Malignant brain tumor-like protein

Overview
NameMalignant brain tumor-like protein
Smed IDSMED30014280
Length (bp)2716
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Malignant brain tumor-like protein (SMED30014280) t-SNE clustered cells

Violin plots show distribution of expression levels for Malignant brain tumor-like protein (SMED30014280) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Malignant brain tumor-like protein (SMED30014280) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Malignant brain tumor-like protein (SMED30014280) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014280

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30014280h1SMcG0005506 dd_Smed_v4_11547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014280h1SMcG0005506 dd_Smed_v4_11547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014280h1SMcG0005506 dd_Smed_v4_11547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30014280h1SMcG0005506 dd_Smed_v4_11547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30014280h1SMcG0005506 dd_Smed_v4_11547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30014280h1SMcG0005506 dd_Smed_v4_11547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Malignant brain tumor-like protein vs. Ensembl Human
Match: L3MBTL3 (L3MBTL histone methyl-lysine binding protein 3 [Source:HGNC Symbol;Acc:HGNC:23035])

HSP 1 Score: 308.916 bits (790), Expect = 6.589e-92
Identity = 185/470 (39.36%), Postives = 254/470 (54.04%), Query Frame = 2
Query:  389 TIEDADERKEKSKNGFKNPLNTSSYGRKRKRRIIDGEVV--GFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPT----FDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVPINNSTES 1780
            T ED +ER ++ +N     +   S   +RKRR  D  V+  G   K ++             ++ W+ YL+      VPAKLF        +    YN K  F V  KLEGVDP ++S++CVLT+ E+ G R++LHFDGY D +DFW  +D+  I P GWCE    KL  PK Y    F+W  YL   K++AA +S  F  +N     + F +G KLEAVDK+N   ICVATV D++    LVHFD+WD SYD W   SSP + PVG+C+++ + L  P  Y  ++  FSWD YL+ TNS   P   F+ +    F     M+ EV+DKR P  IRVA +A   ++ +V + FD W+  Y+Y ID  S   +I P+GWC K G  LQPP +     +AS E   C   GCKG GH K  R+      + CPY+E NLNKD    DR+       +  +S + P N  T++
Sbjct:  158 TKEDGEERDDEMENKQDVRILRGSQRARRKRRG-DSAVLKQGLPPKGKK-------------AWCWASYLEEEKAVAVPAKLFKE------HQSFPYN-KNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKS-LFENQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYP-NVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKK--MKLEVVDKRNPMFIRVATVAD-TDDHRVKVHFDGWNNCYDYWIDADSP--DIHPVGWCSKTGHPLQPPLSPLELMEAS-EHGGCSTPGCKGIGHFKRARHLGPHSAANCPYSEINLNKDRIFPDRLS----GEMPPASPSFPRNKRTDA 594          

HSP 2 Score: 62.3882 bits (150), Expect = 3.162e-9
Identity = 25/72 (34.72%), Postives = 48/72 (66.67%), Query Frame = 2
Query: 2399 ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKET 2614
            +  W++ EVS+ I S+ G +++ K F ++++DG AF+ + Q D++K++ +KLGPA+K+ + I   K   K +
Sbjct:  680 VSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNS 751          
BLAST of Malignant brain tumor-like protein vs. Ensembl Human
Match: L3MBTL3 (L3MBTL histone methyl-lysine binding protein 3 [Source:HGNC Symbol;Acc:HGNC:23035])

HSP 1 Score: 308.916 bits (790), Expect = 6.589e-92
Identity = 185/470 (39.36%), Postives = 254/470 (54.04%), Query Frame = 2
Query:  389 TIEDADERKEKSKNGFKNPLNTSSYGRKRKRRIIDGEVV--GFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPT----FDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVPINNSTES 1780
            T ED +ER ++ +N     +   S   +RKRR  D  V+  G   K ++             ++ W+ YL+      VPAKLF        +    YN K  F V  KLEGVDP ++S++CVLT+ E+ G R++LHFDGY D +DFW  +D+  I P GWCE    KL  PK Y    F+W  YL   K++AA +S  F  +N     + F +G KLEAVDK+N   ICVATV D++    LVHFD+WD SYD W   SSP + PVG+C+++ + L  P  Y  ++  FSWD YL+ TNS   P   F+ +    F     M+ EV+DKR P  IRVA +A   ++ +V + FD W+  Y+Y ID  S   +I P+GWC K G  LQPP +     +AS E   C   GCKG GH K  R+      + CPY+E NLNKD    DR+       +  +S + P N  T++
Sbjct:  158 TKEDGEERDDEMENKQDVRILRGSQRARRKRRG-DSAVLKQGLPPKGKK-------------AWCWASYLEEEKAVAVPAKLFKE------HQSFPYN-KNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKS-LFENQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYP-NVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKK--MKLEVVDKRNPMFIRVATVAD-TDDHRVKVHFDGWNNCYDYWIDADSP--DIHPVGWCSKTGHPLQPPLSPLELMEAS-EHGGCSTPGCKGIGHFKRARHLGPHSAANCPYSEINLNKDRIFPDRLS----GEMPPASPSFPRNKRTDA 594          

HSP 2 Score: 62.3882 bits (150), Expect = 3.162e-9
Identity = 25/72 (34.72%), Postives = 48/72 (66.67%), Query Frame = 2
Query: 2399 ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKET 2614
            +  W++ EVS+ I S+ G +++ K F ++++DG AF+ + Q D++K++ +KLGPA+K+ + I   K   K +
Sbjct:  680 VSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNS 751          
BLAST of Malignant brain tumor-like protein vs. Ensembl Human
Match: L3MBTL3 (L3MBTL histone methyl-lysine binding protein 3 [Source:HGNC Symbol;Acc:HGNC:23035])

HSP 1 Score: 308.916 bits (790), Expect = 6.589e-92
Identity = 185/470 (39.36%), Postives = 254/470 (54.04%), Query Frame = 2
Query:  389 TIEDADERKEKSKNGFKNPLNTSSYGRKRKRRIIDGEVV--GFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPT----FDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVPINNSTES 1780
            T ED +ER ++ +N     +   S   +RKRR  D  V+  G   K ++             ++ W+ YL+      VPAKLF        +    YN K  F V  KLEGVDP ++S++CVLT+ E+ G R++LHFDGY D +DFW  +D+  I P GWCE    KL  PK Y    F+W  YL   K++AA +S  F  +N     + F +G KLEAVDK+N   ICVATV D++    LVHFD+WD SYD W   SSP + PVG+C+++ + L  P  Y  ++  FSWD YL+ TNS   P   F+ +    F     M+ EV+DKR P  IRVA +A   ++ +V + FD W+  Y+Y ID  S   +I P+GWC K G  LQPP +     +AS E   C   GCKG GH K  R+      + CPY+E NLNKD    DR+       +  +S + P N  T++
Sbjct:  158 TKEDGEERDDEMENKQDVRILRGSQRARRKRRG-DSAVLKQGLPPKGKK-------------AWCWASYLEEEKAVAVPAKLFKE------HQSFPYN-KNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKS-LFENQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYP-NVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKK--MKLEVVDKRNPMFIRVATVAD-TDDHRVKVHFDGWNNCYDYWIDADSP--DIHPVGWCSKTGHPLQPPLSPLELMEAS-EHGGCSTPGCKGIGHFKRARHLGPHSAANCPYSEINLNKDRIFPDRLS----GEMPPASPSFPRNKRTDA 594          

HSP 2 Score: 62.3882 bits (150), Expect = 3.162e-9
Identity = 25/72 (34.72%), Postives = 48/72 (66.67%), Query Frame = 2
Query: 2399 ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKET 2614
            +  W++ EVS+ I S+ G +++ K F ++++DG AF+ + Q D++K++ +KLGPA+K+ + I   K   K +
Sbjct:  680 VSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNS 751          
BLAST of Malignant brain tumor-like protein vs. Ensembl Human
Match: L3MBTL3 (L3MBTL histone methyl-lysine binding protein 3 [Source:HGNC Symbol;Acc:HGNC:23035])

HSP 1 Score: 308.531 bits (789), Expect = 1.332e-91
Identity = 185/470 (39.36%), Postives = 254/470 (54.04%), Query Frame = 2
Query:  389 TIEDADERKEKSKNGFKNPLNTSSYGRKRKRRIIDGEVV--GFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPT----FDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVPINNSTES 1780
            T ED +ER ++ +N     +   S   +RKRR  D  V+  G   K ++             ++ W+ YL+      VPAKLF        +    YN K  F V  KLEGVDP ++S++CVLT+ E+ G R++LHFDGY D +DFW  +D+  I P GWCE    KL  PK Y    F+W  YL   K++AA +S  F  +N     + F +G KLEAVDK+N   ICVATV D++    LVHFD+WD SYD W   SSP + PVG+C+++ + L  P  Y  ++  FSWD YL+ TNS   P   F+ +    F     M+ EV+DKR P  IRVA +A   ++ +V + FD W+  Y+Y ID  S   +I P+GWC K G  LQPP +     +AS E   C   GCKG GH K  R+      + CPY+E NLNKD    DR    +   +  +S + P N  T++
Sbjct:  183 TKEDGEERDDEMENKQDVRILRGSQRARRKRRG-DSAVLKQGLPPKGKK-------------AWCWASYLEEEKAVAVPAKLFKE------HQSFPYN-KNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKS-LFENQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYP-NVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKK--MKLEVVDKRNPMFIRVATVAD-TDDHRVKVHFDGWNNCYDYWIDADSP--DIHPVGWCSKTGHPLQPPLSPLELMEAS-EHGGCSTPGCKGIGHFKRARHLGPHSAANCPYSEINLNKDRIFPDR----LSGEMPPASPSFPRNKRTDA 619          

HSP 2 Score: 62.7734 bits (151), Expect = 2.754e-9
Identity = 25/72 (34.72%), Postives = 48/72 (66.67%), Query Frame = 2
Query: 2399 ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKET 2614
            +  W++ EVS+ I S+ G +++ K F ++++DG AF+ + Q D++K++ +KLGPA+K+ + I   K   K +
Sbjct:  705 VSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNS 776          
BLAST of Malignant brain tumor-like protein vs. Ensembl Human
Match: L3MBTL3 (L3MBTL histone methyl-lysine binding protein 3 [Source:HGNC Symbol;Acc:HGNC:23035])

