIVQSVFLQQFTQRCF----KLGMRVRAAISAAVYKKALTLSNDARKESTIGQMVTLMSADAQRFNEVTNFIHLLWSCPVQIVLSVGFLWIELGPSVLAGLLVMILMVPINGLLAIKSKSYQAKCMMYKDKRMKMLNEILSGIKILKLYAWEPSFEAQVQGFRKQELEVMRKSAFLSSVSTFIFFCAPAFVSLASFAVFVSVSTDNILDAEKAFTSISLFNILRTPLGMLPLLISAMVQMSVSNRRLEKFL---SREDLNTGAVQRDLSYSSAVSVRDGTFSWNRDGSPVLKNVSLQVSPGALVAVVGAVGSGKSSLVSALLGEMHSLSGSVNIKGDVAYVPQQAWVQNATLRDNVLFGSDPDERRFCRVLEACALEPDLDLLPAGVQTEIGEKGINLSGGQKQRVSLARAVYSSADIYLLDDPLSAVDAHVGKHLFEKVIGPRGLLKDKTRILVTHGISFLPYVDEIVVLVD-GVVSEVGSYSSLRASKGAFSEFLDTYAKEEDSQDQNQSASGSQQVSVGVEHHDLPLNNIKTEDSVSLLLKKESVKHASNSNRDSQNRNVPQRSEGDADERKGRRLIESETVQTGRVKFSVYLQYLSSMG---WGYASMFAVVYFIQSLAFIGQNLWLSDWTNDALRYPNGSSYPAHIRDMR--VGAYGGLGVAQGFLVFVGTLLLADGAIHASRTLHSRLLSNILRAPMLFFDTTPSGRVVNRFAKDMFTVDELIPTALRSVILKLLELLATLVLICLAVPLFTAVVVPLIIIYHFVERFYLTTSRQLRRLDSVSRSPIYSLFGETVSGLSVIRAFGHQERFLQQNRTTIDNNLKCVCQLIVSNRWMAIRLELLGNLVVFFSALFAVISRDSLDSGLVGLSISYALNVTLTLNALVRMTSQLETHVVSVERVKEYAEIPNEAAWTSERRPAEDWPSEGTIWFQDYKVRYRPQLDLVLHGITCHIHSKEKIGIVGRTGAGKSSLTNCLFRIIEAADGRILIDGENIASMGLHDLRSRLTIIPQDPVLFSGSLRMNLDPFEKFSDEDIWKVLDLAHLKEYVNSLEAGLQHEIAEGGENLSVGQRQLLCLARALLRKSKILILDEATAAVDLETDDLIQTTIRREFSHCTVLTIAHRINTILDSSRVMVLDAGRIVEFGPPDVLL-QKRGHFYALAKDAGICKTE 1553          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000043850.1 (canalicular multispecific organic anion transporter 1-like [Source:NCBI gene;Acc:103026251])

HSP 1 Score: 812.757 bits (2098), Expect = 0.000e+0
Identity = 516/1363 (37.86%), Postives = 803/1363 (58.91%), Query Frame = 2
Query:   29 ENPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPN--------------------------IESEIHDIEDKKCLIGKKNFNE------EFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAX----XXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLN---ESSDKVDKNQ-------------------NNLIQPSAPNK--RKRSRLSTSGSQGFDGNENAEENYEKYFND-----ISHEEEIMSGRVSLNSIVWYFKATGIFVFG-SSILACVIFGVLQAF--GNVWLGMLA-DTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKHE 3910
            ++PE  +  LS+IT+ W ++ I+  ++  +  E  ++L+  ++++  S +  + +K+ LR  +                          I  ++  + D+     KK+  E      E  Y   ++I S+ + +  ++    +LK+ +D+L    P +LKLL+ + ++K + +TW+G L A     +   Q +F       CF    K+ +RVRAA+   +YKK L LS +AR   + G +V + S D ++      +  +  SCP QI+L++  L++ELG S+ AG+  +  ++P+N ++   S+ +  + +++KDKRM +L EI  G+KI+K+YAWE  F  +++  R  E++ +R  +    + + ++   P FV   +F  F+    ++++  EK F S+ LFN L+ P+ +LP  +S  +   VS  R+E FL    +E+ +  ++ R +S  + + +++G+FSW  DG P L N++L V    L+AVVG VG GKSSL+SA+LGEM++L+G+V  +G +AYVPQ+AW+QN TLR+N+L     ++  + +VL+AC LE D++ LP   QTEIGE+G+NLSGGQKQRVSLARAVY  +DIYLLDDPLSAVD +VG+ LF K+I  +GLLK KTR+LVTHG+ +LP+VDEI V+ D G +SE G+Y  L      F  FL+   +  D  D+NQ                   NN+    + +   +K S    S S     N N  +  E   ++     +   E + +GRV  +  + Y  + G   +G +S+ A V F    AF   N+WL     D     N S++       +  +  YG +G+ Q   V +       G + AS+ +HS LL  +LR+ + FF+ TPSGR++NRF KD+F +D  +   +  +I + + L+ +LV+I +  P F  V +P++I Y  ++ FY+++SRQ RRLDS + S + +   ET SG S+IR+   +  F       ID + K      +S RW+ +RL++LGNL+VF S +FAV++R SL + LVGLSISYAL VT  LN L R  ++ ET+ VS+ER+++Y  IP E+   +    +E+W S G I  +++ ++Y   L  VL  IT +I+  EKIG+VGRTGAGKSSL   LFR++E   GRI IDG NI S+GLH LR +LTI+PQDPV+FSG+L+ NLDPF++++D+ + K L+++ + ++VNSL  G+ ++    G NLS+GQ+QL+CLAR LL+KSKI+ILDEATA+VD ETD  +   I+ +F   TV+ IAHR+ TI+D  +++ LD G I+EFG P  LL    GHF ALA+     K E
Sbjct:  211 KSPEVGAPFLSRITFNWFNRMIFTGYRRPLVQEDMWELSEKDSTNFISREFEEMMKQELRKAHSRLQKKKMKMKKISRPEHQQNGLNKGISQDVLVLVDQSEKSEKKSKRENNLDSGEEDYPHSWLILSIAKTFKWVLLESAVLKLVQDLLSFVSPQLLKLLIGFTQDKSV-FTWRGYLYASLLLIVAIVQSVFLQQFTQRCF----KLGMRVRAAISAAVYKKALTLSNDARKESTIGQMVTLMSADAQRFNEVTNFIHLLWSCPVQIVLSVGFLWIELGPSVLAGLLVMILMVPINGLLAIKSKSYQAKCMMYKDKRMKMLNEILSGIKILKLYAWEPSFEAQVQGFRKQELEVMRKSAFLSSVSTFIFFCAPAFVSLASFAVFVSVSTDNILDAEKAFTSISLFNILRTPLGMLPLLISAMVQMSVSNRRLEKFL---SREDLNTGAVQRDLSYSSAVSVRDGTFSWNRDGSPVLKNVSLQVSPGALVAVVGAVGSGKSSLVSALLGEMHSLSGSVNIKGDVAYVPQQAWVQNATLRDNVLFGSDPDERRFCRVLEACALEPDLDLLPAGVQTEIGEKGINLSGGQKQRVSLARAVYSSADIYLLDDPLSAVDAHVGKHLFEKVIGPRGLLKDKTRILVTHGISFLPYVDEIVVLVD-GVVSEVGSYSSLRASKGAFSEFLDTYAKEEDSQDQNQSASGSQQVSVGVEHHDLPLNNIKTEDSVSLLLKKESVKHASNSNRDSQNRNVPQRSEGDADERKGRRLIESETVQTGRVKFSVYLQYLSSMG---WGYASMFAVVYFIQSLAFIGQNLWLSDWTNDALRYPNGSSYPAHIRDMR--VGAYGGLGVAQGFLVFVGTLLLADGAIHASRTLHSRLLSNILRAPMLFFDTTPSGRVVNRFAKDMFTVDELIPTALRSVILKLLELLATLVLICLAVPLFTAVVVPLIIIYHFVERFYLTTSRQLRRLDSVSRSPIYSLFGETVSGLSVIRAFGHQERFLQQNRTTIDNNLKCVCQLIVSNRWMAIRLELLGNLVVFFSALFAVISRDSLDSGLVGLSISYALNVTLTLNALVRMTSQLETHVVSVERVKEYAEIPNEAAWTSERRPAEDWPSEGTIWFQDYKVRYRPQLDLVLHGITCHIHSKEKIGIVGRTGAGKSSLTNCLFRIIEAADGRILIDGENIASMGLHDLRSRLTIIPQDPVLFSGSLRMNLDPFEKFSDEDIWKVLDLAHLKEYVNSLEAGLQHEIAEGGENLSVGQRQLLCLARALLRKSKILILDEATAAVDLETDDLIQTTIRREFSHCTVLTIAHRINTILDSSRVMVLDAGRIVEFGPPDVLL-QKRGHFYALAKDAGICKTE 1558          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: abcc3 (ATP-binding cassette, sub-family C (CFTR/MRP), member 3 [Source:ZFIN;Acc:ZDB-GENE-050517-16])

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 463/1340 (34.55%), Postives = 737/1340 (55.00%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLK-YLKENLR----------SPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVD---MEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLN----------ESSDKVDKNQNNLIQPSAP-------------------NKRKRSRLSTSGSQGFDGN--------ENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGV--LQAFG-NVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWL-CLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNN-YISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE  +S +S++T+ W  +     ++  +K    + L + ++ S         + KE  R          +P    ++H  E  +            +     +I+++   + P    G + K+ +DIL    PL+L  L+ ++ +     TW G  +A L F   +  S+  +  F       +R+R+AL G++Y+K L ++  AR   + G++  + SVD   M  + N + + W   S P  I LA+  L+  LG S+ AGV  +  +IP N  I    R    + +  +D+R+  L+E   G++IIKMYAWE  F   I  +R  E+  +   +    + +  W   PF V   +F  ++    + ++  E+ FVSL LFN L+ P+  LP  +S+   A VS  R+ NFL   E +  + +  P  +     + I+ G+F+W+ D  P L++I+L V    L+AVVG VG GKSSL++A+LGE+  L G+V  +G++AYV Q+AWIQN +LR+N+L  +  ++ +Y +VL AC LE D+ +LP  D TEIGE+G+NLSGGQ+QRVSLARA+Y  + ++LLDDPLSAVD +VG+ +F ++I   GLL  +TRVLVTHGL +LP VD I V+   G++SE G+Y  LM  G  F   L           +S    D   + +I   +P                    + +R  +   GSQ   G+        E       +  + +   E + +G + L+ ++ Y +A G  +   S LA ++F        G NVWL   A           N ++ +  + +  Y  +G  Q +  ++       G LRA+  +H  LLD  L S + F++ TP GRI+NRF+KD+F+ID  L       +      I ++++I I TP F +  IP+++ Y  +Q FY+++SRQ +RL+S   S V +H  E+ +G++ +R+   E  F     R +D   +      +S R +  + L+ LG  +V  + +FAVL+R SL A  VGLS+SYA+QVT +++W+ R  +E E+N V++ER+++Y+  P E+  E  +     +W S G++   ++S +Y   L  VL+NI+ +I GGEK+G+VGRTGAGKSSL L L R+VE  SG I IDGV+I+ IGLH LR ++TI+PQDPV+F G+L+ NLDPF  ++D ++ ++LE + + +   +L  G+ ++C   G N S+GQ+QL CLAR LL+++++++LDEATA+VD ETD  +   I+  F + TV+ IAHRL T++DC +++ L  G I+EF SP  LLS     F  +A+
Sbjct:  190 PEVGASFISRLTFCWFTRMAVNGYRRGLKMSDLWSLRHKDSCSFVVPHLQAVWRKEQARIAQRSAVSQSTPAETRKLHTTEKSQSGGAGTEGGATGQEPS--LIRAMALAFGPRYLVGSVYKLLQDILSFASPLLLSHLIRFVGDNSRP-TWHGYALAGLMFLCAIATSMLAHQHFHAGFVTGIRLRSALTGLLYRKALMITQAARLSCAGGELTTLMSVDVQHMADITNNLNFVW---SAPLHICLAMYFLWQHLGPSVLAGVAVMLLLIPFNAFIALNIRTLQAQIIKKRDERVRTLSEALSGVRIIKMYAWEGRFRDVILRVREHELAVLGRAAYFSMLSAFTWLCSPFLVALASFGVYVLVDEHHVLDAERAFVSLALFNLLRYPLNQLPQLMSELAMASVSLRRLRNFLSLEELDPHAVDRSPSHLRESC-VSIEGGTFTWSWDEPPILHDISLAVPRGCLLAVVGTVGSGKSSLMAALLGELNKLGGSVAVKGQVAYVAQQAWIQN-SLRDNVLFGRPLDETWYREVLQACALEQDLLALPAGDNTEIGEKGINLSGGQRQRVSLARAIYSKASVFLLDDPLSAVDAHVGKHIFERVIGPSGLLAGQTRVLVTHGLSFLPHVDRIVVLT-AGRVSESGSYSELMLSGEAFSELLRIHGQGDGAGEDSPASQDDGPHVIIDLRSPGPDEVLSTCSNIADMEPVMTEPRRMLMRQLGSQEASGSGTTQGVSTETRGHKETQPGSTLMQPESMETGHMKLSVVLHYLRAVGAPL---STLALLLFCANYTTMLGTNVWLSEWA------GEPVVNGTQRNTGYRLGVYSALGAVQSVLSLVMVLMVFKGCLRAAGSLHLALLDNKLHSPISFYDVTPLGRIINRFSKDVFMIDEVLPPTFLMFLGALCNSIFTILIIVISTPVFVVAAIPLVVIYFFVQRFYVATSRQLKRLESTVRSPVFSHFGESVAGAATLRAFRQEERFVIAGDRAVDALQRTSYPSIVSQRRVGAVWLEFLGACVVLFAAMFAVLSRDSLKAGTVGLSVSYAMQVTVVMSWMVRMSSEVESNIVAVERVKEYSETPPEADWEVESCRPPADWPSQGHVEFRDYSTRYREGLDLVLRNISCDIKGGEKVGIVGRTGAGKSSLTLCLLRMVEAASGAIAIDGVDISRIGLHDLRSRITIIPQDPVLFGGSLRDNLDPFGHHSDAEVWEALEFAHLGETARALPGGIQHECAEGGENFSVGQRQLACLARALLRRTRVLVLDEATAAVDVETDALIQGTIRTHFHACTVLTIAHRLHTVLDCTRVMVLSSGQIVEFDSPDVLLSRKDSAFHKMAR 1511          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ABCC8 (ATP binding cassette subfamily C member 8 [Source:HGNC Symbol;Acc:HGNC:59])

HSP 1 Score: 544.273 bits (1401), Expect = 1.669e-168
Identity = 374/1212 (30.86%), Postives = 629/1212 (51.90%), Query Frame = 2
Query:  551 VRVRAALCGMIYKKTLRLSTEA--RSIHSAGDIVNMASVDMEQVMNAITYSWIFISCP------FQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFV-PNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNN----SMPRKMS--------------PGAP------------------------IEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTV--------------------------QTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTR--VLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDK--NQNNLIQPSAPNKRKRSRLSTSGSQ-----GFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYI-------NCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRF--SLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETN--NYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADE 3895
            ++ RAA+  MIY K L LST +  R   ++  I N+ +VD  Q+M      W    CP       QII+ + LLY  LG S   G   I  + PL   I     +  +  L     R+   +E+ HG+K++K+YAWE+ F   +EE R+ E++++   ++   + + +   +P   +  TF  +++   P+  ++P   F SL LF+ L  P+ LL   +  A+ AL+S  ++  FL  SE  ++ N       P+K S              P  P                        I++  G F+W       L +IN+ + + +L  VVG++G GKSSLLSA LGEM+ ++G+V                          +  G +AY  Q+ WI N+ ++ NI     FN+  Y  V++ C L+ DI+ LP  D+T+IGE+G+NLS GQ+QR+S+ARA+YQ +++  LDDP +A+D+++   L +  I   GLL + TR  VLVTH L++L   D I  + D G +   GT + +     E      E  +K D+   +  +I+     +RK  R +    +      F+  EN   +  ++F+ +SH   ++ G + L     Y  A+G  +    +L+ +   V  A  + WL M   T   LN +  N +  S+   +       + + ++    ++  ++      + GL+A++ +H  LL  ++R+ L+FF+ TP G ILNRF+ DL +ID  +  +   ++  ++  ++++ VI+ VTP F +  +P+ + +  +Q  +  +S+  + LD      +L H+MET  G + IR+   ES F    +  ID +N   L    + RWL +R+D +G  IV  + + ++   F   L + LVGL ++YAL V+  LNW+ R  A+ E    +I+R+     + +E    +   + + E+W   G I +   S +Y+ +L   LKN++  I  G+K+G+ GRTG+GKSSL+LALFR+++   G I ID V+I+ I L  LR +L+I+ QDPV+FSG+++ NLDP    TD  L  +LEI+ +   V +L  G++      G N S+GQ+QL CLAR  ++++ I+I+DEATA++D  T++ + + +   F   TV++IAHR+  I+D D ++ L+ G + E  SP  LL+N    F +L ++++
Sbjct:  384 IKFRAAVQTMIYDKILHLSTSSVSRGKMTSRYISNVVTVDSNQLM------WFLFLCPNLWALPVQIIVGVSLLYSLLGVSALIGAAVIALLAPLQYCIATKLARAQKLTLEHSSSRIKQTSELVHGIKLLKLYAWEQVFCSTVEETRSKELRSLSTFAIYTALSTFMNAAIPITAVMATFVTYVHLSSPDITLSPAVAFASLALFHILVTPLFLLSTVVRFAVKALISMQKLTEFLATSEIGDEPNTLDVEPRPKKSSNADVVQMMAVNRKQPQKPVWDDFEPPQDWRQFEFTDGSEDFAIKVTGGVFTWASSEPSLLTDINICIPHGQLTMVVGQIGCGKSSLLSATLGEMHLVSGSVYWNSSPRQQSVNTKNNRQERRASTFCRRRGSVAYAAQKPWILNSNVQENITFGSPFNEERYKAVINTCSLQPDIDILPQGDRTQIGEKGINLSAGQRQRISVARALYQHTNVVFLDDPFTALDIHLSDHLMHSGI--LGLLHNDTRTVVLVTHKLQYLTHADWIIAMKD-GTVQREGTLKDIQTSDPELYEMWKELMNKQDEELQKETIIESRTALERKNLRRAMYSKEVLVKTSFEDEENGINS--EHFDSMSH---LLPG-LPLGEWRSYLAASGWPLLLLIVLSQLCKHVSMAAPDFWLAMW--TSRALNVTAQNHNCTSSSVCLCLQSLLASIFAVLCCLAVVMCLISSLAVEWVGLKAARGLHKRLLGRIVRAPLRFFDTTPLGSILNRFSADLHMIDQLIPSSTESLVRSSLFSLSAVSVIAYVTPIFLVALVPLALVHYFIQKHFRIASKDLQELDENTKLPLLLHIMETVDGIATIRAFRHESQFRQRIFELIDANNVPFLFLSAANRWLEVRMDYIGASIVLATAMASITRSFYSGLDSGLVGLGLTYALLVSIYLNWVVRNLADIEVQLQAIKRVNNLMKVEIEDDERSPELHAVPEDWPHRGEIKINRLSARYDASLKPALKNLSSVIQPGQKVGICGRTGSGKSSLSLALFRMLDIFDGSITIDDVDISKIPLSLLRSRLSIILQDPVLFSGSIRFNLDPEARSTDSMLWDALEIAQLKCVVKALPGGLDATVREGGENFSLGQRQLFCLARAFVRQTAILIMDEATAALDMATEKILQKVVMTAFADRTVVMIAHRVANILDADVVLVLNQGLLEENDSPANLLANPDTIFSSLVKSNK 1578          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006454.1 (pep scaffold:Pmarinus_7.0:GL483531:32:7621:1 gene:ENSPMAG00000005809.1 transcript:ENSPMAT00000006454.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 353.984 bits (907), Expect = 1.865e-109
Identity = 185/495 (37.37%), Postives = 301/495 (60.81%), Query Frame = 2
Query: 2435 RASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQY-LSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINE-TNNYISEN-----WVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAG-KSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADE 3895
            RAS ++H  L   VLRS++  F+ TP+GR+LNRF++D+  +D  +       I   +L++  L VI+ V PWF +  IP+ + ++++        R+ +RLD+ + S  ++H+  +  G   I +     +F   +Y+ +  +N+  L  +  ++RWL +RLDI+   ++  + +  VL    + A+  GL+ISYA+Q+TG   +  R  +E E    S+ERI+ Y    +E++ E   +++ E      W  +G+++ ++  ++Y   LP VLK +T NI   E +G+VGRTG+G KSSL + LFRLVE C G I IDGV I  IGL  LR +L+I+PQ+PV+F GT++ NLDP   YTD+++ ++LE + M D +  L + +  +    G N S+G++QL+C+AR +L+ SKI++LDEATA++D ETD  + E I+  F   T++ IAHRL T++ CD+I+ +D G ++EF SP  LL N +  F A+  A E
Sbjct:    6 RASSRLHDSLFLKVLRSSMTVFDTTPTGRLLNRFSRDMDEVDVRMPFQAELFIQNVILVLFCLGVIAAVFPWFLLAVIPLCVLFLIINKISRVFIRELKRLDNISHSPFMSHVAASLQGLPTIHAYSKSDEFLH-RYQELLDTNQACLFLFSCAVRWLAVRLDIISVALITTTALMMVLMHGQIPAAYAGLAISYAIQLTGTFQFTIRLASETEARFTSVERIQHY----IEALEEEAPDHVPEKPLAAEWPQHGSVSFQDVEMRYREGLPLVLKRVTANIKPRENVGIVGRTGSGCKSSLGVCLFRLVELCGGSISIDGVPIGDIGLGDLRSRLSIIPQEPVLFIGTIRTNLDPLGLYTDEQIWEALERTHMKDNIGQLPQKLETEVVENGENFSVGERQLLCVARAILRHSKILLLDEATAAIDTETDTLIQETIRRAFGDCTMLTIAHRLNTVLSCDRIMVMDQGQVVEFDSPSTLLENRASRFAAMMVAGE 495          

