LIM zinc-binding domain-containing protein

Overview
NameLIM zinc-binding domain-containing protein
Smed IDSMED30014283
Length (bp)5420
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of LIM zinc-binding domain-containing protein (SMED30014283) t-SNE clustered cells

Violin plots show distribution of expression levels for LIM zinc-binding domain-containing protein (SMED30014283) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of LIM zinc-binding domain-containing protein (SMED30014283) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for LIM zinc-binding domain-containing protein (SMED30014283) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014283

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30014283SMESG000013742.1 dd_Smed_v4_16924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30014283SMESG000013742.1 dd_Smed_v4_16924_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014283SMESG000013742.1 dd_Smed_v4_7540_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014283SMESG000013742.1 dd_Smed_v4_7540_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30014283SMESG000013742.1 dd_Smed_v4_7540_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014283SMESG000013742.1 dd_Smed_v4_7540_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30014283SMESG000013742.1 dd_Smed_v4_7540_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014283SMESG000013742.1 Contig51226uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014283SMESG000013742.1 Contig51226newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014283SMESG000013742.1 Contig36586newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30014283SMESG000013742.1 Contig36586uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Human
Match: LIMD2 (LIM domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28142])

HSP 1 Score: 48.521 bits (114), Expect = 5.969e-6
Identity = 25/76 (32.89%), Postives = 38/76 (50.00%), Query Frame = 3
Query: 3588 SDIVSRRRHRHLQSENPLKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKR 3815
            S  V R +   L+++  +K  C  C K  Y MER+  + +IFH  CF C+ C T LS  +      + YC  H ++
Sbjct:   21 SSTVQRSKSFSLRAQ--VKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQ 94          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Human
Match: LIMD2 (LIM domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28142])

HSP 1 Score: 48.521 bits (114), Expect = 9.573e-6
Identity = 25/76 (32.89%), Postives = 38/76 (50.00%), Query Frame = 3
Query: 3588 SDIVSRRRHRHLQSENPLKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKR 3815
            S  V R +   L+++  +K  C  C K  Y MER+  + +IFH  CF C+ C T LS  +      + YC  H ++
Sbjct:   21 SSTVQRSKSFSLRAQ--VKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQ 94          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Human
Match: LIMD2 (LIM domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28142])

HSP 1 Score: 48.521 bits (114), Expect = 9.573e-6
Identity = 25/76 (32.89%), Postives = 38/76 (50.00%), Query Frame = 3
Query: 3588 SDIVSRRRHRHLQSENPLKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKR 3815
            S  V R +   L+++  +K  C  C K  Y MER+  + +IFH  CF C+ C T LS  +      + YC  H ++
Sbjct:   21 SSTVQRSKSFSLRAQ--VKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQ 94          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Human
Match: LIMD2 (LIM domain containing 2 [Source:HGNC Symbol;Acc:HGNC:28142])

HSP 1 Score: 48.521 bits (114), Expect = 9.573e-6
Identity = 25/76 (32.89%), Postives = 38/76 (50.00%), Query Frame = 3
Query: 3588 SDIVSRRRHRHLQSENPLKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKR 3815
            S  V R +   L+++  +K  C  C K  Y MER+  + +IFH  CF C+ C T LS  +      + YC  H ++
Sbjct:   21 SSTVQRSKSFSLRAQ--VKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAALHGEFYCKPHFQQ 94          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Fly
Match: CG33521 (gene:FBgn0250819 transcript:FBtr0334661)

HSP 1 Score: 51.9878 bits (123), Expect = 4.602e-6
Identity = 22/58 (37.93%), Postives = 31/58 (53.45%), Query Frame = 3
Query: 3651 CNVCFKPAYFMERISIN----NIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAK 3812
            C+ C KP Y ME + ++      IFHK C  C+ C  HL F++  +H    YC +H K
Sbjct:   80 CHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCSMHFK 137          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Fly
Match: CG33521 (gene:FBgn0250819 transcript:FBtr0091472)

HSP 1 Score: 52.373 bits (124), Expect = 4.647e-6
Identity = 22/58 (37.93%), Postives = 31/58 (53.45%), Query Frame = 3
Query: 3651 CNVCFKPAYFMERISIN----NIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAK 3812
            C+ C KP Y ME + ++      IFHK C  C+ C  HL F++  +H    YC +H K
Sbjct:   80 CHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCSMHFK 137          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Fly
Match: CG33521 (gene:FBgn0250819 transcript:FBtr0091473)

HSP 1 Score: 51.9878 bits (123), Expect = 4.968e-6
Identity = 22/58 (37.93%), Postives = 31/58 (53.45%), Query Frame = 3
Query: 3651 CNVCFKPAYFMERISIN----NIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAK 3812
            C+ C KP Y ME + ++      IFHK C  C+ C  HL F++  +H    YC +H K
Sbjct:   66 CHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCSMHFK 123          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Fly
Match: CG33521 (gene:FBgn0250819 transcript:FBtr0091470)

HSP 1 Score: 51.9878 bits (123), Expect = 4.968e-6
Identity = 22/58 (37.93%), Postives = 31/58 (53.45%), Query Frame = 3
Query: 3651 CNVCFKPAYFMERISIN----NIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAK 3812
            C+ C KP Y ME + ++      IFHK C  C+ C  HL F++  +H    YC +H K
Sbjct:   66 CHQCKKPVYKMEEVILSLKTATTIFHKTCLRCKDCGKHLKFDSYNVHDGSLYCSMHFK 123          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Zebrafish
Match: limd2 (LIM domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-120906-1])

HSP 1 Score: 49.6766 bits (117), Expect = 1.590e-6
Identity = 23/55 (41.82%), Postives = 30/55 (54.55%), Query Frame = 3
Query: 3642 KPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVH 3806
            K  C  C K  Y MER+  NN+IFH  CF C+ C+T LS  +    + + YC  H
Sbjct:   24 KETCASCEKTVYPMERLVANNLIFHAACFCCKHCNTKLSLGSYAALQGEFYCKPH 78          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Mouse
Match: Limd2 (LIM domain containing 2 [Source:MGI Symbol;Acc:MGI:1915053])

HSP 1 Score: 48.521 bits (114), Expect = 6.100e-6
Identity = 25/76 (32.89%), Postives = 38/76 (50.00%), Query Frame = 3
Query: 3588 SDIVSRRRHRHLQSENPLKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKR 3815
            S  V R +   L+++  +K  C  C K  Y MER+  + +IFH  CF C+ C T LS  +      + YC  H ++
Sbjct:   22 SSTVQRSKSFSLRAQ--VKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCRPHFQQ 95          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Mouse
Match: Limd2 (LIM domain containing 2 [Source:MGI Symbol;Acc:MGI:1915053])

HSP 1 Score: 48.521 bits (114), Expect = 6.100e-6
Identity = 25/76 (32.89%), Postives = 38/76 (50.00%), Query Frame = 3
Query: 3588 SDIVSRRRHRHLQSENPLKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKR 3815
            S  V R +   L+++  +K  C  C K  Y MER+  + +IFH  CF C+ C T LS  +      + YC  H ++
Sbjct:   22 SSTVQRSKSFSLRAQ--VKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCRPHFQQ 95          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Mouse
Match: Limd2 (LIM domain containing 2 [Source:MGI Symbol;Acc:MGI:1915053])