HSP 1 Score: 308.531 bits (789), Expect = 1.332e-91
Identity = 185/470 (39.36%), Postives = 254/470 (54.04%), Query Frame = 2
Query:  389 TIEDADERKEKSKNGFKNPLNTSSYGRKRKRRIIDGEVV--GFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPT----FDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVPINNSTES 1780
            T ED +ER ++ +N     +   S   +RKRR  D  V+  G   K ++             ++ W+ YL+      VPAKLF        +    YN K  F V  KLEGVDP ++S++CVLT+ E+ G R++LHFDGY D +DFW  +D+  I P GWCE    KL  PK Y    F+W  YL   K++AA +S  F  +N     + F +G KLEAVDK+N   ICVATV D++    LVHFD+WD SYD W   SSP + PVG+C+++ + L  P  Y  ++  FSWD YL+ TNS   P   F+ +    F     M+ EV+DKR P  IRVA +A   ++ +V + FD W+  Y+Y ID  S   +I P+GWC K G  LQPP +     +AS E   C   GCKG GH K  R+      + CPY+E NLNKD    DR    +   +  +S + P N  T++
Sbjct:  183 TKEDGEERDDEMENKQDVRILRGSQRARRKRRG-DSAVLKQGLPPKGKK-------------AWCWASYLEEEKAVAVPAKLFKE------HQSFPYN-KNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKS-LFENQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYP-NVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKK--MKLEVVDKRNPMFIRVATVAD-TDDHRVKVHFDGWNNCYDYWIDADSP--DIHPVGWCSKTGHPLQPPLSPLELMEAS-EHGGCSTPGCKGIGHFKRARHLGPHSAANCPYSEINLNKDRIFPDR----LSGEMPPASPSFPRNKRTDA 619          

HSP 2 Score: 62.7734 bits (151), Expect = 2.754e-9
Identity = 25/72 (34.72%), Postives = 48/72 (66.67%), Query Frame = 2
Query: 2399 ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKET 2614
            +  W++ EVS+ I S+ G +++ K F ++++DG AF+ + Q D++K++ +KLGPA+K+ + I   K   K +
Sbjct:  705 VSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNS 776          
BLAST of Malignant brain tumor-like protein vs. Ensembl Celegans
Match: lin-61 (pep chromosome:WBcel235:I:7248828:7250816:-1 gene:WBGene00003041.1 transcript:R06C7.7a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-61)

HSP 1 Score: 92.8189 bits (229), Expect = 2.024e-19
Identity = 88/328 (26.83%), Postives = 147/328 (44.82%), Query Frame = 2
Query:  677 SKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHF----------DGYQDQFDF------WTLSDSQLIFPAGWCENNNRKLQSPKDYTNFP--FSWPVYLTKTKSEAAHESCF-FIVKNPISDK--NNFIIGQKLEAVD---KRNSGMICVATVKDIIGEN-ILVHFDSWDSSYDMW-AHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEER-NQWWFD-LDVGMRCEVIDK-----RCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFD 1561
            SK++F V Q+LE ++ +N +   V  I EI G R+ +            D   D+  F      W    S  IFP G+   N  +L + K+Y       +  +   +     + +  F  + K+PI         +GQK E +D   ++ + +   + +K    E  ++V  D  D+  D +  H ++  + PVGY E Y   L  P  +     +F WD YL+  ++E++P  +F+   +Q   D   VG+R E  D       CP  ++  H   +N      + FD W E+++   D+ S   +ILPIGWC  +  VLQPP  ++
Sbjct:  174 SKHRFKVGQRLELLNYSNSTEIRVARIQEICGRRMNVSITKKDFPESLPDADDDRQVFSSGSQYWIDEGSFFIFPVGFAAVNGYQLNAKKEYIEHTNKIAQAIKNGENPRYDSDDVTFDQLAKDPIDPMIWRKVKVGQKFELIDPLAQQFNNLHVASILKFCKTEGYLIVGMDGPDALEDSFPIHINNTFMFPVGYAEKYNLELVPPDEFK---GTFRWDEYLEKESAETLPLDLFKPMPSQERLDKFKVGLRLEAADMCENQFICPATVKSVHGRLIN------VNFDGWDEEFDELYDVDSH--DILPIGWCEAHSYVLQPPKKYN 490          

HSP 2 Score: 80.4925 bits (197), Expect = 2.019e-15
Identity = 61/194 (31.44%), Postives = 89/194 (45.88%), Query Frame = 2
Query:  686 KFSVNQKLEGVDP-----NNESLFCVLTIVEILGSRLRLHFDG---YQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDK---NNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGH 1234
            K  V QK E +DP     NN  +  +L   +  G  L +  DG    +D F      ++  +FP G+ E  N +L  P ++    F W  YL K  +E      F     P+  +   + F +G +LEA D   +  IC ATVK + G  I V+FD WD  +D      S  +LP+G+CE +  VL  P  Y +
Sbjct:  306 KVKVGQKFELIDPLAQQFNNLHVASILKFCKTEG-YLIVGMDGPDALEDSFPIHI--NNTFMFPVGYAEKYNLELVPPDEFKG-TFRWDEYLEKESAETLPLDLF----KPMPSQERLDKFKVGLRLEAADMCENQFICPATVKSVHGRLINVNFDGWDEEFDELYDVDSHDILPIGWCEAHSYVLQPPKKYNY 491          

HSP 3 Score: 65.4698 bits (158), Expect = 9.919e-11
Identity = 42/134 (31.34%), Postives = 63/134 (47.01%), Query Frame = 2
Query:  503 VGFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDY 904
            VG++ K   E +  +  K    +F W EYL+     T+P  LF  +  +   +D       KF V  +LE  D       C  T+  + G  + ++FDG+ ++FD     DS  I P GWCE ++  LQ PK Y
Sbjct:  367 VGYAEKYNLELVPPDEFKG---TFRWDEYLEKESAETLPLDLFKPMPSQ-ERLD-------KFKVGLRLEAADMCENQFICPATVKSVHGRLINVNFDGWDEEFDELYDVDSHDILPIGWCEAHSYVLQPPKKY 489          
BLAST of Malignant brain tumor-like protein vs. Ensembl Celegans
Match: lin-61 (pep chromosome:WBcel235:I:7248828:7251422:-1 gene:WBGene00003041.1 transcript:R06C7.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-61)

HSP 1 Score: 92.8189 bits (229), Expect = 2.024e-19
Identity = 88/328 (26.83%), Postives = 147/328 (44.82%), Query Frame = 2
Query:  677 SKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHF----------DGYQDQFDF------WTLSDSQLIFPAGWCENNNRKLQSPKDYTNFP--FSWPVYLTKTKSEAAHESCF-FIVKNPISDK--NNFIIGQKLEAVD---KRNSGMICVATVKDIIGEN-ILVHFDSWDSSYDMW-AHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEER-NQWWFD-LDVGMRCEVIDK-----RCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFD 1561
            SK++F V Q+LE ++ +N +   V  I EI G R+ +            D   D+  F      W    S  IFP G+   N  +L + K+Y       +  +   +     + +  F  + K+PI         +GQK E +D   ++ + +   + +K    E  ++V  D  D+  D +  H ++  + PVGY E Y   L  P  +     +F WD YL+  ++E++P  +F+   +Q   D   VG+R E  D       CP  ++  H   +N      + FD W E+++   D+ S   +ILPIGWC  +  VLQPP  ++
Sbjct:  174 SKHRFKVGQRLELLNYSNSTEIRVARIQEICGRRMNVSITKKDFPESLPDADDDRQVFSSGSQYWIDEGSFFIFPVGFAAVNGYQLNAKKEYIEHTNKIAQAIKNGENPRYDSDDVTFDQLAKDPIDPMIWRKVKVGQKFELIDPLAQQFNNLHVASILKFCKTEGYLIVGMDGPDALEDSFPIHINNTFMFPVGYAEKYNLELVPPDEFK---GTFRWDEYLEKESAETLPLDLFKPMPSQERLDKFKVGLRLEAADMCENQFICPATVKSVHGRLIN------VNFDGWDEEFDELYDVDSH--DILPIGWCEAHSYVLQPPKKYN 490          

HSP 2 Score: 80.4925 bits (197), Expect = 2.019e-15
Identity = 61/194 (31.44%), Postives = 89/194 (45.88%), Query Frame = 2
Query:  686 KFSVNQKLEGVDP-----NNESLFCVLTIVEILGSRLRLHFDG---YQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDK---NNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGH 1234
            K  V QK E +DP     NN  +  +L   +  G  L +  DG    +D F      ++  +FP G+ E  N +L  P ++    F W  YL K  +E      F     P+  +   + F +G +LEA D   +  IC ATVK + G  I V+FD WD  +D      S  +LP+G+CE +  VL  P  Y +
Sbjct:  306 KVKVGQKFELIDPLAQQFNNLHVASILKFCKTEG-YLIVGMDGPDALEDSFPIHI--NNTFMFPVGYAEKYNLELVPPDEFKG-TFRWDEYLEKESAETLPLDLF----KPMPSQERLDKFKVGLRLEAADMCENQFICPATVKSVHGRLINVNFDGWDEEFDELYDVDSHDILPIGWCEAHSYVLQPPKKYNY 491          

HSP 3 Score: 65.4698 bits (158), Expect = 9.919e-11
Identity = 42/134 (31.34%), Postives = 63/134 (47.01%), Query Frame = 2
Query:  503 VGFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDY 904
            VG++ K   E +  +  K    +F W EYL+     T+P  LF  +  +   +D       KF V  +LE  D       C  T+  + G  + ++FDG+ ++FD     DS  I P GWCE ++  LQ PK Y
Sbjct:  367 VGYAEKYNLELVPPDEFKG---TFRWDEYLEKESAETLPLDLFKPMPSQ-ERLD-------KFKVGLRLEAADMCENQFICPATVKSVHGRLINVNFDGWDEEFDELYDVDSHDILPIGWCEAHSYVLQPPKKY 489          
BLAST of Malignant brain tumor-like protein vs. Ensembl Celegans
Match: lin-61 (pep chromosome:WBcel235:I:7248828:7251282:-1 gene:WBGene00003041.1 transcript:R06C7.7b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-61)

HSP 1 Score: 92.0485 bits (227), Expect = 7.061e-19
Identity = 85/328 (25.91%), Postives = 145/328 (44.21%), Query Frame = 2
Query:  677 SKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDG----------------YQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFP--FSWPVYLTKTKSEAAHESCF-FIVKNPISDK--NNFIIGQKLEAVD---KRNSGMICVATVKDIIGEN-ILVHFDSWDSSYDMW-AHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEER-NQWWFD-LDVGMRCEVIDK-----RCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFD 1561
            SK++F V Q+LE ++ +N +   V  I EI G R+ +                    +     +W    S  IFP G+   N  +L + K+Y       +  +   +     + +  F  + K+PI         +GQK E +D   ++ + +   + +K    E  ++V  D  D+  D +  H ++  + PVGY E Y   L  P  +     +F WD YL+  ++E++P  +F+   +Q   D   VG+R E  D       CP  ++  H   +N      + FD W E+++   D+ S   +ILPIGWC  +  VLQPP  ++
Sbjct:  295 SKHRFKVGQRLELLNYSNSTEIRVARIQEICGRRMNVSITKKDFPESLPDADDDRQVFSSGSQYWIDEGSFFIFPVGFAAVNGYQLNAKKEYIEHTNKIAQAIKNGENPRYDSDDVTFDQLAKDPIDPMIWRKVKVGQKFELIDPLAQQFNNLHVASILKFCKTEGYLIVGMDGPDALEDSFPIHINNTFMFPVGYAEKYNLELVPPDEFK---GTFRWDEYLEKESAETLPLDLFKPMPSQERLDKFKVGLRLEAADMCENQFICPATVKSVHGRLIN------VNFDGWDEEFDELYDVDSH--DILPIGWCEAHSYVLQPPKKYN 611          