HSP 2 Score: 87.8113 bits (216), Expect = 5.244e-18
Identity = 126/491 (25.66%), Postives = 215/491 (43.79%), Query Frame = 2
Query:  548 TVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXX-GYSIFAGVTA--IGAVIPLNI---IIMKFSRKFSERELLFKD-----KRMSILTEIFHGMKIIKMYAWEKCFNKKIEEI--RNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTE------DGRP-TLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTL-NGTVQTEG-------------KIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISE 1918
            T+R  + L   ++ K LR S         G ++N  S DM++V          +  PFQ  L I  + L L    + A V    + AVIPL +   II K SR F  REL   D       MS +     G+  I  Y+    F  + +E+   N     + + +V W  ++V  D++   V  IT T  +  + +  I      +++     L           S+  +   S  RI++++ A E+E  + + +P K  P A    Q+GS S+ +      +G P  L  +  N++ ++ + +VGR G G  S L   L  +  L  G++  +G             +++ +PQE  +   T+R N+     +      + L+   ++ +I  LP + +TE+ E G N S G++Q + +ARA+ + S I LLD+  +A+D     +L  + I         T + + H L  +   D I V+ DQGQ+ E
Sbjct:    4 TLRASSRLHDSLFLKVLRSSMTVFDTTPTGRLLNRFSRDMDEVD---------VRMPFQAELFIQNVILVLFCLGVIAAVFPWFLLAVIPLCVLFLIINKISRVFI-RELKRLDNISHSPFMSHVAASLQGLPTIHAYSKSDEFLHRYQELLDTNQACLFLFSCAVRW--LAVRLDIIS--VALITTTALMMVLMHGQIPAAYAGLAISYAIQLTGTFQFTIRLASETEARFTSVERIQHYIEALEEE--APDHVPEK--PLAAEWPQHGSVSFQDVEMRYREGLPLVLKRVTANIKPRENVGIVGRTGSGCKSSLGVCLFRLVELCGGSISIDGVPIGDIGLGDLRSRLSIIPQEPVLFIGTIRTNLDPLGLYTDEQIWEALERTHMKDNIGQLPQKLETEVVENGENFSVGERQLLCVARAILRHSKILLLDEATAAIDTET-DTLIQETIRRA--FGDCTMLTIAHRLNTVLSCDRIMVM-DQGQVVE 472          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007076.1 (pep scaffold:Pmarinus_7.0:GL480539:10051:22495:1 gene:ENSPMAG00000006379.1 transcript:ENSPMAT00000007076.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 346.28 bits (887), Expect = 4.305e-106
Identity = 193/523 (36.90%), Postives = 305/523 (58.32%), Query Frame = 2
Query: 2303 LLNNSTFNQSRNSA---KFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRF--SLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSN 3856
            LL +  +  S N +   +FY++ YG +  G  +  +L    F +GG+ A+K IH  LL  VL++ + FF+ATP+GRI+NRF+ DLF +D +L   +   + +   L+ ++VV+    PW  +V +P+   Y  +Q +Y  +SR+ +RL S   S + +H  E+ SG +II++  A   F       ++ + + +      + WL +RL ++G +IV      AVL      +   LVGL+I+YAL + G L+ L     + ET  VS+ER+++Y  I  E  +    ++S +W   G +  +   L Y   LP  L  I+  IN  EK+G+VGRTG+GKS+L   LFR+V+   G I+ID  +I+ + L QLR  L I+PQDP +FS T++ NLDP   Y D +L + LE   +  +V     G+  +    G + S GQ+QL+CLAR +L K+KI+ +DEATASVD++TD  + + I+ +FV+STV+ IAHR  TI+D D+++ L  G ++EF SP +LL +
Sbjct:    2 LLLSPPYRSSANGSDPVQFYLSVYGALAAGNTVFTLLRAFLFAYGGVCAAKNIHVTLLHKVLQAPVSFFDATPTGRIMNRFSSDLFTVDDSLPFIMNIFMAQLFGLVGAIVVMCYGLPWMALVLLPLAGVYYCVQKYYRFTSRELKRLGSVTLSPIYSHFAESLSGLAIIKAFRATDRFTRENEARLELNQRCQFAAVAVMHWLDVRLQMMGVVIVVSLAALAVLEHHLRGVDPGLVGLAIAYALGINGRLSGLVSSFTQTETQMVSVERVQEYRGIASEEAHRHPTHVSPDWPQGGALTFDKVFLTYRPGLPFALNGISFCINSWEKVGIVGRTGSGKSTLFSVLFRIVDVQHGAIYIDNQDISKLALKQLRSNLAIIPQDPFLFSDTVRNNLDPKGSYQDHELWEVLEKCHLKSFVLD-QGGLQAEVAERGRDFSCGQRQLLCLARAMLFKAKILCIDEATASVDQDTDVLLQKTIRSEFVNSTVLTIAHRPNTILDSDRVLVLQGGRVLEFASPHDLLQD 523          

HSP 2 Score: 76.2554 bits (186), Expect = 2.318e-14
Identity = 77/291 (26.46%), Postives = 137/291 (47.08%), Query Frame = 2
Query: 1184 SQAISALVSFGRIENFL-LASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTE------DGRP-TLNNINLNVENQKLIAVVGRVGVGKSSLLSAIL-------GEMYTLNGTV------QTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLE---YDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGL------LKHKT-------RVLVTHGLKWLPFVDEICVIND-QGQISERGTYEHLM 1942
            +Q  + +VS  R++ +  +ASE+ +      P  +SP  P   Q G+ ++ +       G P  LN I+  + + + + +VGR G GKS+L S +        G +Y  N  +      Q    +A +PQ+ ++ ++T+RNN+    S+      +VL+ C L+    D   L    Q E+ ERG + S GQ+Q + LARA+   + I  +D+  ++VD +    L  K I ++ +      + H+        RVLV  G + L F     ++ D +  +S   +  HL+
Sbjct:  260 TQTETQMVSVERVQEYRGIASEEAHRH----PTHVSPDWP---QGGALTFDKVFLTYRPGLPFALNGISFCINSWEKVGIVGRTGSGKSTLFSVLFRIVDVQHGAIYIDNQDISKLALKQLRSNLAIIPQDPFLFSDTVRNNLDPKGSYQDHELWEVLEKCHLKSFVLDQGGL----QAEVAERGRDFSCGQRQLLCLARAMLFKAKILCIDEATASVDQDT-DVLLQKTIRSEFVNSTVLTIAHRPNTILDSDRVLVLQGGRVLEFASPHDLLQDPRSALSRLLSKSHLL 538          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001536.1 (pep scaffold:Pmarinus_7.0:GL479104:2125:31869:1 gene:ENSPMAG00000001392.1 transcript:ENSPMAT00000001536.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 323.553 bits (828), Expect = 4.132e-98
Identity = 172/491 (35.03%), Postives = 292/491 (59.47%), Query Frame = 2
Query: 2435 RASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRF--SLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINE--TNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADE 3895
            + ++ +H+ +L  ++ + +++F+ TP G ILNRF+ D  I+D  +   +  ++   +L +++L +I+ VTP F I  +P+ I Y  +Q ++  +SR  + LD      + +H  ET  G + IR+   E  F        D +N   L    + RWL +RLD +G  IV  + + ++ + +  +LS++ VGL ++YAL V+  LNW+ R  A+ E    +I+R+     I  ES +   +   + +NW  +G I +E  S++Y+  L  VLK++  +I   +K+G+ GRTG+GKSSL+LA FR+V+   GRI ID ++I  I LH LR +L+I+ QDP++FSG+++ NLDP     D  L ++L+I+ +   V +L  G++      G N S+GQ+QL CLAR  ++K+ I I+DEATAS+D  T+  + + +   F + TV+IIAHR+ TI+  D ++ L  GS++E+ +P  LL++ S  F +  +AD+
Sbjct:   30 KTARNVHNNMLKRIVLAPMRYFDTTPLGHILNRFSADTNIMDQQIPTTLESLMRSALLCLSALGIIAYVTPIFLIALVPLAIAYYFIQKYFRVASRDLQELDDSTQLPLFSHFSETVEGITTIRAFRHEVRFRQRLLELTDANNISYLFLSAANRWLEVRLDYIGACIVLIASVASITDSWNNTLSSARVGLCLTYALMVSNYLNWVVRNLADIEVQMGAIKRVNNLLQIETESYDGLLSQAQVPDNWPQSGEIKIEELSVRYDSTLKPVLKHVNAHIQPSQKVGICGRTGSGKSSLSLAFFRMVDTFEGRIIIDNIDIAKIPLHTLRSRLSIILQDPILFSGSIRFNLDPEAACGDGVLWEALDIAQLKHVVKALPGGLDAMVTENGENFSVGQRQLFCLARAFVRKTSIFIMDEATASIDMATESILQKVVMTAFANRTVVIIAHRVHTILTADLVMVLKRGSVLEYDTPSTLLAHDS-MFASFVRADK 519          

HSP 2 Score: 78.1814 bits (191), Expect = 6.046e-15
Identity = 62/268 (23.13%), Postives = 123/268 (45.90%), Query Frame = 2
Query: 1217 RIENFLLASEKEND---SNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEG-KIAYVP------------QEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL 1972
            R+ N L    +  D   S   +P        I+I+  S  +    +P L ++N +++  + + + GR G GKSSL  A    + T  G +  +   IA +P            Q+  + + ++R N+    +       + LD   L++ +++LP      + E G N S GQ+Q   LARA  + + I+++D+  +++D+   +S+  K++       ++T V++ H +  +   D + V+  +G + E  T   L+   + F SF+
Sbjct:  252 RVNNLLQIETESYDGLLSQAQVPDNWPQSGEIKIEELSVRYDSTLKPVLKHVNAHIQPSQKVGICGRTGSGKSSLSLAFFRMVDTFEGRIIIDNIDIAKIPLHTLRSRLSIILQDPILFSGSIRFNLDPEAACGDGVLWEALDIAQLKHVVKALPGGLDAMVTENGENFSVGQRQLFCLARAFVRKTSIFIMDEATASIDM-ATESILQKVVMTA--FANRTVVIIAHRVHTILTADLVMVLK-RGSVLEYDTPSTLLAHDSMFASFV 515          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YCF1 (Vacuolar glutathione S-conjugate transporter; ABC-C transporter of the ATP-binding cassette family; required for vacuole fusion; forms stable complexes with vacuole fusion machinery; regulates Vam7p recruitment to vacuoles; role in detoxifying metals (Cd, Hg, As); transports GSSG that is not immediately reduced in cytosol to vacuole; transports unconjugated bilirubin, selenodigluthatione, oxidized glutathione; similar to human cystic fibrosis protein CFTR [Source:SGD;Acc:S000002542])

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 461/1327 (34.74%), Postives = 728/1327 (54.86%), Query Frame = 2
Query:   32 NPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLR---SPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRND-EIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPG-APIEI-QNGSFSWTE--DGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEH------------LMDFGTEFKSFLNESSDKVDKNQNNLIQP------------------SAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXX-XXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAV--LNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES--INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLT-EGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKAL 3880
            NP + +++ S+IT+ WM   +   +++ + +   + L    +S E S+K  K  +  L+   +P++   I      K L+    F +       F    L R+         ++K   D           L      +       +G L+A   F  G   +   +  F       + +++AL  +IY+K+L LS EA  + S GDIVN+ SVD++++ +   +  +  S PFQII+ +  LY  LG S++ GV  +  ++PLN  +M+  +K  + ++ +KD+R  +++EI + +K +K+YAWEK + +K+EE+RN+ E+KN+  +     + S  +++VPF V   TF  F+Y   +  +T + +F +L LFN L  P++++P  L+  I A VS GR+  F    E + DS   +P+  + G   I I  + +F W    + +  L NIN   +   L  +VG+VG GK++LLS +LG+++ + G     G +AYV Q  WI N T++ NIL    ++  FY K + AC L  D+  L + D+T +GE+G++LSGGQK R+SLARAVY  +D YLLDDPL+AVD +V + L   ++   GLL  KT+VL T+ +  L   D I ++ D G+I+++GTY+             L ++G +     NE  D  + +      P                  S     +R+  +T GS  F  +EN           I+  E    G+V  N  + Y KA         IL  VI   L   GNVWL   ++      NS +  + N+A+ Y+  Y  +G+G  LA ++      +F  + ASK +H+++ ++VLR+ + FF  TP GRILNRF+ D++ +D  L    +      V +  ++ VI   T  F  + IP+ + YI  Q +Y+ +SR+ RRLDS   S + +H  ET  G + +R    +  F  I    ID +         + RWL  RL+++G++I+ G+   +V  L + +L+A +VGLS+SYALQ+T  LNW+ R   E ETN VS+ERI++Y  +  E+  I E +    E W S G+I   N+S +Y   L  VLK+I I+I   EK+G+VGRTGAGKSSL LALFR++E   G I ID + IN IGL+ LR +L+I+PQD  +F GT++ N+DP ++YTD+ + ++LE+S + + V S++ +G++      G NLS+GQ+QL+CLAR +L  SKI++LDEATA+VD ETD+ V E I+  F   T++ IAHRL TI+D D+II LD+G + EF SP +LLS++   F +L
Sbjct:  210 NPYDSANIFSRITFSWMSGLMKTGYEKYLVEADLYKLPRNFSSEELSQKLEKNWENELKQKSNPSLSWAICRTFGSKMLLAA--FFKAIHDVLAFTQPQLLRI---------LIKFVTDYNSERQDDHSSLQGFENNHPQKLPIVRGFLIAFAMFLVGFTQTSVLHQYFLNVFNTGMYIKSALTALIYQKSLVLSNEASGLSSTGDIVNLMSVDVQKLQDLTQWLNLIWSGPFQIIICLYSLYKLLGNSMWVGVIILVIMMPLNSFLMRIQKKLQKSQMKYKDERTRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLVSCCTFAVFVY-TEDRALTTDLVFPALTLFNLLSFPLMIIPMVLNSFIEASVSIGRLFTFFTNEELQPDSVQRLPKVKNIGDVAINIGDDATFLWQRKPEYKVALKNINFQAKKGNLTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHGSVAYVSQVPWIMNGTVKENILFGHRYDAEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSALSIADSIALL-DNGEITQQGTYDEITKDADSPLWKLLNNYGKKNNGKSNEFGDSSESSVRESSIPVEGELEQLQKLNDLDFGNSDAISLRRASDATLGSIDFGDDEN-----------IAKREHREQGKVKWNIYLEYAKACNPKSVCVFILFIVISMFLSVMGNVWLKHWSEV-----NSRYGSNPNAAR-YLAIYFALGIGSALATLIQTIVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFFVNAVKVTFTITVICATTWQFIFIIIPLSVFYIYYQQYYLRTSRELRRLDSITRSPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAFYPSINANRWLAYRLELIGSIIILGAATLSVFRLKQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSEAPLIVEGHRPPKE-WPSQGDIKFNNYSTRYRPELDLVLKHINIHIKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQDSQVFEGTVRENIDPINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFKDRTILTIAHRLNTIMDSDRIIVLDNGKVAEFDSPGQLLSDNKSLFYSL 1505          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YBT1 (Transporter of the ATP-binding cassette (ABC) family; involved in bile acid transport; negative regulator of vacuole fusion; regulates release of lumenal Ca2+ stores; similar to mammalian bile transporters; YBT1 has a paralog, VMR1, that arose from the whole genome duplication [Source:SGD;Acc:S000003971])