HSP 1 Score: 48.521 bits (114), Expect = 6.100e-6
Identity = 25/76 (32.89%), Postives = 38/76 (50.00%), Query Frame = 3
Query: 3588 SDIVSRRRHRHLQSENPLKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKR 3815
            S  V R +   L+++  +K  C  C K  Y MER+  + +IFH  CF C+ C T LS  +      + YC  H ++
Sbjct:   22 SSTVQRSKSFSLRAQ--VKETCAACQKTVYPMERLVADKLIFHNSCFCCKHCHTKLSLGSYAAMHGEFYCRPHFQQ 95          
BLAST of LIM zinc-binding domain-containing protein vs. TrEMBL
Match: W6UJ49 (Uncharacterized protein OS=Echinococcus granulosus OX=6210 GN=EGR_04024 PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 2.105e-35
Identity = 142/469 (30.28%), Postives = 228/469 (48.61%), Query Frame = 3
Query: 3831 VRSVSANKLNQIKERLDNKTNKQS---NNEVKHQK-RVFYGGIKSAKEKFLQDQT----AVQEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDGSNVYNDDIT-------------RLAQTS------------------------STKEKLARFKELQ----EKSFDKAQI------------NEDDSGL--PKKE--------VISVDTKSLRNKFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVR-MDVVKSDQNIDEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEI-GEGGIYESQPQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPIKLDLDITNGGIYENKPAESQADSVSDQN-DEYLNEFPDKKYANEAKRLFLERXXXXXXAKLKRNTPQMIDIWKDLCKDSGVFENKPKLQNKDVM 5015
            V   S  + + I+ R +   N Q    + EV+ +K ++ Y G+ S K+KF+Q+        Q+   R+ K  TPPR+GV  GV+ES+P  R   +  +  G +   D I              RL QT                         +T+   AR+K+++    E   +K +I            NE DS L   + E        V++      +N FL        ESK+ +L+P  E+QELA RE NSIYE+ P  R  DVV +D  +D+    ++ + AK ++EKF +  P +  ++ +K  +E+ GEGG+YE++P++R DD+I      D   P +   +   K + ++  + +      NE I L        ++E++P  S AD+ +DQ+ DE L       +A+ AK+ FLERQ++ EEA  K+ TP MIDIW ++ K+SGVFEN P  + + ++
Sbjct:  222 VAGGSGARASDIRNRFERGENFQEADKSKEVRKRKTKLKYAGVGSMKDKFMQEAARAVNGSQDGQPRKLKEITPPREGVAVGVLESQPTARPEGVEGADTGESTVTDYIGIGKKTKDMRERFKRLEQTGGVVEEENGEKKPVESEELRQVATEATRSAKARWKDIESGKVETKIEKTKIDLGNSSQGGVYENEPDSLLDIARSEERDDAAHLVVTTSAAERKNAFLKKAT---EESKVKRLDPKAELQELASRERNSIYESTPAARPEDVVTADSGVDD---YLNLSGAKSIREKFQD--PSKLQREVKKTTIELRGEGGVYENEPRQR-DDVIRSGDVDDTPTPGDVKWASAAKERFMKDAEERAKAVKRNEKIVLVEGAVGPTVFESQPTNSAADAKADQDEDEQLV----GAFASNAKQRFLERQKEAEEAGKKKATPGMIDIWSEMPKESGVFENVPAARKEGII 677          
BLAST of LIM zinc-binding domain-containing protein vs. TrEMBL
Match: A0A158R807 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4673 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 1.410e-33
Identity = 135/438 (30.82%), Postives = 213/438 (48.63%), Query Frame = 3
Query: 3915 KHQKRVFYGGIKSAKEKFLQDQT----AVQEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDGSNVYNDDIT-------------RLAQTS------------------------STKEKLARFKELQ----EKSFDKAQI------------NEDDSGL--PKKE--------VISVDTKSLRNKFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVR-MDVVKSDQNI-DEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEI-GEGGIYESQPQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPIKLDLDITNGGIYENKPAESQADSVSDQN-DEYLNEFPDKKYANEAKRLFLERXXXXXXAKLKRNTPQMIDIWKDLCKDSGVFENKPKLQNKDVM 5015
            K + ++ Y G+ S K+KF+Q+        Q+   R+ K  TPPR+GV  GV+ES+P  R   +  +  G +   D I              RL QT                         +T+   AR+K+++    E   +K +I            NE DS L   + E        V++      +N FL        ESK+ +L+P  E+QELA RE NSIYE+ P  R  D+V +D +I D  N++     AK ++EKF +  P +   + +K  +E+ GEGG+YE++PQ+R DD+I      D   P +   +   K + ++  + +       E I L        ++E++P  S AD+ +DQ+ DE+L       +A+ AK+ FLERQ++ EEA  K++TP +IDIW ++ K+SGVFEN P    + V+
Sbjct:  111 KRKTKLKYAGVGSMKDKFMQEAARAVNGSQDEQPRKLKEITPPREGVAVGVLESQPAARPEGVEGADTGESTVTDYIGIGKKTKDMREKFKRLEQTGGVIEEENGEKKPTESKELRQVATEATRSAKARWKDIESGKVETKIEKTKIDMGNSSQGGVFENEPDSLLDIARSEEREDAAHLVVTTSAAERKNAFLKKAA---EESKVKRLDPKAELQELASRERNSIYESTPVARPEDIVTADPSIADYQNLS----GAKSIREKFQD--PSKLQHEVKKTTIELRGEGGVYENEPQQR-DDVIRSGDVDDTPTPGDVKWASAAKERFMKDAEERAKAVKRTEKIVLVEGAVGPTVFESQPTNSAADAKADQDEDEHLV----GAFASSAKQRFLERQKEAEEAGKKKSTPGIIDIWSEMPKESGVFENVPAAHKEGVI 534          
BLAST of LIM zinc-binding domain-containing protein vs. TrEMBL
Match: A0A068WQA4 (Expressed conserved protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000198900 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 1.621e-33
Identity = 130/423 (30.73%), Postives = 207/423 (48.94%), Query Frame = 3
Query: 3957 KEKFLQDQT----AVQEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDGSNVYNDDIT-------------RLAQTS------------------------STKEKLARFKELQ----EKSFDKAQI------------NEDDSGL--PKKE--------VISVDTKSLRNKFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVR-MDVVKSDQNIDEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEI-GEGGIYESQPQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPIKLDLDITNGGIYENKPAESQADSVSDQN-DEYLNEFPDKKYANEAKRLFLERXXXXXXAKLKRNTPQMIDIWKDLCKDSGVFENKPKLQNKDVM 5015
            K+KF+Q+        Q+   R+ K  TPPR+GV  GV+ES+P  R   +  +  G +   D I              RL QT                         +T+   AR+K+++    E   +K +I            NE DS L   + E        V++      +N FL        ESK+ +L+P  E+QELA RE NSIYE+ P  R  DVV +D  +D+    ++ + AK ++EKF +  P +  ++ +K  +E+ GEGG+YE++P++R DD+I      D   P +   +   K + ++ ++ +      NE I L        ++E++P  S AD+ +DQ+ DE L       +A+ AK+ FLERQ++ EEA  K+ TP MIDIW ++ K+SGVFEN P  + + ++
Sbjct:    2 KDKFMQEAARAVNGSQDGQPRKLKEITPPREGVAVGVLESQPTARPEGVEGADTGESTVTDYIGIGKKTKDMRERFKRLEQTGGVVEEENGEKKPVESEELRQVATEATRSAKARWKDIESGKVETKIEKTKIDLGNSSQGGVYENEPDSLLDIARSEERDDAAHLVVTTSAAERKNAFLKKAT---EESKVKRLDPKAELQELASRERNSIYESTPAARPEDVVTADSGVDD---YLNLSGAKSIREKFQD--PSKLQREVKKTTIELRGEGGVYENEPRQR-DDVIRSGDVDDTPTPGDVKWASAAKERFMKDVEERAKAVKRNEKIVLVEGAVGPTVFESQPTNSAADAKADQDEDEQLV----GAFASNAKQRFLERQKEAEEAGKKKATPGMIDIWSEMPKESGVFENVPAARKEGII 411          
BLAST of LIM zinc-binding domain-containing protein vs. TrEMBL
Match: A0A3P7W0P5 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS11720 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 4.476e-32
Identity = 129/444 (29.05%), Postives = 214/444 (48.20%), Query Frame = 3
Query: 3870 ERLDNKTNKQSNNEVKHQK-RVFYGGIKSAKEKFLQD-QTAV------QEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDG---------------------------SNVYNDDITRLAQTSSTKEKLARFKELQ----EKSFDKAQI---NEDDSGLPKKE------------------VISVDTKSLRNKFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVRMD-VVKSDQNIDEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEI-GEGGIYESQPQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPIKLDLDITNGGIYENKPAESQADSVSDQNDEYLNEFPDKKYANEAKRLFLERXXXXXXAKLKRNTPQMIDIWKDLCKDSGVFENKPKLQNKDVM 5015
            E+ D+  +   N EVK +K ++ Y G+ S KEKF+++ + AV      ++P  R+ K  TPPR+GV  GV+ES+P  R   ++ +  G                           +     D  R   T +T+   AR+K+++    E   +K +I   N    G+ + E                  VI+      +N FL        ESK+ +L+P  E+QELA +E N +YE+ P  R D VV +D+   +  + +S   AK ++EKF +  P +   + +K   E+ GEGG+YE++PQ+R DD++      +   P +   +   K + ++  + +       E I L        +YE++PA S AD+ +DQ +    E     +   AK+ FLE+Q++ +EA  K+ TP +IDIW ++ K+SGVFEN P    + V+
Sbjct:   50 EKGDSFQDADKNKEVKKRKTKLKYAGVGSVKEKFIKEAEKAVNGTPSDKQP--RKMKEITPPREGVATGVLESQPAARPEGVVAASVGEQTDYIGIGKKTKDVDEENGEVEGKKAAGAAESDELRQVATEATRSAKARWKDIESGKVETKVEKTKIELGNSTQGGIYENEPDKLLDIARQEKDDDAHLVITASAAERKNAFLKKAA---EESKVKRLDPKAELQELASKEKNVVYESTPAARPDDVVAADKAAVDDYLNLS--GAKSIREKFLD--PSKLQNEIKKTTFELRGEGGVYENEPQQR-DDVVRGGEADEAPAPGDVKWASAAKERFMKDAEERAKAIKKTEKISLVEGAVGPTVYESQPANSAADAKADQEE---GEQLVGAFTTSAKQRFLEKQKEADEAAKKKATPGIIDIWSEMPKESGVFENVPAAHMEGVV 480          
BLAST of LIM zinc-binding domain-containing protein vs. TrEMBL
Match: A0A158QJF6 (Uncharacterized protein OS=Rodentolepis nana OX=102285 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 5.334e-32
Identity = 129/444 (29.05%), Postives = 214/444 (48.20%), Query Frame = 3
Query: 3870 ERLDNKTNKQSNNEVKHQK-RVFYGGIKSAKEKFLQD-QTAV------QEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDG---------------------------SNVYNDDITRLAQTSSTKEKLARFKELQ----EKSFDKAQI---NEDDSGLPKKE------------------VISVDTKSLRNKFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVRMD-VVKSDQNIDEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEI-GEGGIYESQPQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPIKLDLDITNGGIYENKPAESQADSVSDQNDEYLNEFPDKKYANEAKRLFLERXXXXXXAKLKRNTPQMIDIWKDLCKDSGVFENKPKLQNKDVM 5015
            E+ D+  +   N EVK +K ++ Y G+ S KEKF+++ + AV      ++P  R+ K  TPPR+GV  GV+ES+P  R   ++ +  G                           +     D  R   T +T+   AR+K+++    E   +K +I   N    G+ + E                  VI+      +N FL        ESK+ +L+P  E+QELA +E N +YE+ P  R D VV +D+   +  + +S   AK ++EKF +  P +   + +K   E+ GEGG+YE++PQ+R DD++      +   P +   +   K + ++  + +       E I L        +YE++PA S AD+ +DQ +    E     +   AK+ FLE+Q++ +EA  K+ TP +IDIW ++ K+SGVFEN P    + V+
Sbjct:   50 EKGDSFQDADKNKEVKKRKTKLKYAGVGSVKEKFIKEAEKAVNGTPSDKQP--RKMKEITPPREGVATGVLESQPAARPEGVVAASVGEQTDYIGIGKKTKDVDEENGEVEGKKAAGAAESDELRQVATEATRSAKARWKDIESGKVETKVEKTKIELGNSTQGGIYENEPDKLLDIARQEKDDDAHLVITASAAERKNAFLKKAA---EESKVKRLDPKAELQELASKEKNVVYESTPAARPDDVVAADKAAVDDYLNLS--GAKSIREKFLD--PSKLQNEIKKTTFELRGEGGVYENEPQQR-DDVVRGGEADEAPAPGDVKWASAAKERFMKDAEERAKAIKKTEKISLVEGAVGPTVYESQPANSAADAKADQEE---GEQLVGAFTTSAKQRFLEKQKEADEAAKKKATPGIIDIWSEMPKESGVFENVPAAHMEGVV 480          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Cavefish
Match: limd2 (LIM domain containing 2 [Source:NCBI gene;Acc:103034267])