HSP 2 Score: 79.7221 bits (195), Expect = 5.121e-15
Identity = 61/194 (31.44%), Postives = 89/194 (45.88%), Query Frame = 2
Query:  686 KFSVNQKLEGVDP-----NNESLFCVLTIVEILGSRLRLHFDG---YQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDK---NNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGH 1234
            K  V QK E +DP     NN  +  +L   +  G  L +  DG    +D F      ++  +FP G+ E  N +L  P ++    F W  YL K  +E      F     P+  +   + F +G +LEA D   +  IC ATVK + G  I V+FD WD  +D      S  +LP+G+CE +  VL  P  Y +
Sbjct:  427 KVKVGQKFELIDPLAQQFNNLHVASILKFCKTEG-YLIVGMDGPDALEDSFPIHI--NNTFMFPVGYAEKYNLELVPPDEFKG-TFRWDEYLEKESAETLPLDLF----KPMPSQERLDKFKVGLRLEAADMCENQFICPATVKSVHGRLINVNFDGWDEEFDELYDVDSHDILPIGWCEAHSYVLQPPKKYNY 612          

HSP 3 Score: 64.6994 bits (156), Expect = 2.044e-10
Identity = 42/134 (31.34%), Postives = 63/134 (47.01%), Query Frame = 2
Query:  503 VGFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDY 904
            VG++ K   E +  +  K    +F W EYL+     T+P  LF  +  +   +D       KF V  +LE  D       C  T+  + G  + ++FDG+ ++FD     DS  I P GWCE ++  LQ PK Y
Sbjct:  488 VGYAEKYNLELVPPDEFKG---TFRWDEYLEKESAETLPLDLFKPMPSQ-ERLD-------KFKVGLRLEAADMCENQFICPATVKSVHGRLINVNFDGWDEEFDELYDVDSHDILPIGWCEAHSYVLQPPKKY 610          
BLAST of Malignant brain tumor-like protein vs. Ensembl Celegans
Match: mbtr-1 (Malignant brain tumor repeat protein 1 [Source:UniProtKB/Swiss-Prot;Acc:A0SQM0])

HSP 1 Score: 65.0846 bits (157), Expect = 1.626e-10
Identity = 70/310 (22.58%), Postives = 128/310 (41.29%), Query Frame = 2
Query:  686 KFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGY-----------------QDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPV-YLTKTKSEAAHESCFFIVKNPISDKNNFI-IGQKLEAVDK----RNSGMICVATVKDIIGEN--ILVHFDSWDSSYDMWA-HYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIF------EERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWC 1519
            +F +NQ++E ++    +   V  I+ ILG RL +                       +  +FW    S  +FP G+   N  + ++ + Y            +  K +   E  F    +  ++K N + +GQK E +D     R S   CVAT++ I      +++  D  +S  + +  H  +  + PVGY E +   + +    G +   F W+ YLK   +E +P+ +       E R+ + F    G   E + +     I  A + +++    V I F  W  +++   D+ S   ++LP GWC
Sbjct:  241 RFRLNQRVELLNYLEPTEIRVARILRILGRRLMVMVTAQDYPEDLPSVEAKDRQVQHENVEFWVDESSFFLFPVGFAMINGLRTKATEGYLEHSRRIAEGSGSYHKDDVTFEQLFAGKPDISAEKLNLLKVGQKFELLDPLSDLRQS--FCVATIRKICKTPGFLIISPDETESDDESFPIHIDNHFMHPVGYAEKFG--IKLDRLAGTEPGKFKWEGYLKEKQAEKIPDEMLRPLPSKERRHMFEF----GRVLEAVGQNETYWISPASVEEVHGR-TVLIEFQGWDSEFSELYDMDSH--DLLPAGWC 539          

HSP 2 Score: 63.5438 bits (153), Expect = 4.458e-10
Identity = 52/185 (28.11%), Postives = 79/185 (42.70%), Query Frame = 2
Query:  689 FSVNQKLEGVDPNNE--SLFCVLTIVEILGSRLRLHFDGYQDQFD---FWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNN---FIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIP 1219
              V QK E +DP ++    FCV TI +I  +   L     + + D   F    D+  + P G+ E    KL          F W  YL + ++E   +        P+  K     F  G+ LEAV +  +  I  A+V+++ G  +L+ F  WDS +       S  LLP G+CE +   L  P
Sbjct:  369 LKVGQKFELLDPLSDLRQSFCVATIRKICKTPGFLIISPDETESDDESFPIHIDNHFMHPVGYAEKFGIKLDRLAGTEPGKFKWEGYLKEKQAEKIPDEML----RPLPSKERRHMFEFGRVLEAVGQNETYWISPASVEEVHGRTVLIEFQGWDSEFSELYDMDSHDLLPAGWCEFFNFKLRHP 549          

HSP 3 Score: 51.2174 bits (121), Expect = 3.536e-6
Identity = 37/138 (26.81%), Postives = 59/138 (42.75%), Query Frame = 2
Query:  503 VGFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFP 916
            VG++ K    KL+R  A ++   F W  YLK      +P ++   +  +          ++ F   + LE V  N        ++ E+ G  + + F G+  +F      DS  + PAGWCE  N KL+ P    N P
Sbjct:  429 VGYAEKFGI-KLDR-LAGTEPGKFKWEGYLKEKQAEKIPDEMLRPLPSK--------ERRHMFEFGRVLEAVGQNETYWISPASVEEVHGRTVLIEFQGWDSEFSELYDMDSHDLLPAGWCEFFNFKLRHPVLPVNDP 556          
BLAST of Malignant brain tumor-like protein vs. Ensembl Celegans
Match: mbtr-1 (Malignant brain tumor repeat protein 1 [Source:UniProtKB/Swiss-Prot;Acc:A0SQM0])

HSP 1 Score: 64.6994 bits (156), Expect = 2.028e-10
Identity = 68/308 (22.08%), Postives = 127/308 (41.23%), Query Frame = 2
Query:  686 KFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGY-----------------QDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPV-YLTKTKSEAAHESCFFIVKNPISDKNNFI-IGQKLEAVDKRN--SGMICVATVKDIIGEN--ILVHFDSWDSSYDMWA-HYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIF------EERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWC 1519
            +F +NQ++E ++    +   V  I+ ILG RL +                       +  +FW    S  +FP G+   N  + ++ + Y            +  K +   E  F    +  ++K N + +GQK E +D  +      CVAT++ I      +++  D  +S  + +  H  +  + PVGY E +   + +    G +   F W+ YLK   +E +P+ +       E R+ + F    G   E + +     I  A + +++    V I F  W  +++   D+ S   ++LP GWC
Sbjct:  228 RFRLNQRVELLNYLEPTEIRVARILRILGRRLMVMVTAQDYPEDLPSVEAKDRQVQHENVEFWVDESSFFLFPVGFAMINGLRTKATEGYLEHSRRIAEGSGSYHKDDVTFEQLFAGKPDISAEKLNLLKVGQKFELLDPLSDLRQSFCVATIRKICKTPGFLIISPDETESDDESFPIHIDNHFMHPVGYAEKFG--IKLDRLAGTEPGKFKWEGYLKEKQAEKIPDEMLRPLPSKERRHMFEF----GRVLEAVGQNETYWISPASVEEVHGR-TVLIEFQGWDSEFSELYDMDSH--DLLPAGWC 526          

HSP 2 Score: 63.5438 bits (153), Expect = 4.764e-10
Identity = 52/185 (28.11%), Postives = 79/185 (42.70%), Query Frame = 2
Query:  689 FSVNQKLEGVDPNNE--SLFCVLTIVEILGSRLRLHFDGYQDQFD---FWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNN---FIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIP 1219
              V QK E +DP ++    FCV TI +I  +   L     + + D   F    D+  + P G+ E    KL          F W  YL + ++E   +        P+  K     F  G+ LEAV +  +  I  A+V+++ G  +L+ F  WDS +       S  LLP G+CE +   L  P
Sbjct:  356 LKVGQKFELLDPLSDLRQSFCVATIRKICKTPGFLIISPDETESDDESFPIHIDNHFMHPVGYAEKFGIKLDRLAGTEPGKFKWEGYLKEKQAEKIPDEML----RPLPSKERRHMFEFGRVLEAVGQNETYWISPASVEEVHGRTVLIEFQGWDSEFSELYDMDSHDLLPAGWCEFFNFKLRHP 536          

HSP 3 Score: 50.8322 bits (120), Expect = 3.521e-6
Identity = 35/131 (26.72%), Postives = 57/131 (43.51%), Query Frame = 2
Query:  503 VGFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSP 895
            VG++ K    KL+R  A ++   F W  YLK      +P ++   +  +          ++ F   + LE V  N        ++ E+ G  + + F G+  +F      DS  + PAGWCE  N KL+ P
Sbjct:  416 VGYAEKFGI-KLDR-LAGTEPGKFKWEGYLKEKQAEKIPDEMLRPLPSK--------ERRHMFEFGRVLEAVGQNETYWISPASVEEVHGRTVLIEFQGWDSEFSELYDMDSHDLLPAGWCEFFNFKLRHP 536          
BLAST of Malignant brain tumor-like protein vs. Ensembl Fly
Match: l(3)mbt (gene:FBgn0002441 transcript:FBtr0085175)

HSP 1 Score: 256.144 bits (653), Expect = 1.681e-70
Identity = 144/386 (37.31%), Postives = 207/386 (53.63%), Query Frame = 2
Query:  527 REKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCF--FIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECN 1678
            +E+L++         F WSEYLKS  G+ V A     I +  +   +  N    F +  KLE +DP N SLFCV +IVE+ G RL+L FDGY   +DFW  +DSQ IFP GWC+   R LQ+PKDY +  FSW  YL KT  +AA  + F    ++  +  +N F +G  LEA D  ++G ICVATV DI+ E I VHFD WD  YD+W H +SP + P G+ E  ++++ +P  Y    S+F WD Y+      +    +F  R     +    M+ EV+D+R P LIR A +    + ++V +  D W  +Y + ++  S   ++ PIGWC      L+ PP +        C + GC+G+G+ K    + H     CPYA  N
Sbjct:  804 QEQLQQRQKDKPRKPFRWSEYLKS-KGKDVAAP----IHLFLNPFPISPNC---FEIGMKLEAIDPENCSLFCVCSIVEVRGYRLKLSFDGYSSMYDFWVNADSQDIFPPGWCDETARVLQAPKDYNSERFSWSRYLVKTGGKAAPRALFGHLNMQQQMDVRNGFAVGMHLEAEDLNDTGKICVATVTDILDERIRVHFDGWDDCYDLWVHITSPYIHPCGWHEGRQQLI-VPPDYQK--SAFIWDDYISEVGGMAASKELFTPRQP--MEYQERMKLEVVDQRNPCLIRPATVV-TRKGYRVQLHLDCWPTEYYFWLEDDSP--DLHPIGWCEATSHELETPPGYLQPKSVMPCDVEGCRGFGNAKRFNLNVHALRECCPYAPEN 1173          