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 404/1236 (32.69%), Postives = 639/1236 (51.70%), Query Frame = 2
Query:  512 CENYCFAITSKITVRVRAALCGMIYKKTLR--LST-----------------------EARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSP-GAPIEIQNGSFSWTEDGRP-TLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTV----------------QTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFND-------------ISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVW---------------------LGMLADTQSLLNN----------STFNQ--SRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNM----------------------GTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            C+        ++ +R+++ +   IY K LR  +ST                       E+ S  + G I+N+ ++D  +V     Y   F+      ++A+ LLY  LG++   GV  I A++PLN  + K+     ++ L   D R+  L E F  ++IIK ++WE+ F K I  IR +E+  +   S+ W I S LW + P  V   +F ++IY     L TP   F +L LF  L+ P+  L   LS  + + VS  R+++FL     END+       + P G     +N + SW +D +   L ++N+  +  KL  V+G  G GK+SLL A+LGEMY LNG V                 T   IAY  Q AW+ N+T++NNIL    FN+  Y  V++AC L+ D E L   D TEIGE+G+ LSGGQKQRVSLARA+Y ++   LLDD LSAVD +    +++  I+   L++ +T +LV+H +       E+ V+ + G++ ++G    ++  G   +  L +SS  +    N+    +A +    S L     Q    N N+     K                 +  EE    G V L+   WY K  G +   S + +  +   L   G  W                     +  ++   S L +          S  NQ  S +S  +Y+  Y IIG  Q L            G+ AS+KI +++L+ VL S ++FF+ATP+GRI+NRF+KD+  ID  L   I       +  ++++++I+ +TP F  V I + I Y  +  FY++ SR+ +R +S + S +  H  ET  G + IR+   E  F       ID++NK     +++ RWL  R+D++G+L++FG+ +F + N  +L + + G+S++YA+  T    WL R  +E E N  S+ER+++Y  I  E  NE        W  +G I + + SL+Y  NLP V+KN++ +++   KIG+VGRTGAGKS++  ALFR +E  +G I ID ++I+ + L +LRR +TI+PQDP +FSGT+K NLDP+DE++D ++ ++L+   ++     L +G   +  N                       G+NLS GQ+QL+CLAR+LL+  KII+LDEATAS+D  +D ++ E I+ +F  ST++ IAHRL+++ID DKI+ +D G + E+  P  LL N    F ++ +
Sbjct:  410 CQAQALFFGRRVCIRMKSIIISEIYTKALRRKISTNKTKPSNEDPQEINDQKSINGDEESTSSANLGAIINLMAIDAFKVSEICGYLHSFLEAFVMTVVALALLYRLLGFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEENFEKDINTIRENELSLLLMRSIVWSISSFLWFVTPTIVTAASFAYYIYVQGEVLTTPVA-FTALSLFTLLRDPLDRLSDMLSFVVQSKVSLDRVQDFL----NENDTKKYDQLTIDPNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNEARYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGP-LMEDRTCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDMLQKGLFGEDELVKSS--ILSRANSSANLAAKSSTSLSNLPAVKEQQVSVNNNSSHFEAKKLQKSLRTEAERTEDGKLIKEETKEEGVVGLDVYKWYLKIFGGWKIVSFLASLFLIAQLLYIGQSWWVRAWASHNVIAKIIPRAQRAIAFISKKASHLIDWRGSSQISMASAENQPSSGHSTMYYLVLYLIIGFAQALLGAGKTILNFVAGINASRKIFNMILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFITPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDEGRFMQENLHKIDENNKPFFYLWVANRWLAFRIDMIGSLVIFGAGLFILFNINNLDSGMAGISLTYAISFTEGALWLVRLYSEVEMNMNSVERVKEYMEIEQEPYNEHKEIPPPQWPQDGKIEVNDLSLRYAPNLPRVIKNVSFSVDAQSKIGIVGRTGAGKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQIFEALKRVNLIS-EEQLQQGATRETSNEASSTNSENVNKFLDLSSEISEGGSNLSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQGSTILTIAHRLRSVIDYDKILVMDAGEVKEYDHPYSLLLNKQSAFYSMCE 1636          

HSP 2 Score: 74.3294 bits (181), Expect = 1.134e-13
Identity = 103/479 (21.50%), Postives = 203/479 (42.38%), Query Frame = 2
Query: 2516 GRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRW-----LCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGN-INLENFSLQYNI-NLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINS---IGLHQLRRQLTILPQDPVIFSGTLKRNL---DPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIE-AIKFQFVSS-TVIIIAHRLK-TIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIK 3904
            G I+N    D F +       +   +   V+ + +L ++  +  +  IVG+ I++  + L           ++ +   +   +  L E +    II+    E +FE  +  N  + N+  L+   S+ W     L      +     F   I+      +   +   LS+   L+    L+ L+   +    + VS++R++ +      + N+T  Y       NGN    EN ++ ++  N    LK++ I    G+   V+G TG+GK+SL +AL   +   +G++ +  +       +  +     +    Q   + + T+K N+    PF+E    +    +E  G+      L  G   + G  G  LS GQKQ + LAR L   ++ ++LD+  ++VD  T   + +  I    +   T I+++H +  T+ + + ++ L+DG + + G P ++L       K L   DE +K
Sbjct:  476 GAIINLMAIDAFKVSEICGY-LHSFLEAFVMTVVALALLYRLLGFAAIVGVLIIVAMLPLNYKLAKYIGDLQKKNLAVTDNRIQKLNEAFQAIRIIKYFSWEENFE--KDINTIRENELSLLLMRSIVWSISSFLWFVTPTIVTAASFAYYIYVQGEVLTTPVAFTALSLFTLLR--DPLDRLSDMLSFVVQSKVSLDRVQDFL-----NENDTKKYDQLTIDPNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYLLNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFNSPFNE---ARYKAVVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVDSHTASWIYDNCITGPLMEDRTCILVSHNIALTLRNAELVVLLEDGRVKDQGDPIDMLQ------KGLFGEDELVK 935          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: BPT1 (ABC type transmembrane transporter of MRP/CFTR family; found in vacuolar membrane, involved in the transport of unconjugated bilirubin and in heavy metal detoxification via glutathione conjugates, along with Ycf1p [Source:SGD;Acc:S000003938])

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 409/1213 (33.72%), Postives = 649/1213 (53.50%), Query Frame = 2
Query:  557 VRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRND-EIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGA------PIEIQNGSFSWTE----------------------DGRPTLNNIN-LNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQT--------EGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNK-LISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFG---TEFKSFLNESSDKVDKNQNNLIQPSAPNKR--------------------------------KRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQL-LAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLN---RFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVE--SINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLT------EGMNYDCGNM-----------GTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIK 3904
            +R +L  ++Y+K+LRL+   R+  S GDI+N+ SVD+ ++      +   I  P QII+ +  LY  LG ++  G+  +  ++P+N  + +  +K S+ ++ +KD R+  +TE+ + +K IK+YAWE+    ++  +RND E+KN R + +   ++   W+ VP  V   TF  F  F  +S ++P  +F SL LFN L   I  +P  ++  I   VS  R+++FLL+ E ++    S   ++ P A       IE+ N +F W                          +  L NI+    +   L+ VVGRVG GKS+ L AILG++  ++G+  +           +AY  QE+WI N ++R NIL    F++ +Y   + AC L  D++ LP+ D+T +GE+G++LSGGQK R+SLARAVY  +DIYLLDD LSAVD  V +++    LI    LLK+KT +L T+ +  L     I  + + G+I E+G YE +M+     ++ K  L E    +D    + +Q    ++                                 +R+ L+T   + F G   A+ +  K     + + E+  GRV     + Y KA G+       L  ++  V     N WL   +++         N S      ++  Y +IG+       +      ++  +R SKK+H  +  +V+RS + FF  TP GRI+NRF+ D+  +D  L    +      +  + +++++    PWF +  + +++ YI  Q FYI  SR+ +RL S + S +++ + E+ +G SII + +    F  + Y  I  +  F      + RWL +RL  +G  IV  + I A+     +  LS+ +VGL +SY+L+VTG L W+ R     ETN VS+ERI +Y  +P E  SIN       ENW S G I  +N+S +Y  NL  VL NI + I   EK+G+VGRTGAGKS+L+LALFR++E   G+I IDG++I+ IGL  LR  L I+PQD   F GT+K NLDPF+ Y++D+L +++E + +   +  +       +  N + GN+           G+NLS+GQ+QL+CLAR LL +SKI++LDEATASVD ETD+ + + I+ +F   T++ IAHR+ T++D DKII LD GS+ EF SP +LLS+ +  F +L +   Y+K
Sbjct:  365 IRGSLASLVYQKSLRLTLAERNEKSTGDILNLMSVDVLRIQRFFENAQTIIGAPIQIIVVLTSLYWLLGKAVIGGLVTMAIMMPINAFLSRKVKKLSKTQMKYKDMRIKTITELLNAIKSIKLYAWEEPMMARLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVTCSTFGLFSLF-SDSPLSPAIVFPSLSLFNILNSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDD----SFIERIDPSADERALPAIEMNNITFLWKSKEVLTSSQSGDNLRTDEESIIGSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLIIRSSSVAYCSQESWIMNASVRENILFGHKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTNTVSILKHSQMIYAL-ENGEIVEQGNYEDVMNRKNNTSKLKKLLEEFDSPIDNGNESDVQTEHRSESEVDEPLQLKVTESETEDEVVTESELELIKANSRRASLATLRPRPFVG---AQLDSVKKTAQKAEKTEV--GRVKTKIYLAYIKACGVLGVVLFFLFMILTRVFDLAENFWLKYWSESNEK------NGSNERVWMFVGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRIINRFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQTFYIVLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNVDFVFNFRSTNRWLSVRLQTIGATIVLATAILALATMNTKRQLSSGMVGLLMSYSLEVTGSLTWIVRTTVTIETNIVSVERIVEYCELPPEAQSINPEKR-PDENWPSKGGIEFKNYSTKYRENLDPVLNNINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIGLFDLRSHLAIIPQDAQAFEGTVKTNLDPFNRYSEDELKRAVEQAHLKPHLEKMLHSKPRGDDSNEEDGNVNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRREFKDRTILTIAHRIDTVLDSDKIIVLDQGSVREFDSPSKLLSDKTSIFYSLCEKGGYLK 1559          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: VMR1 (Vacuolar membrane protein; involved in multiple drug resistance and metal sensitivity; ATP-binding cassette (ABC) family member involved in drug transport; potential Cdc28p substrate; induced under respiratory conditions; VMR1 has a paralog, YBT1, that arose from the whole genome duplication [Source:SGD;Acc:S000001027])

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 397/1199 (33.11%), Postives = 641/1199 (53.46%), Query Frame = 2
Query:  512 CENYCFAITSKITVRVRAALCGMIYKKTLR--------LSTEARSIHS-AGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGA-PIEIQNGSFSWTEDGRPT----LNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTV-------------QTEG---KIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLS-TSGSQGFDGNENAEENYEKYFND--ISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWL---------------GMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISEN-----------WVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSL------------EISGMLDWVNSLTE---GMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            C +    ++ KI +R+RA L G IY K LR         S+++ SI +  G I+N+ S+D  +V     Y ++ +     II+ + LL+  LG S FAG++ I  + PLN ++     KF ++ L   D+R+S L E    ++I+K +AWE+    +I+ IR  E++++   S+ W + S LW + P  V  +TF    +     L  P   F +L LF  L+ P+  L   LS    + VS  RI +FL    + +D+       +SP    IE +N + +W E+        L  +N+  +  KL  ++G  G GKS+LL  +LGE+  ++G++               EG     AY  Q AW+ N+T++NNI+    +N+  Y KV+DAC L+ D+E LP  D TEIGE+G+ LSGGQKQR+SLARAVY  +   LLDD LSAVD +    ++   I+   L+K++T +LVTH +          ++ + G++  +GT   L   G  FK    + S +   N+ N  +  AP K    ++   + +  FD N         + ND  +  EEE  +G +S +   WY K  G F   +++ A  I   +      W                G   DT  L   +  ++++++A +Y+  Y +IG+ Q +            G+RAS+KI + LLD VL + ++FF+ TP GRI+NRF+KD+  +D  L   +   I   +   + + +I+++TP F  V + + + Y  +  +Y+++SR+ +RLDS   S +  H  ET  G   IR+   E  F       ID++N+      ++++W   R+D++G  IV  S  F +LN  ++ + L G+S++YA+  T    WL R  + FE N  S+ER+++Y+ I      E  NY+  +           W  +G I +EN SL+Y  NLP V++N++  ++   KIG+VGRTGAGKS++  ALFRL+E  +G I IDG +I+ I L  LRR +TI+PQDP++F+GT+K N+DP+DEY + K+ K+L            E+    +  NS       ++ +    G NLS G++QL+ +AR+LL++ KII+LDEAT+S+D ++D  +   I+ +F  ST++ IAHRL+++ID D+II +D G + E+  P ELL +  G F ++ +
Sbjct:  396 CNSQGQFVSDKICLRIRAILIGEIYAKGLRRRLFTSPKTSSDSDSISANLGTIINLISIDSFKVSELANYLYVTVQAVIMIIVVVGLLFNFLGVSAFAGISIILVMFPLNFLLANLLGKFQKQTLKCTDQRISKLNECLQNIRIVKYFAWERNIINEIKSIRQKELRSLLKKSLVWSVTSFLWFVTPTLVTGVTFAICTFVQHEDLNAPLA-FTTLSLFTLLKTPLDQLSNMLSFINQSKVSLKRISDFL----RMDDTEKYNQLTISPDKNKIEFKNATLTWNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSIIVPSLEPKHDLIPDCEGLTNSFAYCSQSAWLLNDTVKNNIIFDNFYNEDRYNKVIDACGLKRDLEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYENCITGP-LMKNRTCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITELQSKGL-FKEKYVQLSSRDSINEKNANRLKAPRKNDSQKIEPVTENINFDAN---------FVNDGQLIEEEEKSNGAISPDVYKWYLKFFGGFKALTALFALYITAQILFISQSWWIRHWVNDTNVRINAPGFAMDTLPLKGMTDSSKNKHNAFYYLTVYFLIGIIQAMLGGFKTMMTFLSGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVTIFCLIQCASIIFLITVITPRFLTVAVIVFVLYFFVGKWYLTASRELKRLDSITKSPIFQHFSETLVGVCTIRAFGDERRFILENMNKIDQNNRAFFYLSVTVKWFSFRVDMIGAFIVLASGSFILLNIANIDSGLAGISLTYAILFTDGALWLVRLYSTFEMNMNSVERLKEYSSI------EQENYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLPPVIRNVSFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSITIIPQDPILFAGTIKSNVDPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFNSTHNKFLNLHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRSEFNKSTILTIAHRLRSVIDYDRIIVMDAGEVKEYDRPSELLKDERGIFYSMCR 1572          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Match: YOR1 (Plasma membrane ATP-binding cassette (ABC) transporter; multidrug transporter mediates export of many different organic anions including oligomycin; homolog of human cystic fibrosis transmembrane receptor (CFTR) [Source:SGD;Acc:S000003513])

HSP 1 Score: 502.286 bits (1292), Expect = 4.633e-154
Identity = 351/1113 (31.54%), Postives = 566/1113 (50.85%), Query Frame = 2
Query:  860 LFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPG----APIEIQNGSFSWTED-----------------------------GRPT-----------------------------LNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL---NESSDKVDKNQNNLIQPSAPN-------------KRKRSRLSTSGSQG---FDGNENAEENYEKYFNDIS---HEEEIMS--GRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRN-SAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQY-TMIPVE-SINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGM-----LDWVNSLTEGMNYDCGNM------------GTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKAL 3880
            +F D R++++ E+ + +K+IK Y WE  + K I++IR  EI  +R + +    +  +   +P     +TF   +Y V      P  IF SL LF  L L +  LP  +   I  ++  GR+++ L A E  +D N  +  K SPG      +++ + SF W ED                             G+P+                               ++N +++  + I + G +G GKSSLL+A+ G M   +G V+  G +       WIQN ++R+NI+    FNK  Y +V+  C L+ D++ LP  D TEIGERG+ LSGGQK R++LAR+VY+  DIYL DD LSAVD  VG+ + ++ ++  G+L +KTR+L TH L  +     + V+   GQ+ + GT + L        + L   +++S+K D+ Q  ++                   K+K + +S + + G    DG+ +++E  E+  N IS   + E I +  G+    ++  Y     I V G++  +         F +VWL    +          N+ +N    FY+  Y        + +   +      G+ ASK ++   +  +L + + + + TP GRILNRFTKD   +D+ L  ++  + ++   ++   V+  +  PWF I    +L+ ++L+   Y SS R+ +RL++   SFV  +L E   G   I++  ++  F +     I+K N+   +  +  RW+ + LD++         +  V   F +SA+ VG+ ++Y LQ+ G+LN + R   + E +  S ER+  Y T +P+E S  +      E+W S G I  EN    Y   LP VLKN+ +NI  GEKIG+ GRTGAGKS++  AL+RL E  +G+I ID V+I+ +GL  LRR+L I+PQDPV+F GT+++NLDPF+E TDD+L  +L   G      L  V       N   G M            G+N S+G++QL+ L R L+++SKI+ILDEAT+SVD ETD ++   I  +F   T++ IAHRLKTI++ D+I+ L+ G + EF +P  L S     F+++
Sbjct:  382 IFTDARVTMMREVLNNIKMIKYYTWEDAYEKNIQDIRTKEISKVRKMQLSRNFLIAMAMSLPSIASLVTF-LAMYKVNKGGRQPGNIFASLSLFQVLSLQMFFLPIAIGTGIDMIIGLGRLQSLLEAPE--DDPNQMIEMKPSPGFDPKLALKMTHCSFEW-EDYELNDAIEEAKGEAKDEGKKNKKKRKDTWGKPSASTNKAKRLDNMLKDRDGPEDLEKTSFRGFKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNGDLLMCGY-PWIQNASVRDNIIFGSPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGERGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLT--GMLANKTRILATHQLSLIERASRVIVLGTDGQV-DIGTVDELKARNQTLINLLQFSSQNSEKEDEEQEAVVAGELGQLKYESEVKELTELKKKATEMSQTANSGKIVADGHTSSKE--ERAVNSISLKIYREYIKAAVGKWGFIALPLY----AILVVGTTFCSL--------FSSVWLSYWTE----------NKFKNRPPSFYMGLYSFFVFAAFIFMNGQFTILCAMGIMASKWLNLRAVKRILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESLRLMTSQFANIVGVCVMCIVYLPWFAIAIPFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQERFLAKSDFLINKMNEAGYLVVVLQRWVGIFLDMVAIAFALIITLLCVTRAFPISAASVGVLLTYVLQLPGLLNTILRAMTQTENDMNSAERLVTYATELPLEASYRKPEMTPPESWPSMGEIIFENVDFAYRPGLPIVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNELTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNLDPFNERTDDELWDALVRGGAIAKDDLPEVKLQKPDENGTHGKMHKFHLDQAVEEEGSNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDGKIQTRIVEEFGDCTILCIAHRLKTIVNYDRILVLEKGEVAEFDTPWTLFSQEDSIFRSM 1462          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO36474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SII0])