HSP 1 Score: 48.1358 bits (113), Expect = 4.801e-6
Identity = 21/52 (40.38%), Postives = 28/52 (53.85%), Query Frame = 3
Query: 3651 CNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVH 3806
            C  C K  Y MER+  NN+IFH +CF C+ C+  LS       + + YC  H
Sbjct:   27 CAACQKTVYPMERLVANNLIFHTVCFCCKHCNAKLSLGTYAALQGEFYCKPH 78          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000032509.1 (uncharacterized LOC103022480 [Source:NCBI gene;Acc:103022480])

HSP 1 Score: 51.9878 bits (123), Expect = 7.913e-6
Identity = 20/56 (35.71%), Postives = 29/56 (51.79%), Query Frame = 3
Query: 3648 LCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKR 3815
            +C  C  P Y MERI  +  + H  CF C+ C T LS +N      + YC+ H ++
Sbjct:   90 MCYACETPVYPMERIVADEHVLHTSCFCCKHCRTKLSLHNYSSLYGEFYCVSHYQQ 145          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005882.1 (pep scaffold:Pmarinus_7.0:GL476535:329859:333216:1 gene:ENSPMAG00000005319.1 transcript:ENSPMAT00000005882.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 2.473e-6
Identity = 20/55 (36.36%), Postives = 30/55 (54.55%), Query Frame = 3
Query: 3651 CNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKR 3815
            C  C  P Y +E++      +HKMCF C +C+T L+ NN     ++PYC  H  +
Sbjct:    5 CARCQHPVYPLEKLDCLGQTWHKMCFYCEECETVLTVNNFKSFEKRPYCHAHCPK 59          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Nematostella
Match: EDO50008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF11])

HSP 1 Score: 48.1358 bits (113), Expect = 1.716e-6
Identity = 22/60 (36.67%), Postives = 32/60 (53.33%), Query Frame = 3
Query: 3636 PLKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKR 3815
            P +  C VC K  Y MER++ +  ++HK CF C +C+  L   N    + K YC  H K+
Sbjct:   17 PPQEKCEVCNKTVYPMERLAADKKVYHKFCFKCNECNNTLRLGNYAALQGKVYCKPHFKQ 76          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Nematostella
Match: LASP3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI32])

HSP 1 Score: 50.447 bits (119), Expect = 1.859e-6
Identity = 27/99 (27.27%), Postives = 48/99 (48.48%), Query Frame = 3
Query: 3639 LKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKRKTLKPVRSVSANKLNQIKERLDNKTNKQSNNEVKHQKRVF 3935
            + P C  C K  Y  E+++  + I+HK CF C  C+  L+  N   + + PYC  H        V     N   ++K++ DN+++ + + E + +K  F
Sbjct:    1 MNPQCTKCAKTVYSQEKLNCLDKIWHKTCFRCVVCNMALNMKNYKGYNKNPYCNAHYPTPKFTAVADTPENL--RLKKQTDNQSSLKYHKEYEQEKGKF 97          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Medaka
Match: xirp2b (xin actin binding repeat containing 2 [Source:NCBI gene;Acc:101155974])

HSP 1 Score: 49.6766 bits (117), Expect = 1.314e-6
Identity = 30/92 (32.61%), Postives = 42/92 (45.65%), Query Frame = 3
Query: 3642 KPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKRKTLKPVRSVSANKLNQIKERLDNKTNKQSNNEVK 3917
            K LC VC K AY M+ + ++   +HK CF C  C   LS  N +      YCL H K+     +     N  N I ++L    +K   N V+
Sbjct:   25 KCLCTVCRKRAYPMDALIVDKKKYHKSCFCCEHCKNKLSLGNYVSLHGHFYCLPHYKQ-----LLKSKGNSDNGIGQKLRTWISKAQKNTVR 111          
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000014630.2 (LIM and SH3 domain protein 1 [Source:NCBI gene;Acc:101165512])

HSP 1 Score: 50.8322 bits (120), Expect = 6.664e-6
Identity = 21/62 (33.87%), Postives = 31/62 (50.00%), Query Frame = 3
Query: 3639 LKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKRKTL 3824
            + P C  C KP Y  E+I+  +  +HK CF C  C   LS  N     ++PYC +H  + + 
Sbjct:    2 MNPSCGRCNKPVYPTEKINCLDKFWHKCCFSCEVCKMALSMKNYKGFEKRPYCSMHYPKTSF 63          
BLAST of LIM zinc-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000013742.1 (SMESG000013742.1)