HSP 2 Score: 51.2174 bits (121), Expect = 4.827e-6
Identity = 24/71 (33.80%), Postives = 42/71 (59.15%), Query Frame = 2
Query: 2384 DIKKSILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLK 2596
            D++ + LHW S +V + I   + +   +K   EQ++DG A + L + +L   L +K+GPA+K+ S I  L+
Sbjct: 1294 DVRTNPLHWTSWDVCEYIERALDSTDIAKVIFEQDIDGRALLMLGRKELDTYLKLKVGPAVKLYSLILNLR 1364          
BLAST of Malignant brain tumor-like protein vs. Ensembl Fly
Match: Scm (gene:FBgn0003334 transcript:FBtr0082102)

HSP 1 Score: 145.591 bits (366), Expect = 2.211e-35
Identity = 82/207 (39.61%), Postives = 102/207 (49.28%), Query Frame = 2
Query:  572 FDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNN-FIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYC 1189
            FDW  YL+       PAK F       +N          F +  KLE +DP N +  C+ T+V +LGSRLRL  DG   Q DFW L DS  I   G CE N   LQ P  +     SWP YL K  + A           P   + N F +GQKLEAVDK+N  +IC ATV  I  + I V FD W  ++D W +Y S  + P G+C
Sbjct:  175 FDWDAYLEETGSEAAPAKCFKQAQNPPNN---------DFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFRMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWC 372          

HSP 2 Score: 119.398 bits (298), Expect = 3.690e-27
Identity = 79/240 (32.92%), Postives = 118/240 (49.17%), Query Frame = 2
Query:  893 PKDYTNFP-FSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYL-KLTNSESVPNSIFEERNQWWFDLD---VGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP---PTFDASIESSACP 1588
            P  Y +F  F W  YL +T SEAA   CF   +NP    N+F IG KLEA+D RN    C+ATV  ++G  + +  D  DS  D W    S  +  +G+CE    +L  P   G  +++ SW  YL K+ N+  V      +      + +   VG + E +DK+ PQLI  A +  + ++ Q+ + FD W   ++Y  +  S   +I P GWC ++   +QPP      D+S     CP
Sbjct:  166 PFQYESFHVFDWDAYLEETGSEAAPAKCFKQAQNP--PNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPP--LGFRMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDD-QIHVTFDGWRGAFDYWCNYRSR--DIFPAGWCARSCHPMQPPGHKSRMDSSSSKQRCP 398          

HSP 3 Score: 65.4698 bits (158), Expect = 1.825e-10
Identity = 29/69 (42.03%), Postives = 39/69 (56.52%), Query Frame = 2
Query:  689 FSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSP 895
            F V QKLE VD  N  L C  T+  I   ++ + FDG++  FD+W    S+ IFPAGWC  +   +Q P
Sbjct:  314 FKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPP 382          
BLAST of Malignant brain tumor-like protein vs. Ensembl Fly
Match: Scm (gene:FBgn0003334 transcript:FBtr0306008)

HSP 1 Score: 145.591 bits (366), Expect = 2.211e-35
Identity = 82/207 (39.61%), Postives = 102/207 (49.28%), Query Frame = 2
Query:  572 FDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNN-FIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYC 1189
            FDW  YL+       PAK F       +N          F +  KLE +DP N +  C+ T+V +LGSRLRL  DG   Q DFW L DS  I   G CE N   LQ P  +     SWP YL K  + A           P   + N F +GQKLEAVDK+N  +IC ATV  I  + I V FD W  ++D W +Y S  + P G+C
Sbjct:  175 FDWDAYLEETGSEAAPAKCFKQAQNPPNN---------DFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFRMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWC 372          

HSP 2 Score: 119.398 bits (298), Expect = 3.690e-27
Identity = 79/240 (32.92%), Postives = 118/240 (49.17%), Query Frame = 2
Query:  893 PKDYTNFP-FSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYL-KLTNSESVPNSIFEERNQWWFDLD---VGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP---PTFDASIESSACP 1588
            P  Y +F  F W  YL +T SEAA   CF   +NP    N+F IG KLEA+D RN    C+ATV  ++G  + +  D  DS  D W    S  +  +G+CE    +L  P   G  +++ SW  YL K+ N+  V      +      + +   VG + E +DK+ PQLI  A +  + ++ Q+ + FD W   ++Y  +  S   +I P GWC ++   +QPP      D+S     CP
Sbjct:  166 PFQYESFHVFDWDAYLEETGSEAAPAKCFKQAQNP--PNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLDGSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPP--LGFRMNASSWPGYLCKILNNAMVAPEEIFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDD-QIHVTFDGWRGAFDYWCNYRSR--DIFPAGWCARSCHPMQPPGHKSRMDSSSSKQRCP 398          

HSP 3 Score: 65.4698 bits (158), Expect = 1.825e-10
Identity = 29/69 (42.03%), Postives = 39/69 (56.52%), Query Frame = 2
Query:  689 FSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSP 895
            F V QKLE VD  N  L C  T+  I   ++ + FDG++  FD+W    S+ IFPAGWC  +   +Q P
Sbjct:  314 FKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCNYRSRDIFPAGWCARSCHPMQPP 382          
BLAST of Malignant brain tumor-like protein vs. Ensembl Fly
Match: Sfmbt (gene:FBgn0032475 transcript:FBtr0080491)

HSP 1 Score: 129.798 bits (325), Expect = 2.347e-30
Identity = 98/338 (28.99%), Postives = 162/338 (47.93%), Query Frame = 2
Query:  575 DWSEYL--KSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCF---FIVKNPISD--KNNFIIGQKLEAVDKRNSGMICVATVKDIIGEN-ILVHFDSW--DSSYDMW--AHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPP 1552
            DW ++L  +    RT+P+  ++ I       +    S+++  +N  LE VD +  S   + T+ +I+G RL L +  +     FW   DS +I P GW       L +P+DY     +    + +   + A    F   F      SD   N+F+ G KLEAVD  N   IC ATV  ++    +++  DS+  D+S   W   H  SP + P G+C      +S+    G+D  +F+W+ YL+ T + +    +F  R       +VGM  E  D   P+L+ VA +A++     + + FD W+++Y+  +D  S+  +I P+GWCV     L+ PP
Sbjct:  304 DWKDFLVGRLSGARTLPSNFYNKI-------NDSLQSRFRLGLN--LECVDKDRISQVRLATVTKIVGKRLFLRY--FDSDDGFWCHEDSPIIHPVGWATTVGHNLAAPQDYLERMLAGREAMIEVHEDDATIELFKMNFTFDEYYSDGKTNSFVEGMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPDASGSDWFCYHEKSPCIFPAGFCS--VNNISVTPPNGYDSRTFTWEGYLRDTGAVAAGQHLF-HRIIPDHGFEVGMSLECADLMDPRLVCVATVARVVGRL-LKVHFDGWTDEYDQWLDCESA--DIYPVGWCVLVNHKLEGPP 624          

HSP 2 Score: 103.99 bits (258), Expect = 2.148e-22
Identity = 68/197 (34.52%), Postives = 90/197 (45.69%), Query Frame = 2
Query:  668 EYNSKYK---FSVNQKLEGVDPNNESLFCVLTIVEILG-SRLRLHFDGYQDQFD----FWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGH 1234
            EY S  K   F    KLE VDP N S  C  T++ +L    + +  D YQ        F     S  IFPAG+C  NN  +  P  Y +  F+W  YL  T + AA +  F  +   I D + F +G  LE  D  +  ++CVATV  ++G  + VHFD W   YD W    S  + PVG+C      L  P    H
Sbjct:  436 EYYSDGKTNSFVEGMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPDASGSDWFCYHEKSPCIFPAGFCSVNNISVTPPNGYDSRTFTWEGYLRDTGAVAAGQHLFHRI---IPD-HGFEVGMSLECADLMDPRLVCVATVARVVGRLLKVHFDGWTDEYDQWLDCESADIYPVGWCVLVNHKLEGPPRVAH 628          

HSP 3 Score: 78.5666 bits (192), Expect = 1.986e-14
Identity = 88/372 (23.66%), Postives = 141/372 (37.90%), Query Frame = 2
Query:  563 SSSFDWSEYLKSIDGRTVPAKLF---------DNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGY-QDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSS---------------------FSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSW-------TNILPIGWCVKNGCVLQPPPTFDA 1564
            + S+DW   L   +    P   F         DN+G+    +++E        V Q   G  P +   F V TI+EI G +  + ++G+  D  DFW    +  +   GWC    + L  P+   +    W  +L    S A      F  K   S ++ F +G  LE VDK     + +ATV  I+G+ + + +  +DS    W H  SP++ PVG+       L+ P  Y   + +                     F++D Y     S+   NS  E           GM+ E +D      I  A +  + +   + I  D +    +     GS W         I P G+C  N   + PP  +D+
Sbjct:  181 THSYDWLPRLSKENFNAAPVTCFPHAPGCEVWDNLGVGM-KVEVENTDCDSIEVIQP--GQTPTS---FWVATILEIKGYKALMSYEGFDTDSHDFWVNLCNAEVHSVGWCATRGKPLIPPRTIEHKYKDWKDFLVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLECVDKDRISQVRLATVTKIVGKRLFLRY--FDSDDGFWCHEDSPIIHPVGWATTVGHNLAAPQDYLERMLAGREAMIEVHEDDATIELFKMNFTFDEYY----SDGKTNSFVE-----------GMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPDAS-----GSDWFCYHEKSPCIFPAGFCSVNNISVTPPNGYDS 524          

HSP 4 Score: 71.2478 bits (173), Expect = 3.491e-12
Identity = 36/111 (32.43%), Postives = 51/111 (45.95%), Query Frame = 2
Query:  563 SSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSP 895
            S +F W  YL+          LF  I              + F V   LE  D  +  L CV T+  ++G  L++HFDG+ D++D W   +S  I+P GWC   N KL+ P
Sbjct:  524 SRTFTWEGYLRDTGAVAAGQHLFHRI-----------IPDHGFEVGMSLECADLMDPRLVCVATVARVVGRLLKVHFDGWTDEYDQWLDCESADIYPVGWCVLVNHKLEGP 623          
BLAST of Malignant brain tumor-like protein vs. Ensembl Fly
Match: Sfmbt (gene:FBgn0032475 transcript:FBtr0080492)

HSP 1 Score: 130.183 bits (326), Expect = 2.688e-30
Identity = 98/338 (28.99%), Postives = 162/338 (47.93%), Query Frame = 2
Query:  575 DWSEYL--KSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCF---FIVKNPISD--KNNFIIGQKLEAVDKRNSGMICVATVKDIIGEN-ILVHFDSW--DSSYDMW--AHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPP 1552
            DW ++L  +    RT+P+  ++ I       +    S+++  +N  LE VD +  S   + T+ +I+G RL L +  +     FW   DS +I P GW       L +P+DY     +    + +   + A    F   F      SD   N+F+ G KLEAVD  N   IC ATV  ++    +++  DS+  D+S   W   H  SP + P G+C      +S+    G+D  +F+W+ YL+ T + +    +F  R       +VGM  E  D   P+L+ VA +A++     + + FD W+++Y+  +D  S+  +I P+GWCV     L+ PP
Sbjct:  656 DWKDFLVGRLSGARTLPSNFYNKI-------NDSLQSRFRLGLN--LECVDKDRISQVRLATVTKIVGKRLFLRY--FDSDDGFWCHEDSPIIHPVGWATTVGHNLAAPQDYLERMLAGREAMIEVHEDDATIELFKMNFTFDEYYSDGKTNSFVEGMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPDASGSDWFCYHEKSPCIFPAGFCS--VNNISVTPPNGYDSRTFTWEGYLRDTGAVAAGQHLF-HRIIPDHGFEVGMSLECADLMDPRLVCVATVARVVGRL-LKVHFDGWTDEYDQWLDCESA--DIYPVGWCVLVNHKLEGPP 976          