HSP 1 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 492/1232 (39.94%), Postives = 746/1232 (60.55%), Query Frame = 2
Query:  308 VIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASE-KENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLN------ESSD-------KVDKNQNNLI--------------QPSAPNKRKRSRLS---------TSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES--INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            ++K L  +++P  F     K+ +D   ++      L L     +  S +W+G + AL+ F    F S+  +  F I     ++++ AL G+IY K LRL++ +R+  +AGD+VN+ SVD ++V++  TY  +  S P QI++A+  LY  +G+SI AGV  +  +IP N+++ +FSRK   +++  KD R+ I+ EI +GMK++K+YAWE+ F  K+  IRN E+ +++N           +   PF V   TF   IY +  +++T    FV++ LFN L+ P+ +LP  +   + A VS  R+  FL   E  E + +  MP  +S  A I + +GSFSW   G+PTL+NINLN+ +  L+AVVG+VG GKS+LLSA+LGE   + G V  +G +AYVPQ+AWIQN TLR+N++  ++F+   Y K +  C LE D + LP  D TEIGERG+NLSGGQKQRV+LARAVY ++D+YLLDDPLSAVD +VG+ +F+K+I  +G L+ KTRVLVTHG+ +LP VD+I V+ D G++SE GTY+ L+     F  FL       +S D       +V +++ +++              +P     R+R R +         TS +   D     EE+ E   + +  EE+  +G V       Y K+ G+F+    IL  ++         +WL   +      +N T + +R+    Y+  Y   G  Q   V++      FG +RAS+ IH  LL  +  + + FF  TP GR++NRF+KDL+++D T+  + +  +   +  I +L  I+  TP F  V IP+ I Y+L+Q  Y++SSRQ +R++S + S +  +  ET SG+S IR+   +  F    Y  +D++        +S RWL LRL+ +GNLI+F + +FAV+ R S+ ++LVG+SI+YALQ+T  LN + RQ +E ETN VS+ER ++Y  +  E+  + E ++   + W   G I +E+F L+Y  NLP VLKNI+++I  GEKIG+VGRTGAGKS+L LALFR++E   GRI +D ++I+ +GL  LR  LTI+PQDPV+FSGTL+ NLDPFD Y+D+ L + LE+S +  + + L EG+ +     G NLS+GQ+QL+CLAR LL+KSK+++LDEATA+VD ETD  +   I+ +F   TV  IAHRL TI+D  +I+ LD G ++EF SP+ L++   G F  +AQ
Sbjct:    4 LMKVLFLIFWPQFFLAAFFKLIQD--SMSFVQPTILRLMISFVEGNSPSWEGYMYALIMFAAAAFQSILLHAYFHIVISAGIKIKTALTGLIYSKALRLNSVSRNKSTAGDMVNLMSVDAQRVLDMCTYINLLWSGPLQIVVALYFLYDTMGWSIVAGVVVMVLLIPFNLVVTRFSRKLQLKQMANKDSRIRIMNEILNGMKVLKLYAWEESFMAKVTGIRNQELHHLKNAMYLNAFFGFTFTCAPFLVSLATFA--IYVLTGNILTANNAFVAISLFNILRFPLTVLPNVIISYVQAQVSLKRLTKFLTLDELDETNVHKKMPSHISNQA-IHVDDGSFSWDVTGQPTLHNINLNIPDGSLVAVVGQVGCGKSTLLSALLGETEKVTGEVYVKGSVAYVPQQAWIQNATLRDNVIFGRNFDSRRYHKTIKVCALETDFDILPAGDMTEIGERGINLSGGQKQRVNLARAVYFNADVYLLDDPLSAVDSHVGKHIFDKVIGPRGKLRKKTRVLVTHGISFLPQVDQIVVLQD-GRVSEVGTYKELLANRGAFAEFLKTFAPEEKSGDAALKVLREVPEDEEDILVRLQAIGDEDEMFMEPEPQPIRRRGRANSVVTIGTTITSDTADTDCMTIMEEDRE--VDHMIGEEKAATGSVKWVVFWAYAKSIGVFIASIVILFMILSEGALVGSRIWLAAWS-----ADNDTSDATRD---MYLGGYAAFGFFQAFFVLVSSICLAFGSVRASRSIHDSLLIAIFHAPMSFFETTPLGRVVNRFSKDLYVVDDTVPRSTSGFLRTALSAIGTLFAITYATPLFLSVIIPLGIVYVLIQRLYVASSRQLKRIESVSKSPIYNNFFETISGTSTIRAYHQQQRFIRGNYYKVDENQLAYYPLVVSNRWLGLRLEFVGNLIIFFAALFAVVGRDSIESALVGMSITYALQITQTLNMMVRQTSELETNIVSVERTKEYADMETEAEWVVE-DSRPPKGWPDKGRIQIEDFDLRYRANLPLVLKNISVDIQPGEKIGIVGRTGAGKSTLTLALFRILESAGGRIVVDDLDISKMGLQDLRSSLTIIPQDPVLFSGTLRFNLDPFDAYSDEDLWEVLEVSHLKAFASGLPEGLLHPIAEGGENLSVGQRQLVCLARALLRKSKVLVLDEATAAVDLETDELIQNTIRTEFAERTVFTIAHRLNTIMDYSRILVLDKGFMMEFDSPQNLIAQ-RGIFYGMAQ 1217          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO35071 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMJ8])

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 398/1045 (38.09%), Postives = 608/1045 (58.18%), Query Frame = 2
Query:  446 SYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMS----ILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASE-KENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLST-----------SGSQG--------FDGNENAEENYE---------KYFNDISHEEEIMSGRVSLNSIVW---------------YFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES--INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQ 3430
            S +W+G + AL+ F    F S+  +  F I     ++++ AL G+IY K LRL++ +R+  +AGD+VN+ SVD ++V++  TY  +  S P QI++A+  LY  +G+SI AGV  +  +IP N+++ +FSRK    + +     +         ++   K++K+YAWE+ F  K+  IRN E+ +++N           +   PF V   TF   IY +  +++T    FV++ LFN L+ P+ +LP  +   + A VS  R+  FL   E  E + +  MP  +S  A I + +GSFSW   G+PTL+NINLN+    L+AVVG+VG GKS+LLSA+LGE   + G V  +G +AYVPQ+AWIQN TLR+N++  ++F+   Y K +  C LE D + LP  D TEIGERG+NLSGGQKQRV+LARAVY ++D+YLLDDPLSAVD +VG+ +F+K+I  +G L+ KTRVLVTHG+ +LP VD+I V+ D G++SE GTY+ L+     F  FL   + +         Q S P+  + +R+ +             SQG            E+  +N +         +YF   S   ++   +  ++SI W               Y K+ G+F+    IL  ++         +WL   +      +N T + +R+    Y+  Y   G  Q   V++      FG +RAS+ IH  LL  +  + + FF  TP GR++NRF+KDL+++D T+  + +  +   +  I +L  I+  TP F  V IP+ I Y+L+Q  Y++SSRQ +R++S + S +  +  ET SG+S IR+   +  F    Y  +D++        +S RWL LRL+ +GNLI+F + +FAV+ R S+ ++LVG+SI+YALQ+T  LN + RQ +E ETN VS+ER ++Y  +  E+  + E ++   + W   G I +E+F L+Y  NLP VLKNI+++I  GEKIG+VGRTGAGKS+L LALFR++E   GRI +D ++I+ +GL  LR  LTI+PQ
Sbjct:   13 SPSWEGYMYALIMFAAAAFQSILLHAYFHIVISAGIKIKTALTGLIYSKALRLNSVSRNKSTAGDMVNLMSVDAQRVLDMCTYINLLWSGPLQIVVALYFLYDTMGWSIVAGVVVMVLLIPFNLVVTRFSRKLQVCQFILIGVSLCQPPLCRCCLWGSCKVLKLYAWEESFMAKVTGIRNQELHHLKNAMYLNAFFGFTFTCAPFLVSLATFA--IYVLTGNILTANNAFVAISLFNILRFPLTVLPNVIISYVQAQVSLKRLTKFLTLDELDETNVHKKMPSHISNQA-IHVDDGSFSWDVTGQPTLHNINLNIPEGSLVAVVGQVGCGKSTLLSALLGETEKVTGEVYVKGSVAYVPQQAWIQNATLRDNVIFGRNFDSRRYHKTIKVCALETDFDILPAGDMTEIGERGINLSGGQKQRVNLARAVYFNADVYLLDDPLSAVDSHVGKHIFDKVIGPRGKLRKKTRVLVTHGISFLPQVDQIVVLQD-GRVSEVGTYKELLANRGAFAEFLKTFAPEEKSGDAAREQESCPDNSQGARVMSRQIAREQESCPDNSQGTRVMSRQIAREQESCPDNSQGTRRKTLRSRYFT--SKVAQLRHAK-PMDSITWSPYISFQVKWVVFWTYAKSIGVFIASIVILFMILSEGALVGSRIWLAAWSA-----DNDTSDATRD---MYLGGYAAFGFFQAFFVLVSSICLAFGSVRASRSIHDSLLIAIFHAPMSFFETTPLGRVVNRFSKDLYVVDDTVPRSTSGFLRTALSAIGTLFAITYATPLFLSVIIPLGIVYVLIQRLYVASSRQLKRIESVSKSPIYNNFFETISGTSTIRAYHQQQRFIRGNYYKVDENQLAYYPLVVSNRWLGLRLEFVGNLIIFFAALFAVVGRDSIESALVGMSITYALQITQTLNMMVRQTSELETNIVSVERTKEYADMETEAEWVVE-DSRPPKGWPDKGRIQIEDFDLRYRANLPLVLKNISVDIQPGEKIGIVGRTGAGKSTLTLALFRILESAGGRIVVDDLDISRMGLQDLRSSLTIIPQ 1041          

HSP 2 Score: 103.99 bits (258), Expect = 2.109e-22
Identity = 68/262 (25.95%), Postives = 134/262 (51.15%), Query Frame = 2
Query: 3083 VSIERIRQYTMIPVESINETNNYIS-ENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAI---KFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSN 3856
            VS++R+ ++  + ++ ++ETN +    + +SN  I++++ S  +++     L NI +NI  G  + VVG+ G GKS+L  AL    E  +G +++ G              +  +PQ   I + TL+ N+     +   +  K++++  +    + L  G   + G  G NLS GQKQ + LAR +   + + +LD+  ++VD    + + + +   + +    T +++ H +  +   D+I+ L DG + E G+ KELL+N
Sbjct:  268 VSLKRLTKF--LTLDELDETNVHKKMPSHISNQAIHVDDGSFSWDVTGQPTLHNINLNIPEGSLVAVVGQVGCGKSTLLSALLGETEKVTGEVYVKG-------------SVAYVPQQAWIQNATLRDNVIFGRNFDSRRYHKTIKVCALETDFDILPAGDMTEIGERGINLSGGQKQRVNLARAVYFNADVYLLDDPLSAVDSHVGKHIFDKVIGPRGKLRKKTRVLVTHGISFLPQVDQIVVLQDGRVSEVGTYKELLAN 514          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO41257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4U1])

HSP 1 Score: 590.882 bits (1522), Expect = 0.000e+0
Identity = 387/1160 (33.36%), Postives = 627/1160 (54.05%), Query Frame = 2
Query:  518 NYCFAITSKI-TVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWI--------FISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFT-FFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAIS-ALVSFGRIENFLLASEKENDS-NNSMPRKMSPGAPIEIQNGSFSWTED-GRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFN-----DISHEEEIMSGRVSLNSIVWYFKA-----TGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLN---------NSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLR-WLCLRLDILGNLIVFGSVIFAVLN----RFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            N  FA    +  +RVRAA   +IYKK L LS  A +  + G+++N+ S D ++      + W+         I  P ++ +  +LL+ ++G +  AGV  +  + P+ + +         + + + D+R+ I+ EI  GM++IKMY WE  F K I  +R +E+K    ++    I              I FT F +Y +   ++T  K+F  + LFN++++   L         + + VS  R E  LL  E  ++    S  R  +    + ++  S +W ++   PTL+ ++ +V +  L+ V+G VG GKSSLL+AILGE+    G+++ +G++AY  Q+AW+ N+TLR+NIL  K +++  Y  V+ AC L+ D E L   D+T +GERGV+LSGGQ+ R+SLARAVY D DIYLLDDPLSAVD NVG+ LF + I     LK K R+LVTH L++L   DEI V+  QGQ  ++GTY+ L    + F S L E  ++   N+++    S    R  S+  +          N  ++     +      +  EE    G VS  +   Y ++     TG+F+     + C +  V+  FG+VWL   A+ + + +         ++T + SR    +Y++ Y  +  G  +  ++    + +  + AS+ +H+ +  +++ + + FF+    GRILNRF+KD+ +ID  +   + D++      +  + +++   P    + +P++  +   + +++ SSR+ +R++    S +  H   T  G   IR+   E+ F   Q+     ++      YL+ + WL  RL  LG  +VF  ++F VL     +  LSA  VGL +SY++ +  +      + AE E    S+ER+ +YT +P E    T+     +W   G I  +N S  Y+ +LP VL N+T  I   EK+GVVGRTGAGKSSL   LFRL E   G I IDG+NI  +GL  LR +L+I+PQDPV+FSGT+++NLDPF E+ D  L K L+   +   V  L   ++ +    G+N S+GQ+QL+CLAR +L+ S+I+++DEATA+VD  TD  + E I+ +F   TV+ IAHRL TI+D D+++ LD G ++EF +P +LL   +  F  L +
Sbjct:  126 NVPFAFMKNVYGMRVRAACTALIYKKVLHLSRTALASTTTGNLINLVSADAQK------FDWVRLAPFLHYLILGPLEVGVVAVLLWYQIGPAALAGVGLLVCLAPMQVKMGNALMSLRGKAIHWMDERVKIMNEIIAGMRVIKMYTWEDSFAKLIMHLRKNELKWFLRMAY---IQGAFASFFFSSAGLIYFTTFLVYVLTGEVLTAAKVFTCVSLFNSVRIVCALFFPFAITLFNESRVSLKRFEEALLLDEMHSEGLVKSTLRPKAEECGVFVKKASATWNKEIAIPTLDGLSFDVPSGCLLGVIGAVGSGKSSLLNAILGELPLSEGSIRVQGRVAYASQQAWVYNSTLRHNILFGKEYDEHRYNDVIKACALDKDFELLSEGDETLVGERGVSLSGGQRARISLARAVYADGDIYLLDDPLSAVDANVGRHLFQECICTY--LKDKARILVTHQLQFLKDADEIMVLQ-QGQCIDKGTYQQLSRNDSGFLSLLAEEVEEETGNESDGDDGSTRFGRPVSKQLSVEEVVRKRAGNVVDSCMSIMSAATTLTLPPEETKQEGAVSRQTYAAYLRSFHDLGTGVFLIFLFAM-CQVRPVMLMFGDVWLANWANREEVYSMTLASWNASSNTTSPSRPDLHYYLSVYAALVFGLFVLCLICTMSYYWFTIVASRNLHNGMFHSLIHTNMHFFDNNSIGRILNRFSKDIGVIDDFMPWMLCDVLQIGFSCLGIMCLVAASNPVSIAIVLPVICLFFYFRNYFMKSSREMKRIEGINRSPLFGHFSTTLLGIDTIRAYGVEATFTD-QFNLFHDAHSRAWYAYLAGQAWLTCRLQALG--VVF--LLFIVLGLPALKDGLSAGTVGLILSYSIMLAKLFEPFVEESAEVENIMTSVERVVEYTSLPPEGEKVTDVIPPPDWPDKGKITFDNMSFSYHQSLPEVLHNVTCVIKPSEKVGVVGRTGAGKSSLLSTLFRLAEP-KGLIDIDGINIRKLGLKDLRSKLSIIPQDPVLFSGTMRKNLDPFSEHPDAGLWKVLDEVQLKQPVEDLPGKLDEELAEAGSNFSVGQRQLVCLARAILRHSRILVIDEATANVDPRTDALIQETIRDKFQDCTVLTIAHRLHTIMDSDRVMVLDAGRLVEFDAPYKLLKKRNTIFSGLVE 1266          

HSP 2 Score: 88.1965 bits (217), Expect = 1.960e-17
Identity = 74/281 (26.33%), Postives = 126/281 (44.84%), Query Frame = 2
Query: 1220 IENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEG-------------KIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISE-RGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQ 2020
            +E   L  E E  ++   P        I   N SFS+ +     L+N+   ++  + + VVGR G GKSSLLS +   +    G +  +G             K++ +PQ+  + + T+R N+            KVLD   L+  +E LP +   E+ E G N S GQ+Q V LARA+ + S I ++D+  + VD     +L  + I ++   +  T + + H L  +   D + V+ D G++ E    Y+ L    T F   + ++     K   ++ Q
Sbjct: 1006 VEYTSLPPEGEKVTDVIPPPDWPDKGKITFDNMSFSYHQSLPEVLHNVTCVIKPSEKVGVVGRTGAGKSSLLSTLF-RLAEPKGLIDIDGINIRKLGLKDLRSKLSIIPQDPVLFSGTMRKNLDPFSEHPDAGLWKVLDEVQLKQPVEDLPGKLDEELAEAGSNFSVGQRQLVCLARAILRHSRILVIDEATANVDPRT-DALIQETIRDK--FQDCTVLTIAHRLHTIMDSDRVMVL-DAGRLVEFDAPYKLLKKRNTIFSGLVEQTGGTEAKRLFDIAQ 1281          

HSP 3 Score: 78.1814 bits (191), Expect = 1.959e-14
Identity = 123/553 (22.24%), Postives = 226/553 (40.87%), Query Frame = 2
Query: 2330 SRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGI-----VGIPILICYILLQVFYISSSRQARRLDSKASSFV---LTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYL---SLRWLCLRLDILG----------NLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNG--------NINLENFSLQYN--INLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNL---DPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVI-EAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALA 3883
            ++  A  Y    G+ GL  LL  + F       G+R      +++   VL  +     +T +G ++N  + D    D    + +   ++  +L    + V++++  W+ I      G+ +L+C   +QV           L  KA  ++   +  + E  +G  +I+    E  F              KLI +L    L+W      I G           LI F + +  VL    L+A+ V   +S       + N +   CA F   A+++    + ++   E     +   SE  V +          + ++  S  +N  I +P  L  ++ ++  G  +GV+G  G+GKSSL  A+   +    G I + G             ++    Q   +++ TL+ N+     +DE+  + ++K+  +    +    L+EG     G  G +LS GQ+  I LAR +     I +LD+  ++VD    R +  E I         I++ H+L+ + D D+I+ L  G  I+ G+ ++L  N SG    LA
Sbjct:  104 TKKEAYLYAAGVGLCGLFILLFNVPFAFMKNVYGMRVRAACTALIYKKVLHLSRTALASTTTGNLINLVSADAQKFDW---VRLAPFLHYLILGPLEVGVVAVLL-WYQIGPAALAGVGLLVCLAPMQV---KMGNALMSLRGKAIHWMDERVKIMNEIIAGMRVIKMYTWEDSFA-------------KLIMHLRKNELKWFLRMAYIQGAFASFFFSSAGLIYFTTFLVYVLTGEVLTAAKVFTCVS-------LFNSVRIVCALFFPFAITLFNESRVSLKRFEEALLLDEMHSEGLVKSTLRPKAEECGVFVKKASATWNKEIAIP-TLDGLSFDVPSGCLLGVIGAVGSGKSSLLNAILGELPLSEGSIRVQG-------------RVAYASQQAWVYNSTLRHNILFGKEYDEHRYNDVIKACALDKDFEL---LSEGDETLVGERGVSLSGGQRARISLARAVYADGDIYLLDDPLSAVDANVGRHLFQECICTYLKDKARILVTHQLQFLKDADEIMVLQQGQCIDKGTYQQLSRNDSGFLSLLA 612          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO46846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RP39])