HSP 1 Score: 2560.79 bits (6636), Expect = 0.000e+0
Identity = 1302/1311 (99.31%), Postives = 1307/1311 (99.69%), Query Frame = 3
Query: 1167 HVPFFPPGIASHKKSPSFKRPQSVKECKKLSKHRCPSTSLNMKSSRRISTSTPNIMVTISSSDHILSIPKHNCDMGLSDHNTFRATPLPQYYSPDSLERNRTLFEQLDHNYKTRSLDRTSVTAKSLDQMAVKSKSKTYTNFVPEKPFYPPSKYPNIHDKSNLNLQRFLETRQQYKTPQSRKSVKINNRNKDRNSRPTNLSMKISNIGGSVPNLALRNLKDIPNKYSKDEFHKKDPNNKSPDRSLSKSFIDHVEYSPEMGFYRSSHKLDLQDEFDFCVPKQMSTSYFYPKPIPNQFCNDFNDKMAQSLYNESSLAAKIHMGSLXXXXXXXXXXXXXXEKIEVTDLDDSPSKSYSPIKQCNSFSQDSLDGNRRHAKVPNEANSEKTGTDRTDSLTECDKSYNXXXXXXXXXXXXKTYKFQSPTEDDYSIHNVETPNKYINSLSTISERDKTSEDHKKSTVIDKYGLGQYCESNTIPNDNNGNTCKNTTDNLENSSVISDSKSYNPKNAMENDIPNIKSENQHFFQDPNQSENLSDDRFYNSNQGDKSNATVHGQYDKNPNKNPYNSSDDFTNNSLFHTKSEKNLSSIYPENYNNSGNSPIHSENTNRKSGFLLDQYNLDRYLKDDSIPTKSFIITRNSVSINSEFLNETPASNKNTSDRVLLDQIASKCIVSTNELFNFKRENCVCIDNVIVGESFKCSTDLQGQQKPNGVDSATSTIFSTINTQVSGLDYDLTDNGVTNQLFREMKNRPLPKIKIQSDVTXXXXXXXXXXXXXXXXXXTSYLRYECNSVHLPHRERSWVSSPELTMARSDIVSRRRHRHLQSENPLKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKRKTLKPVRSVSANKLNQIKERLDNKTNKQSNNEVKHQKRVFYGGIKSAKEKFLQDQTAVQEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDGSNVYNDDITRLAQTSSTKEKLARFKELQEKSFDKAQINEDDSGLPKKEVISVDTKSLRNKFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVRMDVVKSDQNIDEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEIGEGGIYESQPQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPIKLDLDITNGGIYENKPAESQADSVSDQNDEYLNEFPDKKYANEAKRLFLERXXXXXXAKLKRNTPQMIDIWKDLCKDSGVFENKPKLQNKDVMRHDDKINEELIVENQIAEQVVASEDETR 5099
            HVPFFPPGI+SHKKSPSFKRPQSVKECKKLSKHRCPSTSLNMKSSRRISTSTPNIMVTISSSDHILSIPKHNCDMGLSDHNTFRATPLPQYYSPDSLERNRTLFEQLDHNYKTRSLDRTSVTAKSLDQMAVKSKSKTYTNFVPEKPFYPPSKYPNIHDKSNLNLQRFLETRQQYKTPQSRKSV+I NRNKDR SRPTNLSMKISNIGGSVPNLALRNLKDIPNKYSKDEFHKKDPNNKSPDRSLSKSFIDHVEYSPEMGFYRSSHKLDLQDEFDFCVPKQMSTSYFYPKPIPNQFCNDFNDKMAQSLYNESSLAAKIHMGSLERAARNNYYSNNNEEKIEVTDLDDSPSKSYSPIKQCNSFSQDSLDGNRRHAKVPNEANSEKTGTDRTDSLTECDKSYNSISEEISTGTESKTYKFQSPTEDDYSIHNVETPNKYINSLSTISERDKTSEDHKKSTVIDKYGLGQYCESNTI NDNN NTCKNTTDNLENSSVISDSKSYNPKNAMENDIPNIKSENQHFFQDPNQSENLSDDRFYNSNQGDKSNATVHGQYDKNPNKNPYNSSDDFTNNSLFHTKSEKNLSS+YPENYNNSGNSPIHSENTNRKSGFLLDQYNLDRYLKDDSIPT+SFIITRNSVSI+SEFLNETPASNKNTSDRVLLDQIASKCIVSTNELFNFKRENCVCIDNVIVGESFKCSTDLQGQQKPNGVDSATSTIFSTINTQVSGLDYDLTDNGVTNQLFREMKNRPLPKIKIQSDVTNSVENSSETESSLSGSDNTSYLRYECNSVHLPHRERSWVSSPELTMARSDIVSRRRHRHLQSENPLKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKRKTLKPVRSVSANKLNQIKERLDNKTNKQSNNEVKHQKRVFYGGIKSAKEKFLQDQTAVQEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDGSNVYNDDITRLAQTSSTKEKLARFKELQEKSFDKAQINEDDSGLPKKEVISVDTKSLRNKFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVRMDVVKSDQNIDEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEIGEGGIYESQPQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPIKLDLDITNGGIYENKPAESQADSVSDQNDEYLNEFPDKKYANEAKRLFLERQQQEEEAKLKRNTPQMIDIWKDLCKDSGVFENKPKLQNKDVMRHDDKINEELIVENQIAEQVVASEDETR
Sbjct:   11 HVPFFPPGISSHKKSPSFKRPQSVKECKKLSKHRCPSTSLNMKSSRRISTSTPNIMVTISSSDHILSIPKHNCDMGLSDHNTFRATPLPQYYSPDSLERNRTLFEQLDHNYKTRSLDRTSVTAKSLDQMAVKSKSKTYTNFVPEKPFYPPSKYPNIHDKSNLNLQRFLETRQQYKTPQSRKSVRIKNRNKDRYSRPTNLSMKISNIGGSVPNLALRNLKDIPNKYSKDEFHKKDPNNKSPDRSLSKSFIDHVEYSPEMGFYRSSHKLDLQDEFDFCVPKQMSTSYFYPKPIPNQFCNDFNDKMAQSLYNESSLAAKIHMGSLERAARNNYYSNNNEEKIEVTDLDDSPSKSYSPIKQCNSFSQDSLDGNRRHAKVPNEANSEKTGTDRTDSLTECDKSYNSISEEISTGTESKTYKFQSPTEDDYSIHNVETPNKYINSLSTISERDKTSEDHKKSTVIDKYGLGQYCESNTIANDNNVNTCKNTTDNLENSSVISDSKSYNPKNAMENDIPNIKSENQHFFQDPNQSENLSDDRFYNSNQGDKSNATVHGQYDKNPNKNPYNSSDDFTNNSLFHTKSEKNLSSMYPENYNNSGNSPIHSENTNRKSGFLLDQYNLDRYLKDDSIPTESFIITRNSVSIHSEFLNETPASNKNTSDRVLLDQIASKCIVSTNELFNFKRENCVCIDNVIVGESFKCSTDLQGQQKPNGVDSATSTIFSTINTQVSGLDYDLTDNGVTNQLFREMKNRPLPKIKIQSDVTNSVENSSETESSLSGSDNTSYLRYECNSVHLPHRERSWVSSPELTMARSDIVSRRRHRHLQSENPLKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKRKTLKPVRSVSANKLNQIKERLDNKTNKQSNNEVKHQKRVFYGGIKSAKEKFLQDQTAVQEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDGSNVYNDDITRLAQTSSTKEKLARFKELQEKSFDKAQINEDDSGLPKKEVISVDTKSLRNKFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVRMDVVKSDQNIDEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEIGEGGIYESQPQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPIKLDLDITNGGIYENKPAESQADSVSDQNDEYLNEFPDKKYANEAKRLFLERQQQEEEAKLKRNTPQMIDIWKDLCKDSGVFENKPKLQNKDVMRHDDKINEELIVENQIAEQVVASEDETR 1321          
BLAST of LIM zinc-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000013742.1 (SMESG000013742.1)