HSP 2 Score: 103.99 bits (258), Expect = 3.037e-22
Identity = 68/197 (34.52%), Postives = 90/197 (45.69%), Query Frame = 2
Query:  668 EYNSKYK---FSVNQKLEGVDPNNESLFCVLTIVEILG-SRLRLHFDGYQDQFD----FWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGH 1234
            EY S  K   F    KLE VDP N S  C  T++ +L    + +  D YQ        F     S  IFPAG+C  NN  +  P  Y +  F+W  YL  T + AA +  F  +   I D + F +G  LE  D  +  ++CVATV  ++G  + VHFD W   YD W    S  + PVG+C      L  P    H
Sbjct:  788 EYYSDGKTNSFVEGMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPDASGSDWFCYHEKSPCIFPAGFCSVNNISVTPPNGYDSRTFTWEGYLRDTGAVAAGQHLFHRI---IPD-HGFEVGMSLECADLMDPRLVCVATVARVVGRLLKVHFDGWTDEYDQWLDCESADIYPVGWCVLVNHKLEGPPRVAH 980          

HSP 3 Score: 77.7962 bits (190), Expect = 3.592e-14
Identity = 88/372 (23.66%), Postives = 141/372 (37.90%), Query Frame = 2
Query:  563 SSSFDWSEYLKSIDGRTVPAKLF---------DNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGY-QDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSS---------------------FSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSW-------TNILPIGWCVKNGCVLQPPPTFDA 1564
            + S+DW   L   +    P   F         DN+G+    +++E        V Q   G  P +   F V TI+EI G +  + ++G+  D  DFW    +  +   GWC    + L  P+   +    W  +L    S A      F  K   S ++ F +G  LE VDK     + +ATV  I+G+ + + +  +DS    W H  SP++ PVG+       L+ P  Y   + +                     F++D Y     S+   NS  E           GM+ E +D      I  A +  + +   + I  D +    +     GS W         I P G+C  N   + PP  +D+
Sbjct:  533 THSYDWLPRLSKENFNAAPVTCFPHAPGCEVWDNLGVGM-KVEVENTDCDSIEVIQP--GQTPTS---FWVATILEIKGYKALMSYEGFDTDSHDFWVNLCNAEVHSVGWCATRGKPLIPPRTIEHKYKDWKDFLVGRLSGARTLPSNFYNKINDSLQSRFRLGLNLECVDKDRISQVRLATVTKIVGKRLFLRY--FDSDDGFWCHEDSPIIHPVGWATTVGHNLAAPQDYLERMLAGREAMIEVHEDDATIELFKMNFTFDEYY----SDGKTNSFVE-----------GMKLEAVDPLNLSSICPATVMAVLKFGYMMIRIDSYQPDAS-----GSDWFCYHEKSPCIFPAGFCSVNNISVTPPNGYDS 876          

HSP 4 Score: 70.8626 bits (172), Expect = 4.862e-12
Identity = 36/111 (32.43%), Postives = 51/111 (45.95%), Query Frame = 2
Query:  563 SSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSP 895
            S +F W  YL+          LF  I              + F V   LE  D  +  L CV T+  ++G  L++HFDG+ D++D W   +S  I+P GWC   N KL+ P
Sbjct:  876 SRTFTWEGYLRDTGAVAAGQHLFHRI-----------IPDHGFEVGMSLECADLMDPRLVCVATVARVVGRLLKVHFDGWTDEYDQWLDCESADIYPVGWCVLVNHKLEGP 975          
BLAST of Malignant brain tumor-like protein vs. Ensembl Zebrafish
Match: l3mbtl3 (L3MBTL histone methyl-lysine binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-040724-127])

HSP 1 Score: 305.449 bits (781), Expect = 3.991e-91
Identity = 168/417 (40.29%), Postives = 231/417 (55.40%), Query Frame = 2
Query:  479 RRIIDGEVVGFSSKTRREKLERETA--KSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPT----FDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRI 1711
            RR   G   G   +     L R T     K  ++ W+ YL+       P+KLF                K  F V  +LEG+DP + S++CVLTI E+ G R+RLHFD + D +DFW  S+S  I P GWCE    KL  PK   +  FSW  Y+   K + A ++  F  +N     + F +G KLEAV +++   ICVATV D++    LVHFD+W+ SYD W   +SP + PVG+C++  + LS P  Y  D ++FSW+ YL  T+S   P   F+ +    F   V M+ EV+DKR P LIRVA +A   ++ ++ I FD W+++Y+Y ID  S   ++ P GWC K G  LQPP T    F+AS E + CP  GC+G GH+KG RYS H    GCPY++ NLNKD    DR+
Sbjct:  120 RRPARGATRGRKKRRGDAALLRYTVPYGGKKKAWCWASYLEQERAIAAPSKLFKEC-------------KNGFRVGMRLEGIDPEHPSMYCVLTIAEVSGHRIRLHFDHFSDCYDFWVNSNSPDIHPVGWCEKTGHKLHPPKGVRDEEFSWSSYIKLNKIQTAPKA-LFHNQNMTVTPSGFRVGMKLEAVCRKDPTFICVATVTDMVDSRFLVHFDNWEESYDYWCDATSPYIHPVGWCQENGRTLSTPPGYP-DANNFSWEKYLAETSSLPAPARAFKVKPPHGF--QVNMKLEVVDKRNPVLIRVATVAD-TDDHRLWIHFDGWTDEYDYWIDADSP--DVHPAGWCAKTGHPLQPPITPQDMFEAS-EQAGCPTAGCRGVGHIKGARYSGHHSAVGCPYSDINLNKDSVLPDRL 515          

HSP 2 Score: 59.6918 bits (143), Expect = 1.469e-8
Identity = 26/66 (39.39%), Postives = 43/66 (65.15%), Query Frame = 2
Query: 2399 ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLK 2596
            +  W+  EV Q I  + G  +  +TF ++++DG AF+ L Q+DL+K+L +KLGPA+K+ + I   K
Sbjct:  649 VASWSIDEVIQFIQGLPGCKEQVRTFRDEQIDGEAFLLLTQVDLVKILSIKLGPALKIYNSILMFK 714          
BLAST of Malignant brain tumor-like protein vs. Ensembl Zebrafish
Match: l3mbtl1b (L3MBTL histone methyl-lysine binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-100922-38])

HSP 1 Score: 291.967 bits (746), Expect = 1.420e-85
Identity = 160/405 (39.51%), Postives = 225/405 (55.56%), Query Frame = 2
Query:  512 SSKTRRE-KLERETAKS--KSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP-PTFDASI-ESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRI 1711
            SSK RR  K+ R       K  ++ WS YL+       P KLF               S+  F V  KLEG+DP + +LFCVLT+ E+ G R+RLHFDGY + +DFW  +DS  + P GWCE  + KL  PK   +  F+W  Y+   + + A +  F  +   ++  + F  G KLEAVD++N   ICVAT+   +   +L+H D  D ++D W   SSP + PVGYCE+ +  L+ P+ Y H L  FSW+ YL+ T +++ P   F++R    F   VG++ E +DKR P LIRVA I+   EE ++ I FD WS++Y+Y +D  S    + P+GWC K G  LQ P  T D+ +     CP  GC G GH++GPRY  H     CPY++ N NKD    DR+
Sbjct:  210 SSKGRRAAKVARLVTAPLVKKKTWSWSVYLEEERAAAAPLKLF-------KEHQSFPQSRNGFKVGMKLEGLDPCHPALFCVLTVAEVQGYRIRLHFDGYPECYDFWVNADSWDVKPPGWCEKTSLKLLLPKGCRDGEFNWNTYVKNCRGQLAPKHLFKSLNTSVT-PSGFRAGMKLEAVDRKNLSDICVATIAAAVDNRLLIHIDHCDDTHDYWCDASSPYIHPVGYCEEVKLTLTTPAEYKH-LKGFSWEKYLEETGTQAAPARAFKQRPPHGF--QVGVKLEAVDKRNPMLIRVATISD-TEEHRIKIHFDGWSDEYDYWLDADSP--ELHPVGWCQKTGHPLQHPNGTRDSPVPPGQGCPTPGCNGVGHIRGPRYGTHYTAVSCPYSDLNFNKDGLVPDRL 600          

HSP 2 Score: 64.6994 bits (156), Expect = 4.444e-10
Identity = 27/73 (36.99%), Postives = 49/73 (67.12%), Query Frame = 2
Query: 2393 KSILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKE 2611
            K +  WN++EV+  +  + G  +++ TF ++++DG AF+ L Q D++K+L +KLGPA+K+ + I  LK   +E
Sbjct:  714 KRVSKWNTEEVASFVRGLPGCREHAPTFRKEQIDGEAFLLLTQSDIVKILSIKLGPALKIYNSILMLKSADEE 786          
BLAST of Malignant brain tumor-like protein vs. Ensembl Zebrafish
Match: l3mbtl1b (L3MBTL histone methyl-lysine binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-100922-38])

HSP 1 Score: 291.967 bits (746), Expect = 1.420e-85
Identity = 160/405 (39.51%), Postives = 225/405 (55.56%), Query Frame = 2
Query:  512 SSKTRRE-KLERETAKS--KSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP-PTFDASI-ESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRI 1711
            SSK RR  K+ R       K  ++ WS YL+       P KLF               S+  F V  KLEG+DP + +LFCVLT+ E+ G R+RLHFDGY + +DFW  +DS  + P GWCE  + KL  PK   +  F+W  Y+   + + A +  F  +   ++  + F  G KLEAVD++N   ICVAT+   +   +L+H D  D ++D W   SSP + PVGYCE+ +  L+ P+ Y H L  FSW+ YL+ T +++ P   F++R    F   VG++ E +DKR P LIRVA I+   EE ++ I FD WS++Y+Y +D  S    + P+GWC K G  LQ P  T D+ +     CP  GC G GH++GPRY  H     CPY++ N NKD    DR+
Sbjct:  210 SSKGRRAAKVARLVTAPLVKKKTWSWSVYLEEERAAAAPLKLF-------KEHQSFPQSRNGFKVGMKLEGLDPCHPALFCVLTVAEVQGYRIRLHFDGYPECYDFWVNADSWDVKPPGWCEKTSLKLLLPKGCRDGEFNWNTYVKNCRGQLAPKHLFKSLNTSVT-PSGFRAGMKLEAVDRKNLSDICVATIAAAVDNRLLIHIDHCDDTHDYWCDASSPYIHPVGYCEEVKLTLTTPAEYKH-LKGFSWEKYLEETGTQAAPARAFKQRPPHGF--QVGVKLEAVDKRNPMLIRVATISD-TEEHRIKIHFDGWSDEYDYWLDADSP--ELHPVGWCQKTGHPLQHPNGTRDSPVPPGQGCPTPGCNGVGHIRGPRYGTHYTAVSCPYSDLNFNKDGLVPDRL 600          