HSP 1 Score: 585.874 bits (1509), Expect = 0.000e+0
Identity = 409/1189 (34.40%), Postives = 636/1189 (53.49%), Query Frame = 2
Query:  542 KITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNI--RNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSW-----TEDGRPT-------------------LNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTV---QTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSL--LNNST-----------------------FNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNR--FSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQY-TMIPVESINETN----------------NYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQA 3889
            KI+ ++RAA+   +Y KTL +ST +    S+G+++N  S D ++V+N       F S PFQI +++ LLY ++G +  AG+     +IPLN  +    +K+S   +  KD R+ I+ EI +G+++IK YAWE  F  K+   RN E+K++  R     WC+    W   P  +  +TFT   Y +  + +T  K+F S+ LF  L  P+   PW ++  + A VS  R++ FL   E + D+        S G  ++I +G FSW      ++ + T                   L+ +NL++   +LI V+G VG GKSSLLSA+  EM  L G V     +G    V QE WIQ+ T++ NIL  K ++   Y  V++AC L  D++SLP  D TEIGE GVNLSGGQK RV LARAVYQ+  IYLLDDPL+AVD +V   L+   I+  GLL+HKT +L TH  K+L   D + V+++ G +   G    ++            SS+++      L Q S    R+RS     G +  + N +      +    +  EE    G V L+    Y++A G  +  S +L+ ++    +  G+ WL        +   +N+T                        N  +N+ KFY+  Y  I +   +  +     F +GG++A+K IH  LL ++L + + FF+ TP GRI+NRF+ D++ ID +L   +   + +   ++ SLV+     PW  ++  P++I Y  LQ +Y  +SR+ +R+ +   S +  H  ET +G S IR+L     F +     ++ + +    + ++  WL LRL  +G  I  G    AVL     ++   LVGL++SYAL VT  +  +    AE E   VS+ER  QY T IPVE    +                   +S +W ++G I   N  L Y   LP  L+N+++ I+ GEK+G+VGRTG+GKSSL L LFR+VE   G + +DGVNI S+ L +LR +L I+PQDP +FSG+++ N+DP+ + +D  L  +LE   +   V+ L  G++ + G  G N S GQ+QL+CLAR +L ++KI+ +DEATASVD ETDR +   I+  F +STV+ IAHR+ T++D D+++ ++ G++ EF  P  L++N +  F +L  +
Sbjct:  187 KISYKIRAAIITTVYHKTLAVSTTSLGKFSSGEVLNFMSTDTDRVVNFANSFHQFWSLPFQIAVSLYLLYQQVGLAFLAGLGFALLLIPLNRWLAIKIQKYSTEMMTQKDSRVKIMNEILYGIRVIKFYAWENNFKNKVNTFRNAELKSLKGRKYLDAWCVY--FWATTPIIISILTFT--TYVLMGNQLTAAKVFTSVALFQMLITPLNAFPWVINGMMEAWVSVKRLQAFLTLEELDPDNYYIYIPAQSAGDAVQIVDGHFSWRYKPPQQEAKETKDVENLAEIETEVKSTVGLLSGLNLSIRKGQLIGVIGGVGSGKSSLLSALTAEMDKLTGQVFVAGLDGGFGLVAQEPWIQHATVKENILFGKPYDVDKYSDVINACALREDLQSLPAGDDTEIGENGVNLSGGQKARVGLARAVYQNKSIYLLDDPLAAVDAHVAAHLYKHCIT--GLLRHKTVILCTHHTKFLSGADHVIVMSN-GTVMHSGPPSEIL------------SSERI------LRQISRDVSRERSLDGKEGGEDGEENADEPTGDGR----LVEEEAKDVGAVRLHVYGSYWRAIGHCLATSILLSLLLMQGSRTIGDWWLAYWISHSKIDHTDNATTITHHSHDSTHPEAPYAAPFLRGVNIKKNTLKFYLVVYAGIAVANTVFTLFRAFLFAYGGIKAAKTIHQRLLSSILAAPISFFDITPIGRIINRFSSDVYSIDDSLPFMLNIFLAQAYFVVASLVITCYGLPWMALLVAPLMIIYYYLQGYYRKTSRELKRIITVTESPIYAHFSETLTGLSTIRALRHTQRFRTENEERLEVNQRANYCEMVAYVWLVLRLQGIGVAINAGVAFLAVLEHHFHTVDPGLVGLAMSYALSVTQSIADMVNSFAETEKQMVSVERAEQYITRIPVEKPGGSKVCHAHILLLSSLSDISRLLSSSWPTHGRIRFHNIVLVYRPGLPPALRNVSLEIHAGEKVGIVGRTGSGKSSLFLVLFRMVEVAEGAVILDGVNIASLPLDKLRSRLAIIPQDPFLFSGSVRDNIDPWGKCSDRDLWITLERCHLQQPVSDLG-GLDAEVGERGRNFSAGQRQLVCLARAMLTRAKILCIDEATASVDMETDRFIQRTIREAFRTSTVLTIAHRIDTVMDSDRVLVMNKGTVTEFEKPDTLMANQNSLFYSLVHS 1345          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Match: EDO38355 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD35])

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 396/1165 (33.99%), Postives = 620/1165 (53.22%), Query Frame = 2
Query:  527 FAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVD---MEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSL----ITPEKIFVSXXXXXXXXXXXXXXXXXXSQAI-SALVSFGRIENFLLASEKENDSNNSMPRKMSPG--APIEIQNGSFSWTED-GRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRL---------STSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATG---------IFVFGSSILACVIFGVLQAFGNVWLGMLADTQ---SLL------NNSTFNQSRN---SAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILG----NLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            F  T +    +R A   M+Y+K + LS  A S  + G I+N+ + D   +E+V   + + WI    P  +++  ++ + ELG     GV  +  + PL   + K       +  L  DKR  I+ E+  GM++IKMY WE+ F   + ++R  E+  IR  +    + +V+      +VM I    F  F P  L    ++PEK+F  + LF ++++ + +      + +  + VS  R+++FL   EK +        ++  G  A ++  N S  W +    PTL  IN  ++   L+ VVG VG GKSSLL  +LGE+   +G +  +G+++Y  Q+AWI + ++R NIL  K + +  Y +V+ AC +E D+   PN  +T +GE+GV LSGGQK R++LARAVY D+DI LLDDPLSAVD +VG+ LF++ +   GLLK +  VLVTH L++L    +I  + D G+   +G+Y  L + G +  S ++  S     + +N+I P   N    S           +  G Q   GN +     E    + S E +  +G V+    + YFKA           + +FGS  +  V        G  WL   AD++   S L       NST     +       YI C G+I  G + +++     + F    AS+ +H  +   VLR+ + FF+  P GR++NRF KD+  +D  L     D + R  L +TSL+  S+  P+  +  IP+ + +  ++ +Y+ +SR+ +RL++   S V +HL  + +G   IR+ +AE  F    +   D       + + + RWL  RLDI+      L  F S +F V    S   ++VGL ++YA Q+TG+  W  RQ AE E N  S+ER+ +Y+ I  E          ++W   G I  E+    Y+ +LP VLKN+  +I   EK+G+VGRTGAGKSSL   LFRL     G + IDG+ I  + L  LR  ++I+PQDPV+FSGTL++NLDPF +++DD L  +LE   + + V+ L +G+  +    G+N S+GQ+QL+CLAR +L  +KI+++DEATA+VD  TD  + E I+ +F   TV+ IAHRL T++D D+++ LD G ++EF  P  LL NS G F  L +
Sbjct:  131 FFQTFRCGFHLRIACSTMVYRKAMCLSHSAYSTVTTGHIINLLTSDVQILERVAVFLHHLWI---APVLLLVTSVISWYELGPYCLPGVIVVVLIAPLQGWLGKKFAVIRNKTALQTDKRFRIMNEVISGMRVIKMYTWERPFANLVADVRRYEVSIIRKAAYLRSVNAVI------YVMCIPVIGFAMFAPYVLTGHALSPEKVFTVIALFYSIRVSLTIFLPECIRGLKESKVSAKRLQSFLERDEKHSMKGVRTLTELKEGETASVKANNFSARWNDMISTPTLQGINFELKPSDLLMVVGPVGAGKSSLLMCLLGELPLTSGYISVKGRVSYASQQAWIFSGSVRENILFGKEYEEAKYWRVIKACAMERDMRLFPNGYETLVGEKGVALSGGQKARINLARAVYYDADIVLLDDPLSAVDTHVGRQLFDECV--YGLLKDRICVLVTHQLQYLKGATDIICLQD-GRCVGQGSYAELSEAGLDVMSLVSALSAG---DHDNIISPDIINVPPSSAQFPVPLANGSTRPGYQKISGNVDDAPEGEVLAREPSKEGQ-HTGTVTWQVYIEYFKAGASPCVRFLIVMLLFGSQAVVMV--------GEWWLAKWADSEKEKSYLIESYRGTNSTPPPPADLTTHEYIYIYC-GMICAGMVTSLVCAMMLYNFFVT-ASQHLHDNMFSRVLRAPIYFFDTNPVGRVVNRFAKDINQMDDVLPAAFYDFL-RVSLNLTSLLGSSM--PFLLVGAIPMTVLFGYIRNYYLRTSREVKRLEAINRSPVYSHLSTSLTGLITIRAFQAEQAFIRSYHAYTDFHTGSYFLFHTTQRWLGFRLDIICASFFTLATFTS-LFIVEGGLS---NVVGLCLTYATQLTGMFQWCIRQSAEVENNMTSVERVIEYSQIDQEVEPSKPLTAPDDWPHTGTITAESLYYSYHQSLPHVLKNVKFSIRNNEKVGIVGRTGAGKSSLLAVLFRL-NNPEGLVRIDGLPITDLKLQDLRSAISIIPQDPVLFSGTLRKNLDPFTQFSDDALWNALEEVQLKEAVDELPDGIETELAEGGSNFSVGQRQLVCLARAILSHNKILVIDEATANVDHSTDSLIQETIRNKFHDCTVLTIAHRLNTVMDSDRVMVLDAGRLVEFDEPYVLLLNSQGFFSQLVE 1261          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 811.216 bits (2094), Expect = 0.000e+0
Identity = 494/1310 (37.71%), Postives = 777/1310 (59.31%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETS-----------SENSEKCLKYLKENLRSPNIES-----EIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAP--IEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL-----NESSDKVDKNQNNLIQP---SAPNKRKRSRLSTSGSQGFDGNENAEENYEK--YFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPIL-ICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES-INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFK 3874
            PE  +S LS+IT+ W+   +   +K  ++++  + LN  + S           +    K  +  ++ L SP         E+  +E+ + LI K       K     ++ +LC  + P      + K+ +DIL+   P +L+LL+ ++ + D   +W+G   A L F      SL     F +     +R+R A+ G IY+K L +S+ AR   + G+IVN+ SVD ++ M+ +TY  +  S P Q++LA+  L+  LG S+ AGV  +  ++P+N +I   ++ +   ++  KD R+ ++ E+ +G+K++K+YAWE  F +K+ +IR +E+K ++  +    + +  W   PF V   TF+ ++     +++  EK FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E + DS   + R  + G+P  I I++G FSW+    PTL  +N+ +    L+AVVG VG GKSSLLSA+LGEM  + G+V  +G +AYVPQ+AWI N TL+NNI+  +   + +Y +V++AC L  D+E LP  D+TEIGE+GVNLSGGQKQRVSLARAVY D  +YLLDDPLSAVD +VG+ +F+ +I  QGLLK KTR+LVTHGL +LP    + V+ D G+I+E G+Y+ L +    F  FL     NE S++ +   N+  +P           S+ +++ S+G    +N E+   K       +  ++ ++GRV L+    Y KA G+ +   S+L  +   +L  F N WL +  D      +   N ++ +    +  YG +G+ Q +AV  +      GG+ AS+ +H  +L  VLRS + FF  TPSG ++NRF K++  ID  + + +   +     ++ S ++I + TP   ++ IP L + Y  +Q FY++SSRQ +RL+S + S + TH  ET  G+S+IR+   +  F     + +D + K      ++ RWL +RL+ +GN IV  + +FAVL R SLS  ++GLSISYALQ+T  L WL R  ++ ETN V++ER+++Y+    E+        +  +W + G I + NF L+Y  +L   ++NI ++I+GGEK+G+VGRTGAGKSSL L LFR++E   G IFIDGV+I  +GLH+LR ++TI+PQDPV+FSGTL+ NLDPFD Y+D+ + K+LE S +  +V+ L + + ++C   G NLS+GQ+QL+CLAR LL+K+K+++LDEATA++D ETD  +   I+ QF   TV+ IAHRL TI+D  +++ LD G + EF SP  L++     ++
Sbjct:  209 PEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTEEKMLYSPKQPPHGENKEVRAVEESEILIVKS----PKKSREPSLLWALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAP-SWQGYFYAALLFVCTCVQSLILQRYFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILMVPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELKVLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDS---VERPAAGGSPYSISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVD-GEITEVGSYQQLKEKEGAFAEFLRMYAANEQSEETEPVPNSPTKPMENGVGPGFTGSQSASNVSKGSVSEQNVEQKNSKNAEAGKTTDADKALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTD------DPVVNGTQPNRLMRLGVYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALI-IPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARESLSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKEAEWRHEPPTVPPDWPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFVSGLPDKLGHECSEGGENLSLGQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMDYTRVLVLDKGQMAEFDSPSNLIAQKGAFYR 1502          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc3 (ATP binding cassette subfamily C member 3 [Source:NCBI gene;Acc:101175305])

HSP 1 Score: 801.201 bits (2068), Expect = 0.000e+0
Identity = 492/1353 (36.36%), Postives = 771/1353 (56.98%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCL-KYLKENLRSPNIESEIHDIEDKKCLIGKKNF-------------------NEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWK---GILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGA-PIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL-------------------------------NESSDKVDKN------------QNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPIL-ICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINET-NNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQ 3886
            PE  +  LS +T+ W      + +K  ++ +  + L   ++S     + L ++ KE  ++ + ++     +  K    K N                    N++ +    F ++++ + + P    G   K+ +D++    P +L LL+++ K +D+   W      LM    F Q L       YCF       + VR AL G IY+K L ++  A+   + G+IVN+ SVD ++ M+   +  +  S P QI+LA+  L+  LG S+ AGV  +  +IPLN  I   +R +   ++  KD R+ ++ EI +G+K++K+YAWE+ F +K+ +IR  E+  +R  +    + ++ W   PF V   +F  F+    N+++  ++ FVSL LFN L+ P+ +LP  +S    A VS  RI+NFL   E + DS +   RK +PG   + + NG+F+W ++  P L+++++ V    L+AVVG VG GKSSL+SA+LGEM  L G V  +G +AYVPQ+AWIQN TLR+NIL   ++N+  Y  VLDAC L  D+E LP  DQTEIGE+G+NLSGGQ+QRVSLARA+Y D+D+YLLDDPLSAVD +V + +F++LI   GLLK KTR+LVTHG+ +LP VD I V+   G++SE G+++ L+     F  FL                               N   D ++              Q +++     N R+RS      SQ   G E  E+  +K    +   E   +GRV     + Y KA G+ +    +L            N+WL          N++  N ++ + +  ++ Y  +G+ Q + V++       G + A++++H+ LL   L +   FF+ TP GRI+NRF+KD+++ID  L   +   +      +++++VI   TP+F ++ IP+L + Y+ +Q FY++SSRQ +RL+S + S + +H  ET +GSS+IR+      F  +    +D++ +      +S RWL +R++ +GN IV  + +FAV+ + +L+  LVGLS+SYALQVT  LNW+ R  ++ E N V++ER+++Y+    E+  E  +      W ++G +    +S++Y   L  VLKNIT+++ GGEKIG+VGRTGAGKSS+ L LFRL+E  +G I IDGV I  IGLH LR +LTI+PQ+PV+FSGTL+ NLDPFD+Y+D+ + K+LE S +  +V +    +  +C   G NLS+GQ+QL+CLAR LL+K++I+ILDEATA++D ETD  +   I+ QF +STV  IAHRL TI+D  +++ LD G I EF +P  L+S   G F  +A+
Sbjct:  205 PETTAGFLSSMTFWWFTSLALKGYKMPLEAKDLWSLKKRDSSETMVPRLLAEWRKEEAKARSQQNLSGQAQYAKLPPSKANHLSGDEAEDNGPKEGDVLLSNQKAQKQPSF-LRAILKAFGPYFLIGSAYKLLQDVITFINPQLLSLLISFTKQEDVPLWWGYTLAFLMFFTAFLQTLILHRHFQYCFVTG----MNVRTALIGAIYRKALVITNAAKRSSTVGEIVNLMSVDAQRFMDLTAFLNMLWSAPLQIMLALYFLWENLGPSVLAGVAVMVMLIPLNAFIAMKTRAYQVEQMQHKDARLKLMNEILNGIKVLKLYAWEESFKQKVLDIRQKELNVLRKTAYLGALSTMAWTSAPFLVALTSFAVFVSVDENNVLDAKRAFVSLSLFNILRFPLNMLPQVISSIAQASVSLKRIQNFLSHDELDPDSVD---RKNTPGDFSVTVVNGTFTWAKEDPPVLHSVSVMVPRGSLLAVVGPVGCGKSSLISALLGEMEKLEGEVSIQGSVAYVPQQAWIQNATLRDNILFGNAYNEQKYCSVLDACALTQDLEVLPGGDQTEIGEKGINLSGGQRQRVSLARALYSDADVYLLDDPLSAVDAHVAKHIFDRLIGPDGLLKEKTRILVTHGISFLPQVDNIMVLG-AGRVSEMGSHQELLKQNGAFAEFLRNYALEDILEEDELEDELLDEMEFFPEEELGNHHCDMMENEPVMNEARKAFMRQMSVLSADGENPRRRSVRRHGCSQRKRG-EPPEK--KKELEKLIQAETAETGRVKTKVYLEYVKAVGVLLSVLILLLYGCQSAAAIGSNIWLSQWT------NDAAGNHTQENVQMRVSVYAALGIAQGILVMISSYTLAMGNISAARRLHANLLTNKLHTPQSFFDTTPIGRIINRFSKDVYVIDEALPSTVLMFLGTFCASLSTMIVIVCSTPYFALI-IPVLALIYVFVQRFYVASSRQLKRLESVSRSPIYSHFSETVTGSSVIRAYGRLDAFVLMSDAKVDENQRSYYPGIVSNRWLGVRIEFIGNCIVLFAALFAVIWKETLNPGLVGLSVSYALQVTMSLNWMVRMTSDLENNIVAVERVKEYSETKPEAPWEVEDKKPPPEWPTDGKVEFHGYSVRYRDGLDLVLKNITLDVKGGEKIGIVGRTGAGKSSMTLCLFRLLEAAAGEITIDGVKIAEIGLHDLRSRLTIIPQEPVLFSGTLRMNLDPFDKYSDEDVWKALEHSHLHGFVRNQPAQLQMECAEGGENLSVGQRQLVCLARALLRKTRILILDEATAAIDLETDDLIQSTIRTQFENSTVFTIAHRLNTIMDYTRVLVLDKGKIAEFDTPTNLISK-RGIFYGMAK 1537          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc6a (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101158001])