HSP 1 Score: 2446 bits (6338), Expect = 0.000e+0
Identity = 1249/1260 (99.13%), Postives = 1254/1260 (99.52%), Query Frame = 3
Query: 1167 HVPFFPPGIASHKKSPSFKRPQSVKECKKLSKHRCPSTSLNMKSSRRISTSTPNIMVTISSSDHILSIPKHNCDMGLSDHNTFRATPLPQYYSPDSLERNRTLFEQLDHNYKTRSLDRTSVTAKSLDQMAVKSKSKTYTNFVPEKPFYPPSKYPNIHDKSNLNLQRFLETRQQYKTPQSRKSVKINNRNKDRNSRPTNLSMKISNIGGSVPNLALRNLKDIPNKYSKDEFHKKDPNNKSPDRSLSKSFIDHVEYSPEMGFYRSSHKLDLQDEFDFCVPKQMSTSYFYPKPIPNQFCNDFNDKMAQSLYNESSLAAKIHMGSLXXXXXXXXXXXXXXEKIEVTDLDDSPSKSYSPIKQCNSFSQDSLDGNRRHAKVPNEANSEKTGTDRTDSLTECDKSYNXXXXXXXXXXXXKTYKFQSPTEDDYSIHNVETPNKYINSLSTISERDKTSEDHKKSTVIDKYGLGQYCESNTIPNDNNGNTCKNTTDNLENSSVISDSKSYNPKNAMENDIPNIKSENQHFFQDPNQSENLSDDRFYNSNQGDKSNATVHGQYDKNPNKNPYNSSDDFTNNSLFHTKSEKNLSSIYPENYNNSGNSPIHSENTNRKSGFLLDQYNLDRYLKDDSIPTKSFIITRNSVSINSEFLNETPASNKNTSDRVLLDQIASKCIVSTNELFNFKRENCVCIDNVIVGESFKCSTDLQGQQKPNGVDSATSTIFSTINTQVSGLDYDLTDNGVTNQLFREMKNRPLPKIKIQSDVTXXXXXXXXXXXXXXXXXXTSYLRYECNSVHLPHRERSWVSSPELTMARSDIVSRRRHRHLQSENPLKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKRKTLKPVRSVSANKLNQIKERLDNKTNKQSNNEVKHQKRVFYGGIKSAKEKFLQDQTAVQEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDGSNVYNDDITRLAQTSSTKEKLARFKELQEKSFDKAQINEDDSGLPKKEVISVDTKSLRNKFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVRMDVVKSDQNIDEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEIGEGGIYESQPQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPIKLDLDITNGGIYENKPAESQADSVSDQNDEYLNEFPDKKYANEAKRLFLERXXXXXXAKLKRNTPQMIDI 4946
            HVPFFPPGI+SHKKSPSFKRPQSVKECKKLSKHRCPSTSLNMKSSRRISTSTPNIMVTISSSDHILSIPKHNCDMGLSDHNTFRATPLPQYYSPDSLERNRTLFEQLDHNYKTRSLDRTSVTAKSLDQMAVKSKSKTYTNFVPEKPFYPPSKYPNIHDKSNLNLQRFLETRQQYKTPQSRKSV+I NRNKDR SRPTNLSMKISNIGGSVPNLALRNLKDIPNKYSKDEFHKKDPNNKSPDRSLSKSFIDHVEYSPEMGFYRSSHKLDLQDEFDFCVPKQMSTSYFYPKPIPNQFCNDFNDKMAQSLYNESSLAAKIHMGSLERAARNNYYSNNNEEKIEVTDLDDSPSKSYSPIKQCNSFSQDSLDGNRRHAKVPNEANSEKTGTDRTDSLTECDKSYNSISEEISTGTESKTYKFQSPTEDDYSIHNVETPNKYINSLSTISERDKTSEDHKKSTVIDKYGLGQYCESNTI NDNN NTCKNTTDNLENSSVISDSKSYNPKNAMENDIPNIKSENQHFFQDPNQSENLSDDRFYNSNQGDKSNATVHGQYDKNPNKNPYNSSDDFTNNSLFHTKSEKNLSS+YPENYNNSGNSPIHSENTNRKSGFLLDQYNLDRYLKDDSIPT+SFIITRNSVSI+SEFLNETPASNKNTSDRVLLDQIASKCIVSTNELFNFKRENCVCIDNVIVGESFKCSTDLQGQQKPNGVDSATSTIFSTINTQVSGLDYDLTDNGVTNQLFREMKNRPLPKIKIQSDVTNSVENSSETESSLSGSDNTSYLRYECNSVHLPHRERSWVSSPELTMARSDIVSRRRHRHLQSENPLKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKRKTLKPVRSVSANKLNQIKERLDNKTNKQSNNEVKHQKRVFYGGIKSAKEKFLQDQTAVQEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDGSNVYNDDITRLAQTSSTKEKLARFKELQEKSFDKAQINEDDSGLPKKEVISVDTKSLRNKFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVRMDVVKSDQNIDEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEIGEGGIYESQPQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPIKLDLDITNGGIYENKPAESQADSVSDQNDEYLNEFPDKKYANEAKRLFLERQQQEEEAKLKRNTPQM  I
Sbjct:   11 HVPFFPPGISSHKKSPSFKRPQSVKECKKLSKHRCPSTSLNMKSSRRISTSTPNIMVTISSSDHILSIPKHNCDMGLSDHNTFRATPLPQYYSPDSLERNRTLFEQLDHNYKTRSLDRTSVTAKSLDQMAVKSKSKTYTNFVPEKPFYPPSKYPNIHDKSNLNLQRFLETRQQYKTPQSRKSVRIKNRNKDRYSRPTNLSMKISNIGGSVPNLALRNLKDIPNKYSKDEFHKKDPNNKSPDRSLSKSFIDHVEYSPEMGFYRSSHKLDLQDEFDFCVPKQMSTSYFYPKPIPNQFCNDFNDKMAQSLYNESSLAAKIHMGSLERAARNNYYSNNNEEKIEVTDLDDSPSKSYSPIKQCNSFSQDSLDGNRRHAKVPNEANSEKTGTDRTDSLTECDKSYNSISEEISTGTESKTYKFQSPTEDDYSIHNVETPNKYINSLSTISERDKTSEDHKKSTVIDKYGLGQYCESNTIANDNNVNTCKNTTDNLENSSVISDSKSYNPKNAMENDIPNIKSENQHFFQDPNQSENLSDDRFYNSNQGDKSNATVHGQYDKNPNKNPYNSSDDFTNNSLFHTKSEKNLSSMYPENYNNSGNSPIHSENTNRKSGFLLDQYNLDRYLKDDSIPTESFIITRNSVSIHSEFLNETPASNKNTSDRVLLDQIASKCIVSTNELFNFKRENCVCIDNVIVGESFKCSTDLQGQQKPNGVDSATSTIFSTINTQVSGLDYDLTDNGVTNQLFREMKNRPLPKIKIQSDVTNSVENSSETESSLSGSDNTSYLRYECNSVHLPHRERSWVSSPELTMARSDIVSRRRHRHLQSENPLKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKRKTLKPVRSVSANKLNQIKERLDNKTNKQSNNEVKHQKRVFYGGIKSAKEKFLQDQTAVQEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDGSNVYNDDITRLAQTSSTKEKLARFKELQEKSFDKAQINEDDSGLPKKEVISVDTKSLRNKFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVRMDVVKSDQNIDEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEIGEGGIYESQPQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPIKLDLDITNGGIYENKPAESQADSVSDQNDEYLNEFPDKKYANEAKRLFLERQQQEEEAKLKRNTPQMSSI 1270          
BLAST of LIM zinc-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000013742.1 (SMESG000013742.1)

HSP 1 Score: 1483 bits (3838), Expect = 0.000e+0
Identity = 750/759 (98.81%), Postives = 755/759 (99.47%), Query Frame = 3
Query: 1167 HVPFFPPGIASHKKSPSFKRPQSVKECKKLSKHRCPSTSLNMKSSRRISTSTPNIMVTISSSDHILSIPKHNCDMGLSDHNTFRATPLPQYYSPDSLERNRTLFEQLDHNYKTRSLDRTSVTAKSLDQMAVKSKSKTYTNFVPEKPFYPPSKYPNIHDKSNLNLQRFLETRQQYKTPQSRKSVKINNRNKDRNSRPTNLSMKISNIGGSVPNLALRNLKDIPNKYSKDEFHKKDPNNKSPDRSLSKSFIDHVEYSPEMGFYRSSHKLDLQDEFDFCVPKQMSTSYFYPKPIPNQFCNDFNDKMAQSLYNESSLAAKIHMGSLXXXXXXXXXXXXXXEKIEVTDLDDSPSKSYSPIKQCNSFSQDSLDGNRRHAKVPNEANSEKTGTDRTDSLTECDKSYNXXXXXXXXXXXXKTYKFQSPTEDDYSIHNVETPNKYINSLSTISERDKTSEDHKKSTVIDKYGLGQYCESNTIPNDNNGNTCKNTTDNLENSSVISDSKSYNPKNAMENDIPNIKSENQHFFQDPNQSENLSDDRFYNSNQGDKSNATVHGQYDKNPNKNPYNSSDDFTNNSLFHTKSEKNLSSIYPENYNNSGNSPIHSENTNRKSGFLLDQYNLDRYLKDDSIPTKSFIITRNSVSINSEFLNETPASNKNTSDRVLLDQIASKCIVSTNELFNFKRENCVCIDNVIVGESFKCSTDLQGQQKPNGVDSATSTIFSTINTQVSGLDYDLTDNGVTNQLFREMKNRPLPKIKIQSDVT 3443
            HVPFFPPGI+SHKKSPSFKRPQSVKECKKLSKHRCPSTSLNMKSSRRISTSTPNIMVTISSSDHILSIPKHNCDMGLSDHNTFRATPLPQYYSPDSLERNRTLFEQLDHNYKTRSLDRTSVTAKSLDQMAVKSKSKTYTNFVPEKPFYPPSKYPNIHDKSNLNLQRFLETRQQYKTPQSRKSV+I NRNKDR SRPTNLSMKISNIGGSVPNLALRNLKDIPNKYSKDEFHKKDPNNKSPDRSLSKSFIDHVEYSPEMGFYRSSHKLDLQDEFDFCVPKQMSTSYFYPKPIPNQFCNDFNDKMAQSLYNESSLAAKIHMGSLERAARNNYYSNNNEEKIEVTDLDDSPSKSYSPIKQCNSFSQDSLDGNRRHAKVPNEANSEKTGTDRTDSLTECDKSYNSISEEISTGTESKTYKFQSPTEDDYSIHNVETPNKYINSLSTISERDKTSEDHKKSTVIDKYGLGQYCESNTI NDNN NTCKNTTDNLENSSVISDSKSYNPKNAMENDIPNIKSENQHFFQDPNQSENLSDDRFYNSNQGDKSNATVHGQYDKNPNKNPYNSSDDFTNNSLFHTKSEKNLSS+YPENYNNSGNSPIHSENTNRKSGFLLDQYNLDRYLKDDSIPT+SFIITRNSVSI+SEFLNETPASNKNTSDRVLLDQIASKCIVSTNELFNFKRENCVCIDNVIVGESFKCSTDLQGQQKPNGVDSATSTIFSTINTQVSGLDYDLTDNGVTNQLFREMKNRPLPKIKIQSDVT
Sbjct:   11 HVPFFPPGISSHKKSPSFKRPQSVKECKKLSKHRCPSTSLNMKSSRRISTSTPNIMVTISSSDHILSIPKHNCDMGLSDHNTFRATPLPQYYSPDSLERNRTLFEQLDHNYKTRSLDRTSVTAKSLDQMAVKSKSKTYTNFVPEKPFYPPSKYPNIHDKSNLNLQRFLETRQQYKTPQSRKSVRIKNRNKDRYSRPTNLSMKISNIGGSVPNLALRNLKDIPNKYSKDEFHKKDPNNKSPDRSLSKSFIDHVEYSPEMGFYRSSHKLDLQDEFDFCVPKQMSTSYFYPKPIPNQFCNDFNDKMAQSLYNESSLAAKIHMGSLERAARNNYYSNNNEEKIEVTDLDDSPSKSYSPIKQCNSFSQDSLDGNRRHAKVPNEANSEKTGTDRTDSLTECDKSYNSISEEISTGTESKTYKFQSPTEDDYSIHNVETPNKYINSLSTISERDKTSEDHKKSTVIDKYGLGQYCESNTIANDNNVNTCKNTTDNLENSSVISDSKSYNPKNAMENDIPNIKSENQHFFQDPNQSENLSDDRFYNSNQGDKSNATVHGQYDKNPNKNPYNSSDDFTNNSLFHTKSEKNLSSMYPENYNNSGNSPIHSENTNRKSGFLLDQYNLDRYLKDDSIPTESFIITRNSVSIHSEFLNETPASNKNTSDRVLLDQIASKCIVSTNELFNFKRENCVCIDNVIVGESFKCSTDLQGQQKPNGVDSATSTIFSTINTQVSGLDYDLTDNGVTNQLFREMKNRPLPKIKIQSDVT 769          