HSP 2 Score: 64.6994 bits (156), Expect = 4.444e-10
Identity = 27/73 (36.99%), Postives = 49/73 (67.12%), Query Frame = 2
Query: 2393 KSILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKE 2611
            K +  WN++EV+  +  + G  +++ TF ++++DG AF+ L Q D++K+L +KLGPA+K+ + I  LK   +E
Sbjct:  714 KRVSKWNTEEVASFVRGLPGCREHAPTFRKEQIDGEAFLLLTQSDIVKILSIKLGPALKIYNSILMLKSADEE 786          
BLAST of Malignant brain tumor-like protein vs. Ensembl Zebrafish
Match: l3mbtl1a (L3MBTL histone methyl-lysine binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-090312-120])

HSP 1 Score: 262.692 bits (670), Expect = 1.631e-77
Identity = 147/358 (41.06%), Postives = 196/358 (54.75%), Query Frame = 2
Query:  689 FSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP-----------PTFDASIES--------------SACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNK 1687
            F    KLEG+DP + S++ VLT+ E+ G RLRLHFDGY D  DFW  ++   I PAGWCE+   KL +PK      FSW  YL  T+S+AA +  F     P +D   F +G KLEAVD+ N  +ICVATV D + +  LVHFD+WD +YD W   SSP + P+G+C +    L+ P  Y  ++  FSW+ YL+ T S +V    F  R    F   V M+ E +DKRCP LIRVA + +++  +++ I FD WS  Y+  +D  S   +I P GWC   G  L+PP           P+F  S +S                CP  GC G GHV G R++ H   SGCP AE N  +
Sbjct:    4 FRQGMKLEGIDPQHPSMYFVLTVAEVCGYRLRLHFDGYSDCHDFWVNANCADIHPAGWCESTAHKLHTPKGCKEEEFSWSNYLKITRSQAAPKELFISSVKPETD-CGFEVGMKLEAVDRMNPSLICVATVTDRVADRFLVHFDNWDDTYDYWCDSSSPYIHPIGWCHERGLPLTPPQDYP-EVDRFSWERYLEETGSTAVAAEAFRVRPAHSF--QVQMKLEAVDKRCPGLIRVATVQEVD-TYRIKIHFDGWSHLYDEWMD--SDHPDIHPAGWCESTGHPLKPPPCQPTSLAVRQPSFSMSCKSLPQPRNTSKYSFHHRKCPTPGCDGSGHVTG-RFTAHHCLSGCPLAERNQGR 353          

HSP 2 Score: 140.969 bits (354), Expect = 7.769e-35
Identity = 82/221 (37.10%), Postives = 107/221 (48.42%), Query Frame = 2
Query:  560 KSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNF-PFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIP 1219
            K   F WS YLK    +  P +LF       S++  E +    F V  KLE VD  N SL CV T+ + +  R  +HFD + D +D+W  S S  I P GWC      L  P+DY     FSW  YL +T S A     F      +   ++F +  KLEAVDKR  G+I VATV+++    I +HFD W   YD W     P + P G+CE     L  P
Sbjct:   76 KEEEFSWSNYLKITRSQAAPKELF------ISSVKPETDC--GFEVGMKLEAVDRMNPSLICVATVTDRVADRFLVHFDNWDDTYDYWCDSSSPYIHPIGWCHERGLPLTPPQDYPEVDRFSWERYLEETGSTAVAAEAF-----RVRPAHSFQVQMKLEAVDKRCPGLIRVATVQEVDTYRIKIHFDGWSHLYDEWMDSDHPDIHPAGWCESTGHPLKPP 283          

HSP 3 Score: 111.309 bits (277), Expect = 4.697e-25
Identity = 64/185 (34.59%), Postives = 98/185 (52.97%), Query Frame = 2
Query: 1004 KNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFD--LDVGMRCEVIDKRCPQLIRVAHIA-KLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP 1549
            +N+F  G KLE +D ++  M  V TV ++ G  + +HFD +   +D W + +   + P G+CE     L  P   G     FSW +YLK+T S++ P  +F    +   D   +VGM+ E +D+  P LI VA +  ++ + F V   FD+W + Y+Y  D  S +  I PIGWC + G  L PP
Sbjct:    1 RNSFRQGMKLEGIDPQHPSMYFVLTVAEVCGYRLRLHFDGYSDCHDFWVNANCADIHPAGWCESTAHKLHTPK--GCKEEEFSWSNYLKITRSQAAPKELFISSVKPETDCGFEVGMKLEAVDRMNPSLICVATVTDRVADRFLVH--FDNWDDTYDYWCDSSSPY--IHPIGWCHERGLPLTPP 179          

HSP 4 Score: 54.6842 bits (130), Expect = 4.065e-7
Identity = 21/66 (31.82%), Postives = 44/66 (66.67%), Query Frame = 2
Query: 2399 ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLK 2596
            +  W  +EV   ++++IG ++ ++ F ++ +DG +F+ L Q D++K++ +KLGPA+K+ + I   K
Sbjct:  445 VATWTIEEVFGFVNNLIGCEEQARIFKDEMIDGESFLLLTQNDIVKIMNIKLGPALKIHNAILMFK 510          
BLAST of Malignant brain tumor-like protein vs. Ensembl Zebrafish
Match: l3mbtl3 (L3MBTL histone methyl-lysine binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-040724-127])

HSP 1 Score: 247.669 bits (631), Expect = 3.081e-72
Identity = 142/366 (38.80%), Postives = 199/366 (54.37%), Query Frame = 2
Query:  479 RRIIDGEVVGFSSKTRREKLERETA--KSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNS----KYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTF 1558
            RR   G   G   +     L R T     K  ++ W+ YL+       P+KLF            EY      K  F V  +LEG+DP + S++CVLTI E+ G R+RLHFD + D +DFW  S+S  I P GWCE    KL  PK   +  FSW  Y+   K + A ++  F  +N     + F +G KLEAV +++   ICVATV D++    LVHFD+W+ SYD W   +SP + PVG+C++  + LS P  Y  D ++FSW+ YL  T+S   P   F+ +    F   V M+ EV+DKR P LIRVA +A   ++ ++ I FD W+++Y+Y ID  S   ++ P GWC K G  LQPP T+
Sbjct:  139 RRPARGATRGRKKRRGDAALLRYTVPYGGKKKAWCWASYLEQERAIAAPSKLFK-----------EYQCFPQCKNGFRVGMRLEGIDPEHPSMYCVLTIAEVSGHRIRLHFDHFSDCYDFWVNSNSPDIHPVGWCEKTGHKLHPPKGMKDEEFSWSSYIKLNKIQTAPKA-LFHNQNMTVTPSGFRVGMKLEAVCRKDPTFICVATVTDMVDSRFLVHFDNWEESYDYWCDATSPYIHPVGWCQENGRTLSTPPGYP-DANNFSWEKYLAETSSLPAPARAFKVKPPHGF--QVNMKLEVVDKRNPVLIRVATVAD-TDDHRLWIHFDGWTDEYDYWIDADSP--DVHPAGWCAKTGHPLQPPITW 486          
BLAST of Malignant brain tumor-like protein vs. Ensembl Xenopus
Match: ENSXETT00000055847.1 (L3MBTL3, histone methyl-lysine binding protein [Source:NCBI gene;Acc:100496330])

HSP 1 Score: 306.605 bits (784), Expect = 6.585e-91
Identity = 185/574 (32.23%), Postives = 284/574 (49.48%), Query Frame = 2
Query:  182 FDPLVWNKDVGYLPGSTLKFRHNKMGLLELWXXXXXXXXXXXXXXXXXXXXXXXXHDDITVNKIEKTE---------------PTIEDADERKE-----KSKNGFKNPLNTSSYGRKRKRR--IIDG----------------EVVGFSSKTRREKLERETAKS-KSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFD--ASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVPINNSTES 1780
             + L W   +  LPGS ++FR ++ G LE+  ++  V      +S +   +++        +++ K E               PT++ A+E+          +G    +      R R++R  ++D                 + +  + K+R+   + +TA   K   ++W  YL+      VP K F               S+  F    KLEG+DP + SL+CVLT+ E+ G R+RLHFDGY D +DFW  +DS  I P GWCE    KL  PK Y +  FSW  YL   K++ A ++ F     P++  + F    KLEAVD++N  ++CVAT+ DI+   +L+HFDSWD SYD W   SSP + PVGYC++    L+ P  Y  D   F+W++YL+   +++ P   F+ R    +     M+ E +D+R P LIRV    + ++  ++ + FD WS  Y++ +D+ S   +I P+GWC K G  LQ PP     A++    CPI GC G GHV+G RY  H    GCPY+E NLN++    DR+               P+ N+T S
Sbjct:   38 MNALDWRDGIATLPGSHIRFRLSEFGTLEIITDSDSVVTATLPQSGQALGTDTHTSSVSIFSQVIKIEDKDPEMEKKTTEESLPTVQPAEEQPTVPVPPTVASGSSTYIENERPQRLRRKRKLLMDSGDEEDLLDDEEMNHWHDKIKANLKSRKTSKQTKTAPPPKKKLWNWVSYLEEEKMPAVPLKCF-------KEHQSFPQSRNNFRGGMKLEGIDPEHPSLYCVLTVAEVQGYRMRLHFDGYPDCYDFWVNADSVDIHPVGWCERTGHKLLPPKGYKDGEFSWAAYLKHCKAQGAPKTLFKSYNTPVT-PSGFRAAMKLEAVDRKNPSLLCVATISDIVENRLLIHFDSWDHSYDYWCDASSPYIRPVGYCQESAIALTPPPEY-KDPKCFTWEAYLEKNGAQAAPARAFKPRPPHGYQPQ--MKLEAVDQRNPMLIRVCSTVQKDDN-RIKLHFDGWSSLYDFWVDVDSP--DIHPVGWCAKTGHALQLPPGASDMAAVAGQGCPIAGCTGIGHVRGSRYGTHYTAVGCPYSEVNLNRENLLQDRL---------SGERPSPVQNATRS 588          

HSP 2 Score: 63.5438 bits (153), Expect = 1.248e-9
Identity = 27/73 (36.99%), Postives = 48/73 (65.75%), Query Frame = 2
Query: 2393 KSILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKE 2611
            +S+  W++ EV+Q +  + G  + S  F ++++DG AF+ L Q DL+K+LG+KLGPA+K+ + I     L ++
Sbjct:  706 QSVGKWSADEVAQFVHQLPGCTEQSSVFRDEQIDGEAFLLLTQNDLVKILGLKLGPALKIYNSILMFHTLTQD 778          
BLAST of Malignant brain tumor-like protein vs. Ensembl Xenopus
Match: ENSXETT00000055854.1 (L3MBTL3, histone methyl-lysine binding protein [Source:NCBI gene;Acc:100496330])