HSP 1 Score: 796.193 bits (2055), Expect = 0.000e+0
Identity = 477/1321 (36.11%), Postives = 753/1321 (57.00%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETS--------SENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLST----------SGSQGFDGN-------------ENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNV----WLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVE-SINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQA 3889
            P   +S LS+I + W    + + ++  ++    + L   +TS         E   +C K  K+     +       + D+  L+ K    +    SG F++++L R + P    G +  IF D   +     +  LL        +  WKG   A L F      SL  +        + +RV+ A+ G++Y+K+L +++ AR   + G+IVN+ S D +++M+ + Y       P +I L +  L+  LG S  AG+  +  + PLN  I K   K  E ++ F D R+ ++ EI +G+KI+K YAWEK F +++   R  E+K ++   V + I    ++   F + +  F  ++     +++  +K+FVS+ L N L+ P+  LP+ +S  + ALVS  R+  +L + E + D   S     S G  + I+NG+FSW+++G P L  I++ V    L+AVVG VG GKSSLLSA+LGE    +G V  +G +AYVPQ+AWIQN T+++NIL  +   K +Y +VL+AC L  D++ LP  D TEIGE+G+NLSGGQKQRVSLARAVY+ +D+YLLDDPLSAVD +VGQ +F+K+I  +G+LK +TR+LVTHG+ +LP  D I V+ D G+I+E G+Y+ L+     F  F++  +    + + + IQ  A ++R  +RLS           S  Q   G+             EN ++   +    ++  ++  +GRV L+    YFK  G+ +    I+  V     Q   ++    WL M AD      +   N ++      +  +G +G  Q +A+          G+ AS+++H  LL  VLRS + FF +TPSG +LNRF K++  ID  +   +  +++    L+   +++ I TP   ++ +P+   Y  +Q FY+++S Q RRL++ + S + TH  ET  G+S+IR+   +S F       +D +      ++++ RWL + L+ +GN +V  + + +V+ + ++S  +VGL++S++LQVTGIL+W+ R   + E N VS+ER+ +Y   P E S N   + +   W  +G I  +++ LQY   L   LK IT+ I   EKIG+VGRTGAGKSSLAL +FR++E   GRIFIDGVNI  IGLH LR ++TI+PQDPV+FSG+L+ NLDPFD YTD+++  SLE++ + D+V++L + +N++C   G NLS+GQ+QL+CLAR LL+K+KI++LDEATA+VD ETD  +   I+ QF   TV+ IAHRL TI+D  ++I +D G I E  SP  L+S     ++   +A
Sbjct:  206 PVKDASFLSKILFWWFTGLVVKGYRTPLEATDLWTLREEDTSHKIISDLQQEWGAECAKLQKQEKSLESAPVLGSRLPDQAQLLRKLQKEQS---SGFFLLRTLARKFGPYFLTGTLCIIFHD-AFMFAIPQVLSLLLGFIRDPEAPQWKGYFYATLMFLLSCLQSLFNHQYMYTCFTVGMRVKTAVMGLVYRKSLVINSAARRTCTVGEIVNLVSADTQKLMDFVVYFNAVWLAPIEIGLCLFFLWQHLGPSALAGIATVILIFPLNGFIAKKRSKLQEIQMKFMDGRVRLMNEILNGIKILKFYAWEKAFLEQVLGYREKELKALKKSQVLYSISIASFNSSSFLIAFAMFGVYVMLDERNVLDAQKVFVSMALINILKTPLSQLPFAISTTMQALVSLRRLGKYLCSEELKVD-GVSKALSSSDGEDVVIENGTFSWSKEGPPCLKRISVRVPRGSLVAVVGHVGSGKSSLLSAMLGETEKRSGQVTVKGSVAYVPQQAWIQNATVQDNILFGREKLKTWYQRVLEACALLPDLDILPAGDATEIGEKGLNLSGGQKQRVSLARAVYRKADLYLLDDPLSAVDAHVGQHIFDKVIGPKGVLKDRTRILVTHGMSFLPQADLILVLID-GEITESGSYQELLSHHGAFADFIHTFAST--EKKESAIQ-RAGSRRSNARLSMVDFMPFSRDLSQEQLIGGDTTNTNLQNMEPVSENDQDQVPEDLGKLTEADKAHTGRVKLDMYKKYFKTIGLAI----IIPIVFLYAFQQGASLAYSYWLSMWAD------DPVVNGTQTDRDLKLAVFGALGFVQGIAIFGTTVAISICGIIASRQLHMDLLVNVLRSPMAFFESTPSGNLLNRFVKEIDAIDCMVPEGLKMMLSYVFKLVEVCIIVLIATPIAAVIILPLAFLYAFVQSFYVATSCQLRRLEAVSRSPIYTHFNETVQGASVIRAFGEQSRFIMQANERVDFNQTSYFPRFVATRWLAVNLEFVGNGVVLAAAVLSVIGKSTVSPGIVGLAVSHSLQVTGILSWIVRSWTDVENNIVSVERVNEYADTPKEASWNTEGSALPLAWPQSGTIEFQDYGLQYRKGLELALKGITLQIQKREKIGIVGRTGAGKSSLALGIFRILEAAKGRIFIDGVNIAEIGLHDLRSRITIIPQDPVLFSGSLRMNLDPFDIYTDEEIWSSLELAHLKDFVSNLPDKLNHECSEGGENLSLGQRQLVCLARALLRKTKILVLDEATAAVDLETDTLIQSTIRTQFEDCTVLTIAHRLNTIMDYTRVIVMDRGYISEMDSPANLISQRGQFYRMCREA 1507          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: ENSORLT00000010371.2 (canalicular multispecific organic anion transporter 1 [Source:NCBI gene;Acc:101165337])

HSP 1 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 472/1169 (40.38%), Postives = 708/1169 (60.56%), Query Frame = 2
Query:  524 CFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLI----------------------QPSAPN--------KRKRSRLSTSGSQGFDGNENA------EENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQ-AF--GNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKHED 3913
            CF +  K    VR A+   +YKK L +S + R   + G+ VN+ S D ++  +   +  +  SCP QII++I+ L+LELG S+ AG+  +  ++P+N ++   +RK+  + + FKDKRM I+ E+ +G+KI+K++AWE  F  ++E IR +E+K ++  +    + + ++   P  V   +F  F+   P++++T EK F S+ LFN L+ P+ +LP  ++  +   VS  R+E FL   + E D     P   S  + + ++NGSFSW  D  P L +++L++E  +L+AVVG VG GKSSL+SA+LGEM+   G +  +G +A+VPQ+AWIQN TLR+NIL      +  + +V+ AC L  D++ L   + TEIGE+G+NLSGGQKQRVSLARA Y  +DIYLLDDPLSAVD +VG+ LF+K+I   G+LKHKTR+LVTHG+ +LP+VDE+ V+ D G+ISE G+Y  L      F  FL    D   K QNN                        QP +P         KR+ S   +  S      +N+      + N  K    +  +E + +G+V  +  + Y +A G   +G + +  +I+ +   AF   N+WL    +  +   N T+   +   +  +  +G +G+ Q   V L         + AS+ +HS LL+ +LR  + FF+ TP GR++NRF KD+F ID  +  +    +   + ++ +L VI + TP+F I+ +P+ + Y  +Q FY+++SRQ RRLDS + S + +H  ET SG S+IR+   +  F       ID++ K      +S RWL +RL+ LGNL+VF S +FAV+++ SL + LVGL+ISYAL VT  LNWL R  +E ETN V++ER+ +YT I  E+   T+    E W   G +   ++ ++Y   L  VL  IT NI   EKIG+VGRTGAGKSSL   LFR++E   GRI ID V+I++IGLH LR +LTI+PQDPV+FSGTL+ NLDPFD+++D++L K+LE+S + D+V  L EG+ ++    G NLS+GQ+QL+CLAR LL+KS+I+ILDEATA+VD ETD  +   I+ +F   TV+ IAHRL +I+D  +++ LD G I+EF SP  LL N  G+F ++A+ D  I  E+
Sbjct:  265 CFVLGMK----VRTAVMAAVYKKALVVSNDTRKESTVGETVNLMSADAQRFNDVTNFIHLLWSCPLQIIVSIVFLWLELGPSVLAGLLVMVLMVPINGLLATQARKYQVQNMNFKDKRMKIMNELLNGVKILKLFAWEPSFQSQVESIRGEELKVMKKFAYLSSVSTFIFSCAPALVSLASFAVFVLVSPDNILTAEKAFTSISLFNILRFPLAMLPMLIASIVQTGVSKKRLEKFLGGEDLEPDIVRHDP---SFDSAVSVRNGSFSWERDAEPLLKDVSLDIEPGRLVAVVGAVGSGKSSLMSALLGEMHCTEGFINIKGSLAFVPQQAWIQNATLRDNILFGSPHEEKRFQEVIQACALGPDLKLLAAGELTEIGEKGINLSGGQKQRVSLARAAYSQADIYLLDDPLSAVDSHVGKHLFDKVIGPNGVLKHKTRILVTHGVSFLPYVDEVVVLVD-GKISEIGSYNSLRASKGAFSEFL----DTYAKEQNNQTKSDKDGCQDTEDLEIIPEREDTQPDSPLEDTVSFTLKRENSIRRSQRSSSVRVRKNSTVKKSEDANETKAGQRLIEKETMETGQVKFSVYLQYLRALG---WGYTSMVFIIYFIQNVAFIGQNLWLSDWTNDAADYYNQTYPNWKRDTR--VGVFGALGIAQGFLVFLGTLLLANASVSASRILHSRLLNNILRVPMVFFDTTPVGRVVNRFAKDIFTIDEAIPQSFRSWLLCLLGVLGTLFVICLATPFFTIIILPLAVIYFFVQRFYVATSRQLRRLDSVSRSPIYSHFGETVSGLSVIRAYRHQDRFLKHNEVTIDENLKSVYPWIVSNRWLAIRLEFLGNLVVFFSALFAVISKDSLDSGLVGLAISYALNVTQTLNWLVRMSSELETNIVAVERVSEYTEIENEAKWITDCRPPERWPDEGKLQFIDYKVRYRPGLDLVLHGITCNIASSEKIGIVGRTGAGKSSLTNCLFRIIEAAEGRILIDDVDISTIGLHDLRGRLTIIPQDPVLFSGTLRMNLDPFDKFSDEELWKALELSHLKDYVAGLQEGLQHEVAEGGENLSVGQRQLLCLARALLRKSRILILDEATAAVDLETDNLIQNTIRKEFAHCTVLTIAHRLHSIMDSSRVMVLDAGKIVEFDSPSNLLEN-RGYFFSMAK-DAGITQEE 1414          
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Match: abcc1 (multidrug resistance-associated protein 1 [Source:NCBI gene;Acc:101173789])

HSP 1 Score: 792.727 bits (2046), Expect = 0.000e+0
Identity = 486/1280 (37.97%), Postives = 761/1280 (59.45%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETS-----------SENSEKCLKYLKENLRSPNIES-----EIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAP--IEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFL-----NESSDKVDKNQNNLIQP---SAPNKRKRSRLSTSGSQGFDGNENAEENYEK--YFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPIL-ICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVES-INETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIID 3784
            PE  +S LS+IT+ W+   +   +K  ++++  + LN  + S           +    K  +  ++ L SP         E+  +E+ + LI K       K     ++ +LC  + P      + K+ +DIL+   P +L+LL+ ++ + D   +W+G   A L F      SL     F +     +R+R A+ G IY+K L +S+ AR   + G+IVN+ SVD ++ M+ +TY  +  S P Q++LA+  L+  LG S+ AGV  +  ++P+N +I   ++ +   ++  KD R+ ++ E+ +G+K++K+YAWE  F +K+ +IR +E+K ++  +    + +  W   PF V   TF+ ++     +++  EK FVSL LFN L+ P+ +LP  +S  + A VS  R+  FL   E + DS   + R  + G+P  I I++G FSW+    PTL  +N+ +    L+AVVG VG GKSSLLSA+LGEM  + G+V  +G +AYVPQ+AWI N TL+NNI+  +   + +Y +V++AC L  D+E LP  D+TEIGE+GVNLSGGQKQRVSLARAVY D  +YLLDDPLSAVD +VG+ +F+ +I  QGLLK KTR+LVTHGL +LP    + V+ D G+I+E G+Y+ L +    F  FL     NE S++ +   N+  +P           S+ +++ S+G    +N E+   K       +  ++ ++GRV L+    Y KA G+ +   S+L  +   +L  F N WL +  D      +   N ++ +    +  YG +G+ Q +AV  +      GG+ AS+ +H  +L  VLRS + FF  TPSG ++NRF K++  ID  + + +   +     ++ S ++I + TP   ++ IP L + Y  +Q FY++SSRQ +RL+S + S + TH  ET  G+S+IR+   +  F     + +D + K      ++ RWL +RL+ +GN IV  + +FAVL R SLS  ++GLSISYALQ+T  L WL R  ++ ETN V++ER+++Y+    E+        +  +W + G I + NF L+Y  +L   ++NI ++I+GGEK+G+VGRTGAGKSSL L LFR++E   G IFIDGV+I  +GLH+LR ++TI+PQDPV+FSGTL+ NLDPFD Y+D+ + K+LE S +  +V+ L + + ++C   G NLS+GQ+QL+CLAR LL+K+K+++LDEATA++D ETD  +   I+ QF   TV+ IAHRL TI+D
Sbjct:  247 PEPGASFLSRITFWWISGMMLSGYKRPLEEKDLWSLNPEDRSHCVVPQLLRRWTAECHKVKRTEEKMLYSPKQPPHGENKEVRAVEESEILIVKS----PKKSREPSLLWALCLTFAPHFLVSCLYKLIQDILMFVGPEILRLLILFVNDPDAP-SWQGYFYAALLFVCTCVQSLILQRYFHVCFVSGMRLRTAVIGAIYRKALVISSAARRSSTVGEIVNLMSVDAQRFMDLVTYINMIWSAPLQVVLALYFLWENLGPSVLAGVAVMILMVPINAVIAMKTKTYQVAQMKNKDSRIKLMNEMLNGIKVLKLYAWEMAFKEKVSQIRENELKVLKKAAYLGAVSTFTWVCAPFLVALSTFSVYVLIDDQNVLDAEKAFVSLALFNILRFPLNMLPMVISSMVQASVSLKRLRVFLSHEELQEDS---VERPAAGGSPYSISIEDGVFSWSRSESPTLKRLNVRIPEGSLVAVVGHVGSGKSSLLSALLGEMDKMEGSVSVKGSVAYVPQQAWILNATLKNNIVFGQKRKEAWYHRVVEACALHQDLEILPAGDETEIGEKGVNLSGGQKQRVSLARAVYCDRSVYLLDDPLSAVDAHVGKHIFDHVIGPQGLLKDKTRILVTHGLSYLPQAHLVLVMVD-GEITEVGSYQQLKEKEGAFAEFLRMYAANEQSEETEPVPNSPTKPMENGVGPGFTGSQSASNVSKGSVSEQNVEQKNSKNAEAGKTTDADKALTGRVKLSVFFSYLKAIGVLLSIISLLFFLSHNLLSLFANYWLSLWTD------DPVVNGTQPNRLMRLGVYGALGVSQGVAVCGYSLSVSIGGILASRFLHQSMLFDVLRSPMSFFERTPSGNLVNRFAKEMDTIDSVIPMILKMFMGSLFNVVGSCIIILVATPMVALI-IPFLGVLYFFVQRFYVASSRQLKRLESVSRSPIYTHFSETLLGTSVIRAFGEQERFIHESDQRVDHNQKAYYPGIVANRWLAVRLEFVGNCIVSFAALFAVLARESLSPGIMGLSISYALQLTASLTWLVRMSSDVETNIVAVERVKEYSDTEKEAEWRHEPPTVPPDWPTEGCIRITNFGLRYRSDLDLAIRNINVDISGGEKVGIVGRTGAGKSSLTLGLFRIIEPAEGNIFIDGVDIAKLGLHELRSRITIIPQDPVLFSGTLRMNLDPFDSYSDEDIWKALEFSHLKSFVSGLPDKLGHECSEGGENLSLGQRQLLCLARALLRKTKVLVLDEATAAIDMETDDLIQTTIRSQFEGCTVLTIAHRLNTIMD 1510          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000074226.1 (SMESG000074226.1)

HSP 1 Score: 2429.44 bits (6295), Expect = 0.000e+0
Identity = 1282/1311 (97.79%), Postives = 1284/1311 (97.94%), Query Frame = 2
Query:   26 TENPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQ--------------DSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKHEDK 3916
            TENPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKF+IKSLCRVYFPIIFFGWILKIFRDILVLTLPLVLKLLLNYLKNKDLSYTWKGILMALLFFFQGLFGSLCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQIILAILLLYLELGYSIFAGVTAIGA+IPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSLVLFNNLQLPILLLPWGLSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVE QKLIAVVGRVGVGKSSLLSAILGEMYTLNG VQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKI YG VLDACCLEYDI SLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQ              DSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFD NENAEENYEKYFNDIS EEEIMSGRVSLNSIVWYFKATGIFVF SSILACVIFGVLQA GNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVILFWGGF FG LRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDH LNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLK NLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKHEDK
Sbjct:  123 TENPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFLIKSLCRVYFPIIFFGWILKIFRDILVLTLPLVLKLLLNYLKNKDLSYTWKGILMALLFFFQGLFGSLCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQIILAILLLYLELGYSIFAGVTAIGAIIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSLVLFNNLQLPILLLPWGLSQAISALVSFGRIENFLLASEKENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVEKQKLIAVVGRVGVGKSSLLSAILGEMYTLNGAVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKILYGTVLDACCLEYDIGSLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQVNLKGKFQILKYFKDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDDNENAEENYEKYFNDISQEEEIMSGRVSLNSIVWYFKATGIFVFASSILACVIFGVLQAIGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVILFWGGFTFGSLRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHILNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKHNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQADEYIKHEDK 1433          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000074229.1 (SMESG000074229.1)

HSP 1 Score: 1987.62 bits (5148), Expect = 0.000e+0
Identity = 1052/1308 (80.43%), Postives = 1158/1308 (88.53%), Query Frame = 2
Query:   26 TENPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEF--KYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMP---RKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQ--------------DSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQAD 3892
            T++PE  +S+ SQ+TY WMD +IY W+K +M D+TSFDL++TE SS NSE   +Y        +I       ED++ LI  +   E F  ++SGK +IKS+   +F II    +L+I RDIL+LTLPLVLKLLLNY K K  +YTWKG+L A +F  QGL GS+ ENYCF +T+KI++RVR ++ GMI +KTLRLS EA++ +SAGDI+NM  VDMEQ+MN I YSWI +SCPFQIIL ++LLY ELG SIF GV  I  VIP+ I IM+ ++K+SE+EL++KDKRM+ILTEI +G+K+IKMY WEK F  KIE IR++E+KN RN S+GWCI++V++DLVPF VMY TFTF+IYFVP S+I+ EK+F+++VLFNN+QLP+LLLPWG++Q I+A+VSFGRI  FLL++E    S  S+P    +MSP A IEIQ+G FSWT+ G P L NI L VE QKLIAVVGRVGVGKSSLLSAILGEMYTLNG VQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYG VLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQ              DSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVILFWGGF FGGLRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRF+KDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAV+NRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNIT+NINGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVN L +G+ YDCG MG NLS GQKQL+CLART+LK SKIIILDEATASVDE+TDRRV +AI  QF +STVIIIAHR+KTII CDKI++ ++GS++EFGSP+ELL  ++G F+   +++
Sbjct:   58 TKHPEIIASIFSQLTYKWMDSFIYNWYKVDMTDKTSFDLHSTEKSSINSEISAQYFHNYGEREDIFRRASKSEDEEFLINSEE-KESFILEHSGKVLIKSIFGAHFHIILIACLLRIVRDILILTLPLVLKLLLNYFKEKQKNYTWKGVLYAFVFLIQGLIGSVFENYCFTLTNKISIRVRGSVIGMISRKTLRLSAEAKATYSAGDIINMTMVDMEQIMNWIVYSWILLSCPFQIILTVVLLYYELGNSIFVGVAMIVTVIPVKIAIMRLTKKYSEKELMWKDKRMNILTEILNGIKVIKMYVWEKSFFNKIESIRHEELKNFRNYSIGWCILNVMFDLVPFLVMYSTFTFYIYFVPFSIISAEKVFIAIVLFNNIQLPMLLLPWGVTQTITAVVSFGRIGKFLLSNEIYPRS--SVPLVVTQMSPDASIEIQSGRFSWTKIGNPVLKNIQLTVEKQKLIAVVGRVGVGKSSLLSAILGEMYTLNGAVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGTVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQVNLKGKFQILKYFKDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVILFWGGFTFGGLRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFSKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVVNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITMNINGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNLLKDGLYYDCGYMGANLSTGQKQLVCLARTVLKNSKIIILDEATASVDEDTDRRVFDAITSQFRNSTVIIIAHRIKTIIGCDKILYFENGSVVEFGSPQELLLKANGKFRFFVKSE 1362          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000074229.1 (SMESG000074229.1)