HSP 2 Score: 835.099 bits (2156), Expect = 0.000e+0
Identity = 420/421 (99.76%), Postives = 421/421 (100.00%), Query Frame = 3
Query: 3837 SVSANKLNQIKERLDNKTNKQSNNEVKHQKRVFYGGIKSAKEKFLQDQTAVQEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDGSNVYNDDITRLAQTSSTKEKLARFKELQEKSFDKAQINEDDSGLPKKEVISVDTKSLRNKFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVRMDVVKSDQNIDEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEIGEGGIYESQPQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPIKLDLDITNGGIYENKPAESQADSVSDQNDEYLNEFPDKKYANEAKRLFLERXXXXXXAKLKRNTPQMIDIWKDLCKDSGVFENKPKLQNKDVMRHDDKINEELIVENQIAEQVVASEDETR 5099
            +VSANKLNQIKERLDNKTNKQSNNEVKHQKRVFYGGIKSAKEKFLQDQTAVQEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDGSNVYNDDITRLAQTSSTKEKLARFKELQEKSFDKAQINEDDSGLPKKEVISVDTKSLRNKFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVRMDVVKSDQNIDEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEIGEGGIYESQPQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPIKLDLDITNGGIYENKPAESQADSVSDQNDEYLNEFPDKKYANEAKRLFLERQQQEEEAKLKRNTPQMIDIWKDLCKDSGVFENKPKLQNKDVMRHDDKINEELIVENQIAEQVVASEDETR
Sbjct:  778 TVSANKLNQIKERLDNKTNKQSNNEVKHQKRVFYGGIKSAKEKFLQDQTAVQEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDGSNVYNDDITRLAQTSSTKEKLARFKELQEKSFDKAQINEDDSGLPKKEVISVDTKSLRNKFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVRMDVVKSDQNIDEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEIGEGGIYESQPQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPIKLDLDITNGGIYENKPAESQADSVSDQNDEYLNEFPDKKYANEAKRLFLERQQQEEEAKLKRNTPQMIDIWKDLCKDSGVFENKPKLQNKDVMRHDDKINEELIVENQIAEQVVASEDETR 1198          
BLAST of LIM zinc-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000013727.1 (SMESG000013727.1)