HSP 1 Score: 299.671 bits (766), Expect = 1.346e-89
Identity = 156/405 (38.52%), Postives = 221/405 (54.57%), Query Frame = 2
Query:  572 FDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFD--ASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVPINNSTES 1780
            ++W  YL+      VP K F               S+  F    KLEG+DP + SL+CVLT+ E+ G R+RLHFDGY D +DFW  +DS  I P GWCE    KL  PK Y +  FSW  YL   K++ A ++ F     P++  + F    KLEAVD++N  ++CVAT+ DI+   +L+HFDSWD SYD W   SSP + PVGYC++    L+ P  Y  D   F+W++YL+   +++ P   F+ R    +     M+ E +D+R P LIRV    + ++  ++ + FD WS  Y++ +D+ S   +I P+GWC K G  LQ PP     A++    CPI GC G GHV+G RY  H    GCPY+E NLN++    DR+               P+ N+T S
Sbjct:  129 WNWVSYLEEEKMPAVPLKCF-------KEHQSFPQSRNNFRGGMKLEGIDPEHPSLYCVLTVAEVQGYRMRLHFDGYPDCYDFWVNADSVDIHPVGWCERTGHKLLPPKGYKDGEFSWAAYLKHCKAQGAPKTLFKSYNTPVT-PSGFRAAMKLEAVDRKNPSLLCVATISDIVENRLLIHFDSWDHSYDYWCDASSPYIRPVGYCQESAIALTPPPEY-KDPKCFTWEAYLEKNGAQAAPARAFKPRPPHGYQPQ--MKLEAVDQRNPMLIRVCSTVQKDDN-RIKLHFDGWSSLYDFWVDVDSP--DIHPVGWCAKTGHALQLPPGASDMAAVAGQGCPIAGCTGIGHVRGSRYGTHYTAVGCPYSEVNLNRENLLQDRL---------SGERPSPVQNATRS 510          

HSP 2 Score: 63.1586 bits (152), Expect = 1.582e-9
Identity = 27/73 (36.99%), Postives = 48/73 (65.75%), Query Frame = 2
Query: 2393 KSILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKE 2611
            +S+  W++ EV+Q +  + G  + S  F ++++DG AF+ L Q DL+K+LG+KLGPA+K+ + I     L ++
Sbjct:  582 QSVGKWSADEVAQFVHQLPGCTEQSSVFRDEQIDGEAFLLLTQNDLVKILGLKLGPALKIYNSILMFHTLTQD 654          
BLAST of Malignant brain tumor-like protein vs. Ensembl Xenopus
Match: ENSXETT00000055857.1 (L3MBTL3, histone methyl-lysine binding protein [Source:NCBI gene;Acc:100496330])

HSP 1 Score: 298.901 bits (764), Expect = 2.520e-89
Identity = 156/405 (38.52%), Postives = 221/405 (54.57%), Query Frame = 2
Query:  572 FDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFD--ASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVPINNSTES 1780
            ++W  YL+      VP K F               S+  F    KLEG+DP + SL+CVLT+ E+ G R+RLHFDGY D +DFW  +DS  I P GWCE    KL  PK Y +  FSW  YL   K++ A ++ F     P++  + F    KLEAVD++N  ++CVAT+ DI+   +L+HFDSWD SYD W   SSP + PVGYC++    L+ P  Y  D   F+W++YL+   +++ P   F+ R    +     M+ E +D+R P LIRV    + ++  ++ + FD WS  Y++ +D+ S   +I P+GWC K G  LQ PP     A++    CPI GC G GHV+G RY  H    GCPY+E NLN++    DR+               P+ N+T S
Sbjct:  131 WNWVSYLEEEKMPAVPLKCF-------KEHQSFPQSRNNFRGGMKLEGIDPEHPSLYCVLTVAEVQGYRMRLHFDGYPDCYDFWVNADSVDIHPVGWCERTGHKLLPPKGYKDGEFSWAAYLKHCKAQGAPKTLFKSYNTPVT-PSGFRAAMKLEAVDRKNPSLLCVATISDIVENRLLIHFDSWDHSYDYWCDASSPYIRPVGYCQESAIALTPPPEY-KDPKCFTWEAYLEKNGAQAAPARAFKPRPPHGYQPQ--MKLEAVDQRNPMLIRVCSTVQKDDN-RIKLHFDGWSSLYDFWVDVDSP--DIHPVGWCAKTGHALQLPPGASDMAAVAGQGCPIAGCTGIGHVRGSRYGTHYTAVGCPYSEVNLNRENLLQDRL---------SGERPSPVQNATRS 512          
BLAST of Malignant brain tumor-like protein vs. Ensembl Xenopus
Match: ENSXETT00000055853.1 (L3MBTL3, histone methyl-lysine binding protein [Source:NCBI gene;Acc:100496330])

HSP 1 Score: 295.434 bits (755), Expect = 6.654e-88
Identity = 155/403 (38.46%), Postives = 218/403 (54.09%), Query Frame = 2
Query:  572 FDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVPINNSTES 1780
            ++W  YL+      VP K F               S+  F    KLEG+DP + SL+CVLT+ E+ G R+RLHFDGY D +DFW  +DS  I P GWCE    KL  PK Y +  FSW  YL   K++ A ++ F     P++  + F    KLEAVD++N  ++CVAT+ DI+   +L+HFDSWD SYD W   SSP + PVGYC++    L+ P  Y  D   F+W++YL+   +++ P   F+ R    +     M+ E +D+R P LIRV    + ++  ++ + FD WS  Y++ +D+ S   +I P+GWC K G  LQ PP          CPI GC G GHV+G RY  H    GCPY+E NLN++    DR+               P+ N+T S
Sbjct:  119 WNWVSYLEEEKMPAVPLKCF-------KEHQSFPQSRNNFRGGMKLEGIDPEHPSLYCVLTVAEVQGYRMRLHFDGYPDCYDFWVNADSVDIHPVGWCERTGHKLLPPKGYKDGEFSWAAYLKHCKAQGAPKTLFKSYNTPVT-PSGFRAAMKLEAVDRKNPSLLCVATISDIVENRLLIHFDSWDHSYDYWCDASSPYIRPVGYCQESAIALTPPPEY-KDPKCFTWEAYLEKNGAQAAPARAFKPRPPHGYQPQ--MKLEAVDQRNPMLIRVCSTVQKDDN-RIKLHFDGWSSLYDFWVDVDSP--DIHPVGWCAKTGHALQLPPA------GQGCPIAGCTGIGHVRGSRYGTHYTAVGCPYSEVNLNRENLLQDRL---------SGERPSPVQNATRS 492          

HSP 2 Score: 63.1586 bits (152), Expect = 1.860e-9
Identity = 27/73 (36.99%), Postives = 48/73 (65.75%), Query Frame = 2
Query: 2393 KSILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKE 2611
            +S+  W++ EV+Q +  + G  + S  F ++++DG AF+ L Q DL+K+LG+KLGPA+K+ + I     L ++
Sbjct:  590 QSVGKWSADEVAQFVHQLPGCTEQSSVFRDEQIDGEAFLLLTQNDLVKILGLKLGPALKIYNSILMFHTLTQD 662          
BLAST of Malignant brain tumor-like protein vs. Ensembl Xenopus
Match: hdac3 (histone deacetylase 3 [Source:Xenbase;Acc:XB-GENE-481106])

HSP 1 Score: 278.87 bits (712), Expect = 7.722e-83
Identity = 150/361 (41.55%), Postives = 209/361 (57.89%), Query Frame = 2
Query:  602 DGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLN 1684
            D RT      ++  +R+ ++  ++ + +K  V  KLEG+DP + SL+ +LT+ E+ G R+RLHFDGY D  DFW  +DS  I PAGWCE    KLQ PK Y +  FSW  YL +TK+  A +   F+     +  + F +G KLEAVD+ N  +ICVA+V D+I +  LVHFD+W  +YD W   SSP + PVG+CE +EK+L+ P  Y  D   FSW  YL  T + +VP   F  R    F +D  MR E +D+R P LI VA + ++ EEF++ + FD WS  Y++ +D  +   ++ P GW  + G  LQ P        S  CP  GC G GHV G R++ H   SGCP A+ N N
Sbjct:   46 DNRTYIVVAPESCSLRYVSLGAQHKNSFK--VGMKLEGIDPQHPSLYFILTVTEVCGFRIRLHFDGYSDCHDFWVNADSPDIHPAGWCERTGHKLQPPKGYKDEDFSWTNYLRQTKAPVAPKH-LFVTPKIGAPPSLFRVGMKLEAVDRMNPSLICVASVTDVIEDRFLVHFDNWGDTYDYWCDPSSPYVHPVGWCEQHEKILTPPQDYP-DPEGFSWGKYLSETKTVAVPAQAFHPRPPHGFKVD--MRLEAVDRRSPSLICVASVVEV-EEFRIKVHFDGWSHMYDFWLD--ADHPDLHPAGWSQRTGHPLQTP-------LSKKCPTPGCDGSGHVTG-RFTAHHCLSGCPLADRNQN 389          

HSP 2 Score: 132.88 bits (333), Expect = 1.023e-31
Identity = 76/223 (34.08%), Postives = 106/223 (47.53%), Query Frame = 2
Query:  560 KSSSFDWSEYLKSIDGRTVPAKLF--DNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFP-FSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIP 1219
            K   F W+ YL+       P  LF    IG   S           F V  KLE VD  N SL CV ++ +++  R  +HFD + D +D+W    S  + P GWCE + + L  P+DY +   FSW  YL++TK+ A     F          + F +  +LEAVD+R+  +ICVA+V ++    I VHFD W   YD W     P L P G+ +     L  P
Sbjct:  145 KDEDFSWTNYLRQTKAPVAPKHLFVTPKIGAPPS----------LFRVGMKLEAVDRMNPSLICVASVTDVIEDRFLVHFDNWGDTYDYWCDPSSPYVHPVGWCEQHEKILTPPQDYPDPEGFSWGKYLSETKTVAVPAQAFH-----PRPPHGFKVDMRLEAVDRRSPSLICVASVVEVEEFRIKVHFDGWSHMYDFWLDADHPDLHPAGWSQRTGHPLQTP 352          

HSP 3 Score: 56.225 bits (134), Expect = 2.343e-7
Identity = 22/67 (32.84%), Postives = 43/67 (64.18%), Query Frame = 2
Query: 2396 SILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLK 2596
            ++  W+++EV   + ++ G +  ++ F E+ +DG A + L Q D++K+L +KLGPA+K+ + I   K
Sbjct:  484 TVSKWSTEEVFSFVQTLTGCEDQARLFREEMIDGQALLLLTQTDIVKILCIKLGPAVKIYNSILMFK 550          
BLAST of Malignant brain tumor-like protein vs. Ensembl Mouse
Match: L3mbtl3 (L3MBTL3 histone methyl-lysine binding protein [Source:MGI Symbol;Acc:MGI:2143628])