HSP 1 Score: 1986.46 bits (5145), Expect = 0.000e+0
Identity = 1052/1308 (80.43%), Postives = 1158/1308 (88.53%), Query Frame = 2
Query:   26 TENPENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKNFNEEF--KYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDSNNSMP---RKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQ--------------DSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKALAQAD 3892
            T++PE  +S+ SQ+TY WMD +IY W+K +M D+TSFDL++TE SS NSE   +Y        +I       ED++ LI  +   E F  ++SGK +IKS+   +F II    +L+I RDIL+LTLPLVLKLLLNY K K  +YTWKG+L A +F  QGL GS+ ENYCF +T+KI++RVR ++ GMI +KTLRLS EA++ +SAGDI+NM  VDMEQ+MN I YSWI +SCPFQIIL ++LLY ELG SIF GV  I  VIP+ I IM+ ++K+SE+EL++KDKRM+ILTEI +G+K+IKMY WEK F  KIE IR++E+KN RN S+GWCI++V++DLVPF VMY TFTF+IYFVP S+I+ EK+F+++VLFNN+QLP+LLLPWG++Q I+A+VSFGRI  FLL++E    S  S+P    +MSP A IEIQ+G FSWT+ G P L NI L VE QKLIAVVGRVGVGKSSLLSAILGEMYTLNG VQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYG VLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQ              DSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVILFWGGF FGGLRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRF+KDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAV+NRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNIT+NINGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVN L +G+ YDCG MG NLS GQKQL+CLART+LK SKIIILDEATASVDE+TDRRV +AI  QF +STVIIIAHR+KTII CDKI++ ++GS++EFGSP+ELL  ++G F+   +++
Sbjct:  199 TKHPEIIASIFSQLTYKWMDSFIYNWYKVDMTDKTSFDLHSTEKSSINSEISAQYFHNYGEREDIFRRASKSEDEEFLINSEE-KESFILEHSGKVLIKSIFGAHFHIILIACLLRIVRDILILTLPLVLKLLLNYFKEKQKNYTWKGVLYAFVFLIQGLIGSVFENYCFTLTNKISIRVRGSVIGMISRKTLRLSAEAKATYSAGDIINMTMVDMEQIMNWIVYSWILLSCPFQIILTVVLLYYELGNSIFVGVAMIVTVIPVKIAIMRLTKKYSEKELMWKDKRMNILTEILNGIKVIKMYVWEKSFFNKIESIRHEELKNFRNYSIGWCILNVMFDLVPFLVMYSTFTFYIYFVPFSIISAEKVFIAIVLFNNIQLPMLLLPWGVTQTITAVVSFGRIGKFLLSNEIYPRS--SVPLVVTQMSPDASIEIQSGRFSWTKIGNPVLKNIQLTVEKQKLIAVVGRVGVGKSSLLSAILGEMYTLNGAVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGTVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQVNLKGKFQILKYFKDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSAPNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQSRNSAKFYINCYGIIGLGQLLAVILFWGGFTFGGLRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFSKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVVNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITMNINGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNLLKDGLYYDCGYMGANLSTGQKQLVCLARTVLKNSKIIILDEATASVDEDTDRRVFDAITSQFRNSTVIIIAHRIKTIIGCDKILYFENGSVVEFGSPQELLLKANGKFRFFVKSE 1503          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000000283.1 (SMESG000000283.1)

HSP 1 Score: 1014.22 bits (2621), Expect = 0.000e+0
Identity = 607/1363 (44.53%), Postives = 866/1363 (63.54%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESEIHDIEDKKCLIGKKN------------FNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASEKENDS----NNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNE-------SSDKVDKNQNNLIQP-----SAPNKRKRSRLSTSGS---QGFDGN--------------------------------ENAEENYEKYFN----DISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSL-------LNNSTF-----NQSRNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYIS--ENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEFGSPKELLSNSSGHFKAL 3880
            PE ++S +S++T+ W D YIY+W KEEM +E SF+L + + S        KY+  NL   +   +I   ++K   I K N            F E+   SG  +   L +V+   +   W+LK+  D L+L  P +LK+LL Y+ +++ + TW    +A  F   G+  S+ ENY + +TS ++VR+RA + GMIY KTLRLS EAR+ ++ G+IVN+ SVD E++M  I +SW   SCPFQII+A +LLY E+ Y+IFAG       +PLN ++MK++  FS+ EL +KD+R+ I +EI  G+K+IKMY WE+ F  KI  +RN E+K I    + W I+ ++W+++P  ++ +    F++    + IT EK FVSL LFN ++  ++++P+GL++ ++A VS  RI  +L+  E E        N    ++     IEIQ G+FSW    +  LNNINL++   KLIAVVG++G GKSSL+SAILGEM T++G V+ +G+IAYV QE WIQN TL+NNIL T+ +N+ FY KV+ +CCL  D+E LP  D+TEIGERG+NLSGGQKQRVSLARAVYQ+ DIYLLDDPLSAVD +V  SLF  +ISN G+L  KTRVL+THGL WLP VDEI V+++ G IS+RG+++ L++   +FK F+ +       S +  + +  ++I+      S  N +    +  SGS     FD +                                E +EEN     +     +  EE+   G V       Y K+ G+ +F  ++L    F  LQ F  +W+    + + +       L N+++     NQ R   +FY+  Y  I +  +  V LFW  F  G   + K IH  LL ++LR  ++FF+ TP GRILNR + D+ ++D  + +N+++  +   ++++S++VI  VTPWF IV IP+ I Y  +Q  Y+ +SRQ+RRLD+ A+S V     ET  G SIIR+ + ES F+ + Y  IDK+++F+ IQ  S+RWLC R+DI+G+L+VF +VI ++ N   L+A LVGLSISY+LQVT  LNWL RQ  E E N V++ERIR+Y+M+P E+  E N+ +   ENW + GNI      L+Y  +L  VLKNI +++NGG K+G+VGRTGAGKSSL LALFRL+E  +G+I IDG++I++IGLH LR++LTILPQDPVIFSGTL+ NLDPF+ +TD+ L + LE + + DWV+SL EGMNY+CG  G NLS GQ+QL+CLAR LL+KSKI+ILDEATASVD ETD+ V+  +K  F  STVIIIAHR+ TI+D DKI+ LD G ++E GSPK+LL  + G FK+L
Sbjct:  128 PEEYASTISKLTFSWFDSYIYKWRKEEMTEENSFELRSNDESK-------KYI--NLVEKSFLKKIEFCKEKSKQINKSNSSKNLLTDNDEEFREKKHNSGWILFSCLSKVFLFQLVVAWVLKLIGDTLLLFTPYLLKILLRYVNSENKT-TWISYGIAFTFLANGILSSIMENYSYFMTSYLSVRIRAVIIGMIYSKTLRLSREARNKYTTGEIVNLMSVDAERIMVFIDFSWFIFSCPFQIIIATVLLYQEMNYAIFAGFGLFLVFLPLNGLLMKYAHGFSDVELKWKDERIKIFSEILTGIKVIKMYGWEQSFISKITGLRNLEVKYILRSQIIWGIVYIIWEILPSLIIMVMILSFVFMNRFNFITAEKAFVSLSLFNLIRFSLIIVPYGLTETVNAFVSLKRIAEYLMVEEMEPIGFTYLQNLYEEQLENDPAIEIQGGTFSWKRSDKVILNNINLSIAKGKLIAVVGKIGSGKSSLISAILGEMVTISGDVKIKGRIAYVSQEPWIQNRTLKNNILFTEDYNETFYKKVVVSCCLTQDLEQLPMGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDSHVAHSLFENIISNNGILGGKTRVLITHGLNWLPKVDEIVVLDNSGHISDRGSFKDLLENSLKFKQFIKDHMNPGKNSVNGANFSHESIIEEKVKHHSPENDQLLYEIPDSGSGIETEFDLDYHGPFISKESSPLQFTVVDDADIELHNKIKDLEFSEENNHNLISRSNGQLIDEEQAFVGNVKAKEYFVYVKSRGLLLFLLTVLIYSSFVALQVFSFIWIEKFTEDKVIQNLSNLILKNASYVIDQSNQIRERTEFYMIRYSFICIAMIGVVSLFWVCFAMGTYNSMKYIHGKLLYSILRCPMEFFDTTPVGRILNRLSHDMDLMDRKMPVNLSESFSCFFVVLSSIIVIIYVTPWFAIVIIPLFIFYYFIQFLYMPTSRQSRRLDAIATSPVFNIFTETIQGISIIRACKVESYFQELSYEIIDKNSRFRFIQVSSMRWLCFRIDIIGSLVVFFAVILSITNVSYLTAGLVGLSISYSLQVTEALNWLLRQYTEVEMNMVALERIREYSMVPSEA--EWNSLMPPPENWPNIGNIKFIELDLKYRESLSFVLKNINLDLNGGYKVGIVGRTGAGKSSLTLALFRLMEASNGKIVIDGLDISTIGLHDLRKRLTILPQDPVIFSGTLRENLDPFNVHTDEDLYQCLETAHLQDWVSSLNEGMNYECGEGGVNLSAGQRQLLCLARALLRKSKILILDEATASVDFETDKLVMTTVKEYFRQSTVIIIAHRINTILDTDKIVVLDSGEVVEIGSPKDLLEQADGIFKSL 1478          
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Match: SMESG000000273.1 (SMESG000000273.1)

HSP 1 Score: 929.858 bits (2402), Expect = 0.000e+0
Identity = 555/1240 (44.76%), Postives = 778/1240 (62.74%), Query Frame = 2
Query:   35 PENFSSVLSQITYVWMDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYL-----------KENLRSPNIESEIHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRDIXXXXXXXXXXXXXXXXXXXXXSYTWKGILMAXXXXXXXXXXXXCENYCFAITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVMNAITYSWIFISCPFQXXXXXXXXXXXXGYSIFAGVTAIGAVIPLNIIIMKFSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDEIKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVSXXXXXXXXXXXXXXXXXXSQAISALVSFGRIENFLLASE----KENDSNNSMPRKMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSSLLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIFYGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDSDIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVDEICVINDQGQISERGTYEHLMDFGTEFKSFLNE---------------SSDKVDKNQNNLIQ------------------PSAPNKRKRS--------RLSTSGSQGFDG----------------------------------------NENAEENYEKYFNDISHEEEIMSGRVSLNSIVWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNST---FNQS---------RNSAKFYINCYGIIGLGQLLAVXXXXXXXXXXXXRASKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETNAVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQ 3430
            PE ++S+LS++TY W+D YIY+WF++EM DETSFDL   + S++N+    K             + +L   +  S  H +ED+  L    N     +  G  +  SL RVY   +      K   D  +  +P +LK+LL Y++N+  +Y W G  +A+ F F G+  SL EN CF ITS +++R+RAAL GMIY+KTLRL+ E R+  ++G+IVN+ SVD E++MN I ++W F+SCP QI+LAI+LLY E+ Y+IFAG+  I A  PLN ++M   +KFS  EL +KD R+ ILTEI +G+K++KMYAWEK F  KI  +R+ E++ I  VS  + ++ VLW+++PF +M  TF  ++     ++ITPEK FVSL LFN L+ P+++LPWGL+ +++A VS  RI  +L+  E    + N    +     +  A IEI++GSFSW ++ + TLNNIN  +   KL+A+VG+VG GKSSL+SAILGEM+ +NG+V  +G IAYV QEAWIQN +L+ NIL T+ +N+  Y  +++AC L+ D+E LP  D+TEIGERG+NLSGGQKQRVSLARAVYQ+ DIYLLDDPLSAVD +VGQ LF  +ISN G+LK KTR+LVTHGL WLP VDE+ V++  G ISERG+++ L+    EF  F+ E                   + K +N L Q                  P+ P +R  S        RLS+S S+  DG                                        ++N +   +K  + +  EE+ MSG V   +     K+ G+++F +++     F  LQ F N+WL    +   + N S     N S         R   K+Y+  Y IIGL   L V  +W  F  G + ASK IH  LL +VLRS ++FF+ TPSGRI+NRF+KD+  +DH + +NI+D ++   ++  S++VI  VTPWF I  IP+ I Y L+Q+FYI +SRQ+RRLDS A+S V  H  ET  G ++IR+ + +  F+++    IDKS+KFK IQ  S+RWL LR++ILG L+VF +V+F+++ RFSL+ASLVGLSISY+LQ+T  LNWL RQ  E ETN V++ERIR+Y+ IP E+  + NN  S++W +NGNI  +++ L+Y   LP VLKNI ++ +GG+KIGVVGRTGAGKSSL LALFRLVE   G I ID +NI++IGLH LR++LTILPQ
Sbjct:   25 PEVYASILSKLTYSWLDAYIYKWFRKEMTDETSFDLRRQDESTKNTNILEKIFYDKIKISHNRKRYDLLQNSTASVAHLMEDEDKLTNPDN-----RSPGWVLFISLARVYGLELLLACAFKTVHDFSIYAMPFLLKILLEYIQNRSDNY-WIGYFLAIAFLFFGVLSSLAENGCFFITSILSIRIRAALIGMIYRKTLRLNNEIRNKFTSGEIVNLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAFVSLKRIGQYLVGEELNLTEINHREFTDNSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGTIAYVSQEAWIQNKSLKENILFTQDYNEKVYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCNEFMQFVQEYIEHNNNPSGGQHLSDESALGKAKNLLRQLSDNEDVVEEITDFVLTSPAVPIQRNDSHRVSNASDRLSSSISKSIDGFSRHVKYFENSNSGVFEDEDPKSPRIMTPGSQSRQISKETDQNTDRLIDKPISQLVEEEQAMSGTVKWATYSMCIKSRGLWLFIATVAIYAAFTGLQVFSNIWLKNFTEDSDIQNASQHILLNISGSPYWSKIIREQTKYYMVIYTIIGLCMTLVVCFYWASFTVGSINASKVIHKKLLRSVLRSPMEFFDTTPSGRIINRFSKDMENLDHLIPMNISDSLSCLFIVFASIIVIIYVTPWFAIAIIPLAILYYLIQLFYIPTSRQSRRLDSIAASPVFNHFTETLQGVALIRAFKEQQYFQNLNQTLIDKSSKFKFIQQSSVRWLSLRIEILGQLMVFAAVLFSIIGRFSLTASLVGLSISYSLQITEFLNWLLRQYTELETNCVALERIREYSKIPSEAEWDLNNAPSDSWPNNGNITFKDYDLRYREGLPLVLKNINLHFHGGKKIGVVGRTGAGKSSLNLALFRLVEAAGGSITIDKINISTIGLHDLRKRLTILPQ 1258          