HSP 1 Score: 192.2 bits (487), Expect = 6.427e-54
Identity = 125/315 (39.68%), Postives = 191/315 (60.63%), Query Frame = 3
Query: 1182 PPGIASHKKSPSFKRPQSVKECKKLSKHRCPST-----SLN-MKSSRRISTSTPNIMVTISSSDHILSIPKHNCDMGLSDHNTFRATPLPQYYSPDSLERNRTLFEQLDHNYKTRSLDRTSVTAKSLDQMAVKSKSKTYTNFVPEKPFYPPSKYPNIHDKSNLNLQRFLETRQQYKTPQSRKSVKINNRNKDRNSRPTNLSMKISNIGGSVPNLALRNLKDIPNKY----SKDEFHKKDPNN-KSPDRSLSKSFI---------DHVEYSPEMGFYRSSHKLDLQDEFDFCVPKQMSTSYFYPKPIPNQFCNDFN 2066
            P  I++HK  P  +RPQSVKECK++S++R  +T     ++N   +S+R+S+STPNI  +         IPKHNCD    +++TF+ATPLP YYS +S+ER++ LF+ LD+N K +SL+R S +  S D++++  KS T  N + +KPFYPPSKYPNIHDK N+NLQR L+TR+ YKTP++R+ VK+  +NK +++R ++L       G S       +LK+  +K+    S + F + D    +  +R+ +  FI         D ++YSPE+   + + KL  +DE  +   + +   Y YPKPI N F    N
Sbjct:   12 PSEISNHKLLPKCQRPQSVKECKRISQYRNDTTVGSKDTVNSFANSKRLSSSTPNIHKSAYEHRESELIPKHNCDSFKRNNSTFKATPLPSYYSKNSIERSQLLFQNLDYNRKIKSLERLSESVNSQDRISMTEKSNTLPNSIHKKPFYPPSKYPNIHDKFNVNLQRLLDTRKLYKTPETRRFVKV--KNKRQSTRNSDLD------GNS-------DLKNPIDKFFYSNSNEHFDRVDDGKVRLRNRTKANKFIFETSFNGNQDQMDYSPEINVDKRNEKLLQKDEIPYHKIQPLYVEYHYPKPIRNPFYLGLN 311          
BLAST of LIM zinc-binding domain-containing protein vs. Planmine SMEST
Match: SMESG000002154.1 (SMESG000002154.1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.146e-8
Identity = 28/83 (33.73%), Postives = 42/83 (50.60%), Query Frame = 3
Query: 3639 LKPLCNVCFKPAYFMERISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKRKTLKPVRSVSANK-LNQIKERLDN 3884
            + PLC  C K  Y +E++S  +  +HKMCF C +CD  L+  N   + + PYC  H   +    V     NK L Q+ + + N
Sbjct:    1 MNPLCGRCNKTVYPVEKLSCLDKYWHKMCFKCTQCDLTLTMKNYKGYNKMPYCSTHYPTQKFTTVTDTPENKRLAQLTQDISN 83          
The following BLAST results are available for this feature:
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
LIMD25.969e-632.89LIM domain containing 2 [Source:HGNC Symbol;Acc:HG... [more]
LIMD29.573e-632.89LIM domain containing 2 [Source:HGNC Symbol;Acc:HG... [more]
LIMD29.573e-632.89LIM domain containing 2 [Source:HGNC Symbol;Acc:HG... [more]
LIMD29.573e-632.89LIM domain containing 2 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG335214.602e-637.93gene:FBgn0250819 transcript:FBtr0334661[more]
CG335214.647e-637.93gene:FBgn0250819 transcript:FBtr0091472[more]
CG335214.968e-637.93gene:FBgn0250819 transcript:FBtr0091473[more]
CG335214.968e-637.93gene:FBgn0250819 transcript:FBtr0091470[more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
limd21.590e-641.82LIM domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Limd26.100e-632.89LIM domain containing 2 [Source:MGI Symbol;Acc:MGI... [more]
Limd26.100e-632.89LIM domain containing 2 [Source:MGI Symbol;Acc:MGI... [more]
Limd26.100e-632.89LIM domain containing 2 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LIM zinc-binding domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6UJ492.105e-3530.28Uncharacterized protein OS=Echinococcus granulosus... [more]
A0A158R8071.410e-3330.82Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A068WQA41.621e-3330.73Expressed conserved protein OS=Echinococcus granul... [more]
A0A3P7W0P54.476e-3229.05Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A158QJF65.334e-3229.05Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
limd24.801e-640.38LIM domain containing 2 [Source:NCBI gene;Acc:1030... [more]
ENSAMXT00000032509.17.913e-635.71uncharacterized LOC103022480 [Source:NCBI gene;Acc... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005882.12.473e-636.36pep scaffold:Pmarinus_7.0:GL476535:329859:333216:1... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO500081.716e-636.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
LASP31.859e-627.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
xirp2b1.314e-632.61xin actin binding repeat containing 2 [Source:NCBI... [more]
ENSORLT00000014630.26.664e-633.87LIM and SH3 domain protein 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of LIM zinc-binding domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013742.10.000e+099.31SMESG000013742.1[more]
SMESG000013742.10.000e+099.13SMESG000013742.1[more]
SMESG000013742.10.000e+098.81SMESG000013742.1[more]
SMESG000013727.16.427e-5439.68SMESG000013727.1[more]
SMESG000002154.11.146e-833.73SMESG000002154.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014283 ID=SMED30014283|Name=LIM zinc-binding domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5420bp
CATTTCTCTCTTTTTATCTAATATTTAATTTTTAATCCTTATCATAAGAA
AATTCAAGATTTAATCTTTCATTTCAATATATTAAATATTAGCACAAAAA
TTTTGTGTAACGGTTACTTTGAATCTGAATTGAAGAGTAAACAAAATTTC
TCCTACGTGCTTGTTCTGATATTTATAAATTCGCAAGAATTATCCAAACG
AAATTTTTGATTGGATCGACTTTTTCTCAAAGAATTGATCCAAGATCTAT
CCATTAAAAATGCCAATGATTCAAATTTAAAATCATTATTAAAACTCCTT
CACAAGAAATAATAATGCTCCCTCCCTCATTTTAGTTATTCCAAATAATA
AAATGTTAAAAATTATTTTTATTTTATCTATTCACCTATTAAGGGTCTAA
AAGTTCAGATTTAGTTAAATAAGTTTAAAAAAATATTCTTGAAAACAGTA
ATTTTGATTATTAATCTTCTAAATAGAGCCGCCACTTCCATTTATCTCTA
AACTCACTAGCGTCCATTGACTGACGGTACCGTCGCCGTTATAAACTGTT
TGTCTGGTTGAATATCATATTATGTCTCAGAATCACATATAATCTCTTGT
AGCTCTGTCACTTCGAGAGACTTTTTTGGGGCTCTTTAAAAAATGTGAAC
TTTATTAATTAAATTGAATTATTATTTATGTTTCTATCAAATTATTAACT
ATTCCTTTGTTATTATTAAAAAAAATAATAAACAGATCAGGAAGTTTCAT
CCTCATTTTTACTTCCATTGAATTTCAATAATCACATTCCATTTAACTCT
CTTTATACTTATATAATCGAAATTTAATATAAATTCTGAATAAATGATCT
GGCAGTTTATATTTCTCCAACACATTTTTTAAAGATGAATTCATGGTATA
CACAACAATATAATATATGCAAATGTGAGACCATATTATTATTCAAATGA
TTGTTCAAAATTTTAATATTATTGAAAAAAAATGTTTGGAGTGTTTGTGT
GTATAAAACAACTAAGATTTTTTGGAAAATCAATAGCAATAACATGTGTG
GCACAGTGCTATTATTCAAAATATTGCCTAAAAAAGTGAATTTAATATAT
TCAGTGTTTTAAATTTTATTTGGACGTAATTCAATAATGTCTCTCAATTC
ATTATCGTTGTCAAATCATGTACCTTTTTTCCCTCCTGGAATTGCCAGTC
ACAAGAAATCACCTAGTTTCAAGCGACCGCAAAGTGTAAAAGAATGTAAG
AAACTATCTAAACATCGATGTCCTAGTACATCATTAAACATGAAATCTAG
TAGGCGAATAAGTACTAGTACACCGAATATTATGGTTACTATTTCTTCAT
CTGATCATATACTTTCAATTCCAAAGCACAATTGTGATATGGGACTTTCA
GATCATAATACATTTAGAGCGACTCCGTTGCCACAGTATTATTCGCCAGA
TTCTTTAGAAAGAAACAGGACTCTATTTGAACAATTGGATCATAATTACA
AGACACGTTCACTTGACCGAACATCCGTAACAGCTAAATCTCTAGATCAA
ATGGCTGTTAAATCAAAGTCGAAAACTTATACAAATTTTGTTCCTGAAAA
ACCGTTTTATCCTCCAAGCAAATATCCAAATATTCATGACAAAAGCAACT
TAAATCTTCAGCGATTTCTTGAAACTCGACAGCAATACAAGACTCCACAA
TCTAGGAAATCTGTAAAGATAAATAATCGAAATAAAGACAGAAATTCCAG
ACCTACTAATTTATCAATGAAAATATCAAACATAGGAGGATCAGTACCGA
ATTTGGCATTGAGAAATCTCAAAGATATTCCCAATAAATATTCAAAAGAT
GAATTTCATAAAAAGGACCCAAATAATAAATCTCCAGACAGGTCACTATC
GAAATCTTTTATAGATCATGTTGAATACTCCCCAGAAATGGGATTTTATA
GGAGTTCACATAAACTAGATCTTCAAGATGAATTTGATTTTTGCGTTCCA
AAACAAATGTCAACAAGTTATTTTTATCCAAAACCTATACCAAACCAATT
TTGTAATGATTTTAACGATAAAATGGCTCAAAGTCTTTATAATGAATCGT
CATTAGCTGCTAAGATTCACATGGGGAGTTTAGAGCGAGCCGCTAGAAAC
AATTATTATTCCAATAACAATGAAGAAAAAATTGAAGTAACTGACCTTGA
CGATAGCCCCAGTAAATCTTATTCTCCAATTAAACAATGCAATTCGTTTA
GTCAAGACAGTCTAGATGGCAATAGACGACATGCAAAAGTTCCTAATGAG
GCAAATTCGGAAAAAACTGGAACTGACAGAACTGACAGTTTGACTGAATG
TGACAAAAGCTACAACAGCATATCTGAAGAAATATCAACTGGTACAGAAT
CAAAAACATACAAATTTCAATCACCGACTGAGGATGACTATTCCATCCAC
AATGTTGAAACACCGAATAAATATATCAACTCTCTTAGTACAATTTCTGA
ACGAGATAAAACTTCCGAAGATCATAAGAAGAGTACGGTGATTGATAAAT
ATGGTTTAGGTCAATATTGTGAATCAAATACTATTCCAAATGACAACAAC
GGGAACACATGTAAAAATACTACCGATAATTTAGAGAACAGTTCAGTAAT
TAGCGACTCAAAAAGCTATAACCCTAAAAACGCAATGGAAAATGACATTC
CTAATATTAAATCGGAAAATCAACATTTTTTCCAGGATCCAAATCAATCG
GAAAATCTAAGTGATGATCGATTCTACAATTCCAATCAAGGTGATAAATC
CAATGCAACCGTTCACGGTCAATACGATAAGAATCCCAATAAAAATCCTT
ACAACAGTTCCGACGATTTCACTAACAATTCTTTATTCCATACAAAATCT
GAGAAAAACTTATCATCGATATATCCTGAAAACTATAACAACTCAGGAAA
TTCACCAATTCATAGTGAAAATACAAATAGGAAATCCGGTTTTTTATTAG
ATCAATATAATTTGGACAGGTACTTGAAGGACGATTCCATTCCGACGAAA
AGTTTTATAATCACTCGCAATTCTGTCTCTATTAACAGTGAATTTCTAAA
CGAGACCCCTGCTTCGAATAAAAACACAAGTGACAGGGTTTTGTTGGACC
AAATTGCTTCGAAATGCATTGTCAGCACAAATGAGTTATTTAATTTCAAA
AGAGAAAATTGTGTTTGCATTGACAATGTTATTGTCGGAGAAAGTTTTAA
ATGCTCAACAGATCTTCAGGGGCAGCAGAAGCCGAATGGAGTAGATTCGG
CTACGTCGACTATTTTTTCAACAATAAATACTCAAGTCAGCGGACTTGAT
TACGATTTAACAGACAATGGAGTAACCAATCAGTTGTTTAGAGAGATGAA
GAATCGCCCATTACCAAAAATTAAAATCCAATCAGATGTTACAAATTCTG
TTGAAAATTCATCAGAAACTGAGTCATCATTGAGTGGCAGTGATAATACA
TCGTATTTGAGATACGAATGTAACAGTGTCCACCTTCCTCACCGTGAAAG
ATCATGGGTATCGAGTCCCGAATTGACAATGGCGCGTAGTGATATTGTTT
CAAGAAGACGTCACAGGCATCTACAGAGTGAAAATCCTTTAAAACCGCTT
TGCAATGTTTGCTTCAAACCCGCTTATTTTATGGAAAGAATCAGCATCAA
TAATATTATATTTCACAAAATGTGTTTCCTGTGTAGAAAATGTGATACTC
ATTTGAGTTTTAACAATTGCATCATTCACCGCCGTAAGCCCTATTGCTTA
GTACATGCTAAACGCAAAACATTGAAACCCGTCCGATCAGTATCAGCTAA
TAAATTAAATCAAATAAAAGAAAGACTTGATAACAAGACTAATAAACAAT
CAAATAATGAAGTTAAACATCAGAAAAGAGTATTTTATGGTGGAATCAAA
TCGGCTAAAGAAAAATTCCTCCAAGATCAAACTGCTGTCCAAGAACCGGT
GGTAAGACAACAGAAACGTTTTACACCGCCTCGTCAAGGTGTTACTGCTG
GAGTAATTGAAAGTGAACCAAAGCCAAGAGATCCTAATATTATTACATCT
GGTGACGGATCAAATGTCTATAATGATGATATAACTCGACTTGCTCAAAC
CAGTTCTACAAAAGAAAAATTAGCTCGATTTAAAGAATTACAAGAAAAAT
CATTTGATAAAGCACAAATAAACGAAGACGATTCTGGATTACCAAAGAAA
GAAGTAATATCTGTCGACACGAAATCACTGAGAAATAAATTTCTGTCGGG
TATGAATGGAAACGATTCTGAGTCTAAATTGATAAAATTAAACCCAAGCG
AAGAAATTCAGGAATTAGCACGCCGAGAATCTAATTCAATTTATGAAAAT
AAACCAGAAGTTAGAATGGATGTTGTGAAATCCGACCAAAACATTGACGA
ACCGAATGTTACAGTTTCTAGAAATAAAGCCAAGGAACTGAAAGAGAAGT
TTTCCAATTATGTTCCAGATGAAAAAACTAAAAAAACAGAGAAATTTCAA
ATGGAAATTGGAGAAGGTGGAATATATGAGAGTCAGCCTCAAGAACGAAG
TGATGATATAATTCCATATACATCTGATAAAGATTTCGTATTACCTAATA
ATACTGTCAAAAGTGGTCTTCAAAAAATCAAAGAATTGCAAACAATTAAA
TCTCAAGGGTATCAAAAATCAAATAATGAACCGATAAAATTAGATCTAGA
CATTACTAACGGTGGGATATATGAAAACAAACCAGCTGAATCTCAAGCAG
ATTCGGTTTCTGATCAAAATGACGAATATCTAAACGAATTCCCTGATAAA
AAATATGCCAATGAAGCTAAAAGATTATTCTTGGAAAGACAGCAACAAGA
GGAAGAAGCAAAGCTTAAGAGAAATACTCCTCAAATGATTGATATCTGGA
AAGATTTATGTAAAGATAGCGGAGTTTTTGAAAACAAGCCAAAACTTCAA
AATAAAGATGTAATGCGACATGACGATAAAATAAATGAGGAATTGATTGT
CGAGAATCAAATAGCTGAGCAAGTAGTAGCATCTGAAGATGAGACTAGAT
AGAAGCTCGATTTGATGTGAAGTGCCATGAAGTCATTATCGCTAAATGAA
AATTGCTCAGTTACAATTCATATTTCTACTTATTAACTGAAATTATCCTC
ATGTTGCATCCTAAACTCTCTATCACAGTATCAACTTAGATCTCAAATGG
AAATGGTTTTCTATTGCTTGTCTTTTCTCTTTATATGTATGATTTATTAA
ATTTTTCATTTAAACTGTTCCCCGCGGTATCATGTGCAATATTCTCTCAA
TTTATATTTCCATATAAATTTTATTTTCTATTTCAATTTTGTAAAATAAT
AAATTGTTATTTGATTTAAA
back to top