HSP 2 Score: 88.5817 bits (218), Expect = 2.718e-17
Identity = 116/514 (22.57%), Postives = 223/514 (43.39%), Query Frame = 2
Query: 2441 SKKIHSVLLDTVLRSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVL----------LITSLVVISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLMETYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILGNLIVFGSVIFAVL----NRFSLSASLVGLSISYALQVTGI-LNW-LTRQCAEFETNAVSIERIRQYTMIPVESINETNNY-ISENWVSN--GNINLENFSLQYNINLPCVLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNINSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGMLDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATASVDEETDRRVIEAIKFQ---FVSSTVIIIAHRLKTIIDCDKIIHLD-DGSIIEFGSPKELLSNSSGHFKALAQADEYIKHED 3913
            S +I + L+  + R TL+  N      I N+FT    +  + ++++   I+N  +           ++ +++++     +    G+ +++ +  L    ++  ++   ++ K     +  L E  +G  +++    E  F        D   ++ L    +   +C+  +IL  LI+  + +  VL    N  +   + V L++   L+   + L W LT     F    VS++RI QY +    ++ E N+   ++N   N    I + + S  +       L NI   I  G+ + +VG+ G GKSSL  A+   +   +G + + G              +  + Q+  I + +LK N+    +Y +      +E   +   +  L  G   + G  G NLS GQKQ + LAR + +   I +LD+  ++VD    + + E +          T I++ H L  +   D+++ LD +GSI E GS K+LL + +  F    Q  EYI+H +
Sbjct:  201 SIRIRAALIGMIYRKTLRLNN-----EIRNKFTSGEIV--NLMSVDAERIMNWIIFAWFFLSCPLQIVLAIILLYQEMSYAIFAGLGLIVAFFPLNGLLMNLMQKFSTIELKWKDLRIKILTEILNGIKVLKMYAWEKSFLDKITNLRDTEMRYILRVSAAFGVVCVLWEILPFLIMLATFLCYVLTSEYNIITPEKAFVSLTLFNLLRFPMVVLPWGLTDSMNAF----VSLKRIGQYLVGEELNLTEINHREFTDNSAFNYDAAIEIRDGSFSWKKEDKLTLNNINFEIGRGKLVAIVGKVGTGKSSLISAILGEMHRINGSVSVQGT-------------IAYVSQEAWIQNKSLKENILFTQDYNEKVYEDIIEACSLKSDLEQLPGGDETEIGERGINLSGGQKQRVSLARAVYQNRDIYLLDDPLSAVDAHVGQHLFENVISNNGILKDKTRILVTHGLNWLPKVDEVLVLDSNGSISERGSFKDLLKDCN-EFMQFVQ--EYIEHNN 687          
The following BLAST results are available for this feature:
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ABCC10.000e+037.71ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+037.71ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+037.44ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+037.44ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC30.000e+040.07ATP binding cassette subfamily C member 3 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mrp-10.000e+037.30pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-10.000e+037.47pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-10.000e+037.23pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-10.000e+037.01pep chromosome:WBcel235:X:576318:587483:-1 gene:WB... [more]
mrp-70.000e+036.77pep chromosome:WBcel235:V:19674843:19693043:1 gene... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MRP1.350e-1438.60gene:FBgn0032456 transcript:FBtr0090026[more]
MRP8.999e-1538.60gene:FBgn0032456 transcript:FBtr0090025[more]
MRP1.189e-1438.52gene:FBgn0032456 transcript:FBtr0090022[more]
MRP4.917e-1638.38gene:FBgn0032456 transcript:FBtr0090017[more]
MRP3.980e-1638.30gene:FBgn0032456 transcript:FBtr0090016[more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc10.000e+038.50ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc10.000e+038.74ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc23.199e-1137.60ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc24.079e-1137.67ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
abcc6b.20.000e+036.09ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
septin93.380e-1837.94septin 9 [Source:Xenbase;Acc:XB-GENE-1012202][more]
ABCC10.000e+038.94ATP binding cassette subfamily C member 1 [Source:... [more]
ABCC10.000e+039.41ATP binding cassette subfamily C member 1 [Source:... [more]
septin94.286e-1839.50septin 9 [Source:Xenbase;Acc:XB-GENE-1012202][more]
ABCC10.000e+039.25ATP binding cassette subfamily C member 1 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Abcc10.000e+037.97ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc30.000e+038.89ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc30.000e+038.94ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc20.000e+037.69ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
Abcc60.000e+034.39ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8CG09|MRP1_RAT0.000e+038.31Multidrug resistance-associated protein 1 OS=Rattu... [more]
sp|O35379|MRP1_MOUSE0.000e+037.97Multidrug resistance-associated protein 1 OS=Mus m... [more]
sp|P33527|MRP1_HUMAN0.000e+037.71Multidrug resistance-associated protein 1 OS=Homo ... [more]
sp|Q6UR05|MRP1_CANLF0.000e+038.17Multidrug resistance-associated protein 1 OS=Canis... [more]
sp|Q5F364|MRP1_CHICK0.000e+038.50Multidrug resistance-associated protein 1 OS=Gallu... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7VJB80.000e+040.22Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1B6E1F33.256e-1738.36Uncharacterized protein OS=Clastoptera arizonana O... [more]
A0A1B6EGY93.574e-1738.36Uncharacterized protein OS=Clastoptera arizonana O... [more]
A0A2A3EBU10.000e+040.30Multidrug resistance-associated protein OS=Apis ce... [more]
K7J1C74.134e-1639.34Uncharacterized protein OS=Nasonia vitripennis OX=... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc10.000e+038.29ATP binding cassette subfamily C member 1 [Source:... [more]
abcc10.000e+038.52ATP binding cassette subfamily C member 1 [Source:... [more]
abcc10.000e+037.81ATP binding cassette subfamily C member 1 [Source:... [more]
ENSAMXT00000030862.10.000e+037.86canalicular multispecific organic anion transporte... [more]
ENSAMXT00000043850.10.000e+037.86canalicular multispecific organic anion transporte... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc30.000e+034.55ATP-binding cassette, sub-family C (CFTR/MRP), mem... [more]
ABCC81.669e-16830.86ATP binding cassette subfamily C member 8 [Source:... [more]
ENSPMAT00000006454.11.865e-10937.37pep scaffold:Pmarinus_7.0:GL483531:32:7621:1 gene:... [more]
ENSPMAT00000007076.14.305e-10636.90pep scaffold:Pmarinus_7.0:GL480539:10051:22495:1 g... [more]
ENSPMAT00000001536.14.132e-9835.03pep scaffold:Pmarinus_7.0:GL479104:2125:31869:1 ge... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YCF10.000e+034.74Vacuolar glutathione S-conjugate transporter; ABC-... [more]
YBT11.134e-1332.69Transporter of the ATP-binding cassette (ABC) fami... [more]
BPT10.000e+033.72ABC type transmembrane transporter of MRP/CFTR fam... [more]
VMR10.000e+033.11Vacuolar membrane protein; involved in multiple dr... [more]
YOR14.633e-15431.54Plasma membrane ATP-binding cassette (ABC) transpo... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO364740.000e+039.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350712.109e-2238.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412571.960e-1733.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468460.000e+034.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383550.000e+033.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
abcc10.000e+037.71multidrug resistance-associated protein 1 [Source:... [more]
abcc30.000e+036.36ATP binding cassette subfamily C member 3 [Source:... [more]
abcc6a0.000e+036.11multidrug resistance-associated protein 1 [Source:... [more]
ENSORLT00000010371.20.000e+040.38canalicular multispecific organic anion transporte... [more]
abcc10.000e+037.97multidrug resistance-associated protein 1 [Source:... [more]
back to top
BLAST of Multidrug resistance-associated protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074226.10.000e+097.79SMESG000074226.1[more]
SMESG000074229.10.000e+080.43SMESG000074229.1[more]
SMESG000074229.10.000e+080.43SMESG000074229.1[more]
SMESG000000283.10.000e+044.53SMESG000000283.1[more]
SMESG000000273.12.718e-1744.76SMESG000000273.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014286 ID=SMED30014286|Name=Multidrug resistance-associated protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4099bp
CTCAATTTGATCTTAATTTAATTAGACAGAAAATCCAGAAAATTTTTCAT
CTGTTTTGTCGCAGATTACATATGTTTGGATGGACAAATATATTTATCAA
TGGTTCAAAGAAGAGATGAAAGACGAGACTTCCTTCGATTTGAATAACAC
GGAAACTAGTTCAGAAAACTCAGAAAAGTGTTTGAAATATTTAAAAGAAA
ATTTACGAAGTCCAAACATAGAATCAGAAATACATGACATAGAGGATAAA
AAGTGTTTGATTGGAAAAAAAAATTTTAACGAAGAATTCAAGTATTCTGG
GAAGTTTGTAATTAAGTCTTTATGTCGAGTATATTTTCCAATAATATTTT
TTGGATGGATTTTAAAAATTTTCCGTGACATTCTTGTTTTAACTCTTCCG
TTGGTATTAAAATTATTATTGAACTACTTAAAGAATAAAGATCTCAGTTA
TACATGGAAAGGAATTTTAATGGCATTATTATTTTTTTTCCAAGGATTAT
TTGGGAGTCTTTGTGAAAATTATTGCTTTGCAATAACAAGTAAAATTACC
GTTAGAGTGAGAGCTGCATTGTGTGGAATGATTTATAAAAAAACTCTTCG
ATTAAGCACTGAAGCGCGATCTATTCATTCAGCCGGAGACATCGTTAATA
TGGCCAGTGTGGATATGGAACAAGTTATGAATGCAATTACATACTCGTGG
ATATTTATTTCTTGTCCTTTTCAAATAATTCTAGCAATTCTACTGCTCTA
CTTAGAATTAGGGTACTCCATATTTGCCGGGGTGACCGCAATCGGAGCTG
TTATACCATTGAATATAATTATTATGAAATTCAGTAGAAAATTTTCGGAG
AGAGAATTGTTATTTAAAGATAAAAGAATGAGTATTTTAACAGAAATATT
TCATGGAATGAAGATAATTAAAATGTATGCCTGGGAGAAATGTTTCAATA
AAAAAATTGAAGAAATAAGAAATGATGAAATTAAAAATATTCGAAATGTA
TCAGTTGGGTGGTGCATTATGAGCGTTCTATGGGATTTGGTTCCGTTTTT
CGTTATGTATATTACGTTTACGTTTTTCATTTATTTTGTTCCAAATTCTT
TAATTACTCCTGAAAAAATTTTTGTTTCTTTAGTTTTATTTAATAATTTA
CAATTGCCAATATTATTGTTACCATGGGGATTAAGTCAAGCTATAAGTGC
CCTTGTCTCGTTCGGTAGAATCGAAAATTTTCTTTTGGCTAGCGAGAAAG
AAAATGATTCGAACAATTCAATGCCTCGCAAAATGAGTCCTGGTGCACCA
ATTGAAATACAAAATGGAAGCTTTTCATGGACTGAAGACGGAAGACCTAC
TCTAAATAACATTAACTTGAATGTGGAAAATCAAAAATTAATTGCTGTTG
TCGGTCGAGTTGGTGTTGGCAAATCTTCTTTGCTCTCAGCGATTCTTGGT
GAAATGTACACTTTAAATGGTACAGTACAGACAGAGGGTAAAATTGCTTA
TGTGCCTCAAGAAGCCTGGATTCAAAACAATACATTGAGAAATAATATTT
TGTGTACAAAATCCTTCAATAAAATATTTTATGGCAAAGTATTGGACGCT
TGTTGTTTAGAATATGACATTGAATCTCTACCTAATCGAGATCAAACGGA
AATCGGCGAAAGGGGAGTCAATTTAAGTGGAGGACAAAAGCAAAGAGTTA
GTTTGGCAAGAGCTGTATATCAAGATAGTGACATTTATTTATTGGATGAC
CCTTTATCAGCTGTCGATGTTAACGTTGGGCAAAGTTTATTCAACAAACT
CATTTCCAATCAAGGATTATTGAAACATAAGACCCGAGTTTTGGTAACTC
ATGGATTGAAATGGTTGCCATTTGTTGACGAAATCTGCGTTATTAATGAT
CAAGGTCAGATTTCAGAACGAGGAACTTATGAGCACTTGATGGATTTTGG
AACTGAATTTAAATCGTTTCTCAATGAAAGCTCGGACAAAGTTGACAAAA
ATCAAAACAACCTTATTCAGCCTTCTGCTCCCAATAAAAGGAAACGATCT
AGACTGTCAACATCAGGCAGTCAAGGGTTCGATGGTAACGAAAATGCAGA
GGAAAACTACGAAAAGTATTTCAATGATATTTCACACGAAGAGGAAATCA
TGAGTGGACGAGTCAGTCTAAATTCTATTGTTTGGTATTTCAAAGCAACA
GGAATCTTCGTGTTTGGGTCCTCAATTTTAGCGTGCGTCATATTCGGTGT
ACTACAGGCCTTTGGAAACGTATGGTTAGGAATGCTAGCGGATACCCAAT
CACTGCTAAATAACTCTACGTTTAATCAAAGTCGAAATAGTGCCAAATTT
TATATCAATTGTTACGGAATTATTGGACTAGGTCAGTTATTAGCTGTTAT
CCTTTTCTGGGGAGGATTCATTTTTGGAGGTTTGCGAGCATCAAAAAAAA
TTCATTCTGTTTTACTTGACACAGTTTTGCGGTCTACATTGCAGTTTTTC
AATGCAACTCCGTCTGGAAGGATCCTTAATAGATTTACAAAAGACCTTTT
TATCATAGATCACACCTTGAACCTCAATATAACGGATATCATCAACCGGA
CGGTGCTGCTAATAACATCCTTAGTTGTTATTAGTATAGTTACTCCTTGG
TTTGGAATTGTCGGAATCCCAATTCTAATCTGTTACATTTTGCTTCAGGT
GTTTTACATATCTTCTTCTCGACAGGCGCGACGACTTGATTCGAAAGCTT
CTTCATTTGTACTGACACATTTAATGGAGACATACAGCGGATCCTCGATA
ATAAGGTCGTTGGAAGCTGAATCAGATTTCGAAAGCATTCAATATAGAAA
CATTGACAAAAGCAATAAATTTAAACTTATTCAATATCTTTCCCTACGTT
GGCTGTGCTTGCGATTAGACATTTTAGGGAATTTAATAGTTTTCGGTTCA
GTAATATTTGCCGTGCTCAATAGGTTTTCGCTGAGTGCGAGTTTAGTCGG
CTTATCCATTTCTTACGCATTGCAGGTGACCGGAATTCTGAATTGGTTGA
CTAGGCAATGTGCGGAATTCGAAACCAATGCGGTATCCATTGAAAGAATA
CGACAGTACACAATGATTCCAGTTGAGTCTATTAATGAAACAAATAATTA
CATTTCTGAAAATTGGGTATCAAACGGAAATATTAATTTAGAAAATTTCT
CTTTGCAATATAACATAAATCTTCCTTGTGTTTTGAAGAACATAACAATA
AATATTAACGGCGGAGAGAAAATTGGAGTGGTTGGACGAACTGGAGCAGG
AAAATCAAGCTTAGCGTTAGCTTTATTTAGACTTGTAGAAGGATGTAGTG
GAAGAATCTTTATTGATGGAGTAAATATCAATTCCATAGGTCTTCATCAA
CTGAGGAGGCAGCTAACAATTTTACCCCAGGATCCCGTCATATTTTCAGG
GACTTTGAAACGCAATTTAGATCCATTCGATGAGTATACTGACGATAAAT
TATTGAAGAGTCTTGAAATCTCAGGAATGCTTGACTGGGTAAATTCATTA
ACTGAAGGAATGAATTACGATTGTGGTAATATGGGGACTAATCTTTCGAT
GGGACAAAAACAACTGATTTGTCTTGCTAGGACTCTTTTAAAAAAATCTA
AAATTATAATATTGGATGAAGCTACTGCTTCCGTAGACGAGGAAACTGAC
AGGCGAGTTATTGAAGCAATAAAATTTCAATTTGTCAGTAGCACTGTGAT
CATTATTGCGCATCGTTTAAAAACAATAATTGATTGTGACAAAATTATAC
ATCTTGATGACGGTTCAATTATTGAATTTGGATCTCCAAAAGAGTTGCTA
TCAAACAGTTCTGGACATTTCAAAGCCTTGGCCCAGGCAGATGAATATAT
AAAACATGAAGACAAATAAAAAATATTATATCATGGTGGATTGTTTTTTT
TCTATAAGGTTAAGGTAATGGAAATGTACTGCTCGATGAACTTGACCAAT
GAACCTATTTTTGTGACATGAATGACAGAATTTGTTGCTATTAAATTTGA
TTTTCTATACTTGAATTCGTTTAATTAGTAATTGTATGGGACAAAAATA
back to top

protein sequence of SMED30014286-orf-1

>SMED30014286-orf-1 ID=SMED30014286-orf-1|Name=SMED30014286-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1280bp
MDKYIYQWFKEEMKDETSFDLNNTETSSENSEKCLKYLKENLRSPNIESE
IHDIEDKKCLIGKKNFNEEFKYSGKFVIKSLCRVYFPIIFFGWILKIFRD
ILVLTLPLVLKLLLNYLKNKDLSYTWKGILMALLFFFQGLFGSLCENYCF
AITSKITVRVRAALCGMIYKKTLRLSTEARSIHSAGDIVNMASVDMEQVM
NAITYSWIFISCPFQIILAILLLYLELGYSIFAGVTAIGAVIPLNIIIMK
FSRKFSERELLFKDKRMSILTEIFHGMKIIKMYAWEKCFNKKIEEIRNDE
IKNIRNVSVGWCIMSVLWDLVPFFVMYITFTFFIYFVPNSLITPEKIFVS
LVLFNNLQLPILLLPWGLSQAISALVSFGRIENFLLASEKENDSNNSMPR
KMSPGAPIEIQNGSFSWTEDGRPTLNNINLNVENQKLIAVVGRVGVGKSS
LLSAILGEMYTLNGTVQTEGKIAYVPQEAWIQNNTLRNNILCTKSFNKIF
YGKVLDACCLEYDIESLPNRDQTEIGERGVNLSGGQKQRVSLARAVYQDS
DIYLLDDPLSAVDVNVGQSLFNKLISNQGLLKHKTRVLVTHGLKWLPFVD
EICVINDQGQISERGTYEHLMDFGTEFKSFLNESSDKVDKNQNNLIQPSA
PNKRKRSRLSTSGSQGFDGNENAEENYEKYFNDISHEEEIMSGRVSLNSI
VWYFKATGIFVFGSSILACVIFGVLQAFGNVWLGMLADTQSLLNNSTFNQ
SRNSAKFYINCYGIIGLGQLLAVILFWGGFIFGGLRASKKIHSVLLDTVL
RSTLQFFNATPSGRILNRFTKDLFIIDHTLNLNITDIINRTVLLITSLVV
ISIVTPWFGIVGIPILICYILLQVFYISSSRQARRLDSKASSFVLTHLME
TYSGSSIIRSLEAESDFESIQYRNIDKSNKFKLIQYLSLRWLCLRLDILG
NLIVFGSVIFAVLNRFSLSASLVGLSISYALQVTGILNWLTRQCAEFETN
AVSIERIRQYTMIPVESINETNNYISENWVSNGNINLENFSLQYNINLPC
VLKNITININGGEKIGVVGRTGAGKSSLALALFRLVEGCSGRIFIDGVNI
NSIGLHQLRRQLTILPQDPVIFSGTLKRNLDPFDEYTDDKLLKSLEISGM
LDWVNSLTEGMNYDCGNMGTNLSMGQKQLICLARTLLKKSKIIILDEATA
SVDEETDRRVIEAIKFQFVSSTVIIIAHRLKTIIDCDKIIHLDDGSIIEF
GSPKELLSNSSGHFKALAQADEYIKHEDK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
GO:0016887ATPase activity
GO:0005524ATP binding
GO:0042626ATPase activity, coupled to transmembrane movement of substances
GO:0000166nucleotide binding
GO:0005215transporter activity
GO:0005324long-chain fatty acid transporter activity
GO:0008559xenobiotic-transporting ATPase activity
GO:0015238drug transmembrane transporter activity
GO:0015431glutathione S-conjugate-exporting ATPase activity
GO:0015562efflux transmembrane transporter activity
GO:0016491oxidoreductase activity
GO:0016787hydrolase activity
GO:0034040lipid-transporting ATPase activity
GO:0034634glutathione transmembrane transporter activity
GO:0046624sphingolipid transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000028Category 2 cell
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR030239ABCC6
IPR036640ABC1_TM_sf
IPR003593AAA+_ATPase
IPR027417P-loop_NTPase
IPR003439ABC_transporter-like
IPR011527ABC1_TM_dom
IPR017871ABC_transporter_CS
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006810transport
GO:0006855drug transmembrane transport
GO:0006979response to oxidative stress
GO:0015911plasma membrane long-chain fatty acid transport
GO:0030335positive regulation of cell migration
GO:0033700phospholipid efflux
GO:0034775glutathione transmembrane transport
GO:0042493response to drug
GO:0042908xenobiotic transport
GO:0046618drug export
GO:0055114oxidation-reduction process
GO:0060326cell chemotaxis
GO:0060548negative regulation of cell death
GO:1901215negative regulation of neuron death
GO:1905701positive regulation of drug transmembrane export
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0016323basolateral plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 30..83
e-value: 5.7E-10
score: 39.8
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 1052..1117
e-value: 2.8E-11
score: 44.1
IPR003439ABC transporter-likePFAMPF00005ABC_trancoord: 425..559
e-value: 3.8E-21
score: 76.0
IPR003439ABC transporter-likePROSITEPS50893ABC_TRANSPORTER_2coord: 408..633
score: 19.415
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1..153
e-value: 3.5E-45
score: 156.3
NoneNo IPR availablePANTHERPTHR24223FAMILY NOT NAMEDcoord: 1..152
NoneNo IPR availableCOILSCoilCoilcoord: 670..690
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 1018..1117
e-value: 8.2E-25
score: 89.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 383..656
e-value: 1.1E-69
score: 236.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 641..668
NoneNo IPR availablePANTHERPTHR24223:SF350CANALICULAR MULTISPECIFIC ORGANIC ANION TRANSPORTER 2coord: 2..1117
NoneNo IPR availablePANTHERPTHR24223FAMILY NOT NAMEDcoord: 2..1117
NoneNo IPR availableCDDcd18595ABC_6TM_MRP1_2_3_6_D1_likecoord: 124..381
e-value: 1.54885E-82
score: 268.569
NoneNo IPR availableCDDcd18603ABC_6TM_MRP1_2_3_6_D2_likecoord: 712..1011
e-value: 8.92576E-102
score: 320.965
NoneNo IPR availableCDDcd03250ABCC_MRP_domain1coord: 408..607
e-value: 2.48971E-100
score: 313.252
NoneNo IPR availableTMHMMTMhelixcoord: 229..248
NoneNo IPR availableTMHMMTMhelixcoord: 81..103
NoneNo IPR availableTMHMMTMhelixcoord: 757..779
NoneNo IPR availableTMHMMTMhelixcoord: 307..329
NoneNo IPR availableTMHMMTMhelixcoord: 203..225
NoneNo IPR availableTMHMMTMhelixcoord: 968..990
NoneNo IPR availableTMHMMTMhelixcoord: 941..963
NoneNo IPR availableTMHMMTMhelixcoord: 714..736
NoneNo IPR availableTMHMMTMhelixcoord: 853..875
NoneNo IPR availableTMHMMTMhelixcoord: 129..151
IPR030239Multidrug resistance-associated protein 6PANTHERPTHR24223:SF339MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 6coord: 1..152
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1..147
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 1028..1117
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 400..631
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 434..622
e-value: 3.1E-7
score: 40.0
IPR011527ABC transporter type 1, transmembrane domainPFAMPF00664ABC_membranecoord: 716..985
e-value: 3.6E-27
score: 95.7
coord: 90..358
e-value: 4.0E-31
score: 108.7
IPR011527ABC transporter type 1, transmembrane domainPROSITEPS50929ABC_TM1Fcoord: 94..373
score: 33.653
IPR011527ABC transporter type 1, transmembrane domainPROSITEPS50929ABC_TM1Fcoord: 715..999
score: 32.955
IPR036640ABC transporter type 1, transmembrane domain superfamilyGENE3DG3DSA:1.20.1560.10coord: 69..382
e-value: 6.0E-26
score: 93.3
IPR036640ABC transporter type 1, transmembrane domain superfamilyGENE3DG3DSA:1.20.1560.10coord: 678..1017
e-value: 1.8E-31
score: 111.5
IPR036640ABC transporter type 1, transmembrane domain superfamilySUPERFAMILYSSF90123ABC transporter transmembrane regioncoord: 711..1011
IPR036640ABC transporter type 1, transmembrane domain superfamilySUPERFAMILYSSF90123ABC transporter transmembrane regioncoord: 78..389
IPR017871ABC transporter, conserved sitePROSITEPS00211ABC_TRANSPORTER_1coord: 532..546