protein sequence of SMED30014283-orf-1

>SMED30014283-orf-1 ID=SMED30014283-orf-1|Name=SMED30014283-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1322bp
MSLNSLSLSNHVPFFPPGIASHKKSPSFKRPQSVKECKKLSKHRCPSTSL
NMKSSRRISTSTPNIMVTISSSDHILSIPKHNCDMGLSDHNTFRATPLPQ
YYSPDSLERNRTLFEQLDHNYKTRSLDRTSVTAKSLDQMAVKSKSKTYTN
FVPEKPFYPPSKYPNIHDKSNLNLQRFLETRQQYKTPQSRKSVKINNRNK
DRNSRPTNLSMKISNIGGSVPNLALRNLKDIPNKYSKDEFHKKDPNNKSP
DRSLSKSFIDHVEYSPEMGFYRSSHKLDLQDEFDFCVPKQMSTSYFYPKP
IPNQFCNDFNDKMAQSLYNESSLAAKIHMGSLERAARNNYYSNNNEEKIE
VTDLDDSPSKSYSPIKQCNSFSQDSLDGNRRHAKVPNEANSEKTGTDRTD
SLTECDKSYNSISEEISTGTESKTYKFQSPTEDDYSIHNVETPNKYINSL
STISERDKTSEDHKKSTVIDKYGLGQYCESNTIPNDNNGNTCKNTTDNLE
NSSVISDSKSYNPKNAMENDIPNIKSENQHFFQDPNQSENLSDDRFYNSN
QGDKSNATVHGQYDKNPNKNPYNSSDDFTNNSLFHTKSEKNLSSIYPENY
NNSGNSPIHSENTNRKSGFLLDQYNLDRYLKDDSIPTKSFIITRNSVSIN
SEFLNETPASNKNTSDRVLLDQIASKCIVSTNELFNFKRENCVCIDNVIV
GESFKCSTDLQGQQKPNGVDSATSTIFSTINTQVSGLDYDLTDNGVTNQL
FREMKNRPLPKIKIQSDVTNSVENSSETESSLSGSDNTSYLRYECNSVHL
PHRERSWVSSPELTMARSDIVSRRRHRHLQSENPLKPLCNVCFKPAYFME
RISINNIIFHKMCFLCRKCDTHLSFNNCIIHRRKPYCLVHAKRKTLKPVR
SVSANKLNQIKERLDNKTNKQSNNEVKHQKRVFYGGIKSAKEKFLQDQTA
VQEPVVRQQKRFTPPRQGVTAGVIESEPKPRDPNIITSGDGSNVYNDDIT
RLAQTSSTKEKLARFKELQEKSFDKAQINEDDSGLPKKEVISVDTKSLRN
KFLSGMNGNDSESKLIKLNPSEEIQELARRESNSIYENKPEVRMDVVKSD
QNIDEPNVTVSRNKAKELKEKFSNYVPDEKTKKTEKFQMEIGEGGIYESQ
PQERSDDIIPYTSDKDFVLPNNTVKSGLQKIKELQTIKSQGYQKSNNEPI
KLDLDITNGGIYENKPAESQADSVSDQNDEYLNEFPDKKYANEAKRLFLE
RQQQEEEAKLKRNTPQMIDIWKDLCKDSGVFENKPKLQNKDVMRHDDKIN
EELIVENQIAEQVVASEDETR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR001781Znf_LIM
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003779actin binding
GO:0005515protein binding
GO:0017166vinculin binding
GO:0046872metal ion binding
GO:0051371muscle alpha-actinin binding
Vocabulary: cellular component
TermDefinition
GO:0005916fascia adherens
GO:0005927muscle tendon junction
GO:0030016myofibril
Vocabulary: biological process
TermDefinition
GO:0030036actin cytoskeleton organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001781Zinc finger, LIM-typeSMARTSM00132lim_4coord: 838..890
e-value: 0.0013
score: 25.5
IPR001781Zinc finger, LIM-typePROSITEPS00478LIM_DOMAIN_1coord: 839..873
IPR001781Zinc finger, LIM-typePROSITEPS50023LIM_DOMAIN_2coord: 837..898
score: 10.356
NoneNo IPR availableGENE3DG3DSA:2.10.110.10coord: 834..898
e-value: 3.6E-11
score: 45.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 762..785
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 352..405
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 377..404
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 763..785
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 356..376
NoneNo IPR availableSUPERFAMILYSSF57716Glucocorticoid receptor-like (DNA-binding domain)coord: 835..864