HSP 1 Score: 304.679 bits (779), Expect = 1.559e-89
Identity = 170/432 (39.35%), Postives = 239/432 (55.32%), Query Frame = 2
Query:  491 DGEVVGFSSKTRREK------LERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESS---ACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVP 1759
            DG ++  S + RR++      L++        ++ W+ YL+      VP KLF        +    YN K  F V  KLEGVDP++++++CVLT+ E+ G R++LHFDGY D +DFW  +D+  I P GWCE    KL+ PK Y    F+W  YL   K++AA +S  F  +N     + F +G KLEA DK++  +ICVATV D++    LVHFD+WD SYD W   +SP + PVG+C+++ + L  P  Y H +  FSWD YL+ TNS   P   F+ +    F     M+ E +DKR P  IRVA +A   ++ ++ + FD WS  Y+Y ID  S   +I P+GWC K G  LQ P +    +E S    CP  GC+G GH K  RY   Q  + CPY+E NL+K+    DR+      S D S  T P
Sbjct:  174 DGRILRGSQRARRKRRGDSAVLKQGLPPKGKKTWCWASYLEEEKAVAVPTKLFKE------HQSFPYN-KNGFKVGMKLEGVDPDHQAMYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLRPPKGYKEEEFNWQSYLKTCKAQAAPKS-LFENQNITVIPSGFRVGMKLEAADKKSPSVICVATVTDMVDNRFLVHFDNWDESYDYWCESNSPHIHPVGWCKEHRRTLITPPGYSH-VKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKK--MKLEAVDKRNPLFIRVATVAD-TDDHRIKVHFDGWSSCYDYWIDADSP--DIHPVGWCSKTGHPLQAPLSPAELMEPSETGGCPTLGCRGVGHFKKSRYLGTQSGANCPYSEINLSKERIFPDRL------SGDTSPPTTP 585          

HSP 2 Score: 62.3882 bits (150), Expect = 2.339e-9
Identity = 25/72 (34.72%), Postives = 48/72 (66.67%), Query Frame = 2
Query: 2399 ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKET 2614
            +  W++ EVS+ I S+ G +++ K F ++++DG AF+ + Q D++K++ +KLGPA+K+ + I   K   K +
Sbjct:  783 VSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNS 854          
BLAST of Malignant brain tumor-like protein vs. Ensembl Mouse
Match: L3mbtl3 (L3MBTL3 histone methyl-lysine binding protein [Source:MGI Symbol;Acc:MGI:2143628])

HSP 1 Score: 304.679 bits (779), Expect = 2.400e-89
Identity = 170/432 (39.35%), Postives = 239/432 (55.32%), Query Frame = 2
Query:  491 DGEVVGFSSKTRREK------LERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESS---ACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVP 1759
            DG ++  S + RR++      L++        ++ W+ YL+      VP KLF        +    YN K  F V  KLEGVDP++++++CVLT+ E+ G R++LHFDGY D +DFW  +D+  I P GWCE    KL+ PK Y    F+W  YL   K++AA +S  F  +N     + F +G KLEA DK++  +ICVATV D++    LVHFD+WD SYD W   +SP + PVG+C+++ + L  P  Y H +  FSWD YL+ TNS   P   F+ +    F     M+ E +DKR P  IRVA +A   ++ ++ + FD WS  Y+Y ID  S   +I P+GWC K G  LQ P +    +E S    CP  GC+G GH K  RY   Q  + CPY+E NL+K+    DR+      S D S  T P
Sbjct:  199 DGRILRGSQRARRKRRGDSAVLKQGLPPKGKKTWCWASYLEEEKAVAVPTKLFKE------HQSFPYN-KNGFKVGMKLEGVDPDHQAMYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLRPPKGYKEEEFNWQSYLKTCKAQAAPKS-LFENQNITVIPSGFRVGMKLEAADKKSPSVICVATVTDMVDNRFLVHFDNWDESYDYWCESNSPHIHPVGWCKEHRRTLITPPGYSH-VKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKK--MKLEAVDKRNPLFIRVATVAD-TDDHRIKVHFDGWSSCYDYWIDADSP--DIHPVGWCSKTGHPLQAPLSPAELMEPSETGGCPTLGCRGVGHFKKSRYLGTQSGANCPYSEINLSKERIFPDRL------SGDTSPPTTP 610          

HSP 2 Score: 62.7734 bits (151), Expect = 2.065e-9
Identity = 25/72 (34.72%), Postives = 48/72 (66.67%), Query Frame = 2
Query: 2399 ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKET 2614
            +  W++ EVS+ I S+ G +++ K F ++++DG AF+ + Q D++K++ +KLGPA+K+ + I   K   K +
Sbjct:  808 VSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNS 879          
BLAST of Malignant brain tumor-like protein vs. Ensembl Mouse
Match: L3mbtl3 (L3MBTL3 histone methyl-lysine binding protein [Source:MGI Symbol;Acc:MGI:2143628])

HSP 1 Score: 304.679 bits (779), Expect = 2.400e-89
Identity = 170/432 (39.35%), Postives = 239/432 (55.32%), Query Frame = 2
Query:  491 DGEVVGFSSKTRREK------LERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESS---ACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVP 1759
            DG ++  S + RR++      L++        ++ W+ YL+      VP KLF        +    YN K  F V  KLEGVDP++++++CVLT+ E+ G R++LHFDGY D +DFW  +D+  I P GWCE    KL+ PK Y    F+W  YL   K++AA +S  F  +N     + F +G KLEA DK++  +ICVATV D++    LVHFD+WD SYD W   +SP + PVG+C+++ + L  P  Y H +  FSWD YL+ TNS   P   F+ +    F     M+ E +DKR P  IRVA +A   ++ ++ + FD WS  Y+Y ID  S   +I P+GWC K G  LQ P +    +E S    CP  GC+G GH K  RY   Q  + CPY+E NL+K+    DR+      S D S  T P
Sbjct:  199 DGRILRGSQRARRKRRGDSAVLKQGLPPKGKKTWCWASYLEEEKAVAVPTKLFKE------HQSFPYN-KNGFKVGMKLEGVDPDHQAMYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLRPPKGYKEEEFNWQSYLKTCKAQAAPKS-LFENQNITVIPSGFRVGMKLEAADKKSPSVICVATVTDMVDNRFLVHFDNWDESYDYWCESNSPHIHPVGWCKEHRRTLITPPGYSH-VKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKK--MKLEAVDKRNPLFIRVATVAD-TDDHRIKVHFDGWSSCYDYWIDADSP--DIHPVGWCSKTGHPLQAPLSPAELMEPSETGGCPTLGCRGVGHFKKSRYLGTQSGANCPYSEINLSKERIFPDRL------SGDTSPPTTP 610          

HSP 2 Score: 62.7734 bits (151), Expect = 2.065e-9
Identity = 25/72 (34.72%), Postives = 48/72 (66.67%), Query Frame = 2
Query: 2399 ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKET 2614
            +  W++ EVS+ I S+ G +++ K F ++++DG AF+ + Q D++K++ +KLGPA+K+ + I   K   K +
Sbjct:  808 VSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNS 879          
BLAST of Malignant brain tumor-like protein vs. Ensembl Mouse
Match: L3mbtl4 (L3MBTL4 histone methyl-lysine binding protein [Source:MGI Symbol;Acc:MGI:2444889])

HSP 1 Score: 288.115 bits (736), Expect = 2.527e-87
Identity = 151/395 (38.23%), Postives = 219/395 (55.44%), Query Frame = 2
Query:  539 ERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEY-NSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP---PTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRI 1711
            +RE++ + + ++ W +YL+  +    P +LF          D  +   +  F V  +LEG+D    S+FCVL++ E+ G RLRLHFDGY   +DFWT + S  I P GWC+    +L  P+DY    F W  YL   + + A +  F    +       F +G KLEAVD+RN  ++CVAT+ DI+ + + VHFDS D S+D W   +SP + PVG+C++  + L  P  Y H    FSW  YL+ + S++VP   F  R    F  +  M+ E +DKR PQLIRVA IA + ++++V I FD W  KY+Y +D  S   +I PIGWC   G  L+ P             ACP  GC+G GH++GPRY+ H    GCPY++ NL ++    DR+
Sbjct:   41 KRESSVTTAETWSWEQYLREGNAVAAPVELFSK--------DQSFPEHENGFQVGMRLEGIDARRPSVFCVLSVAEVCGYRLRLHFDGYLSCYDFWTNAGSPDIHPVGWCQKTKHELHIPRDYRKDKFVWMDYLKACRLQNAPKKLFRNRSSNGPVPREFQVGMKLEAVDRRNPCLMCVATIADIVEDRVRVHFDSLDDSFDYWCDVNSPYIQPVGWCQENGRTLVAPQGYPHP-DKFSWTDYLRASQSKAVPAKAFGMRTPHGFLPN--MKLEAVDKRNPQLIRVATIADV-DDYRVKIHFDGWDHKYDYWVDADSQ--DIHPIGWCDVTGHPLEVPYGSKHVKILPGQPACPTPGCRGIGHIRGPRYAGHHSAFGCPYSDVNLKREAALQDRL 421          
BLAST of Malignant brain tumor-like protein vs. Ensembl Mouse
Match: L3mbtl4 (L3MBTL4 histone methyl-lysine binding protein [Source:MGI Symbol;Acc:MGI:2444889])

HSP 1 Score: 290.041 bits (741), Expect = 1.704e-86
Identity = 151/395 (38.23%), Postives = 219/395 (55.44%), Query Frame = 2
Query:  539 ERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEY-NSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP---PTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRI 1711
            +RE++ + + ++ W +YL+  +    P +LF          D  +   +  F V  +LEG+D    S+FCVL++ E+ G RLRLHFDGY   +DFWT + S  I P GWC+    +L  P+DY    F W  YL   + + A +  F    +       F +G KLEAVD+RN  ++CVAT+ DI+ + + VHFDS D S+D W   +SP + PVG+C++  + L  P  Y H    FSW  YL+ + S++VP   F  R    F  +  M+ E +DKR PQLIRVA IA ++ +++V I FD W  KY+Y +D  S   +I PIGWC   G  L+ P             ACP  GC+G GH++GPRY+ H    GCPY++ NL ++    DR+
Sbjct:   41 KRESSVTTAETWSWEQYLREGNAVAAPVELFSK--------DQSFPEHENGFQVGMRLEGIDARRPSVFCVLSVAEVCGYRLRLHFDGYLSCYDFWTNAGSPDIHPVGWCQKTKHELHIPRDYRKDKFVWMDYLKACRLQNAPKKLFRNRSSNGPVPREFQVGMKLEAVDRRNPCLMCVATIADIVEDRVRVHFDSLDDSFDYWCDVNSPYIQPVGWCQENGRTLVAPQGYPHP-DKFSWTDYLRASQSKAVPAKAFGMRTPHGFLPN--MKLEAVDKRNPQLIRVATIADVD-DYRVKIHFDGWDHKYDYWVDADSQ--DIHPIGWCDVTGHPLEVPYGSKHVKILPGQPACPTPGCRGIGHIRGPRYAGHHSAFGCPYSDVNLKREAALQDRL 421          

HSP 2 Score: 63.1586 bits (152), Expect = 1.109e-9
Identity = 26/68 (38.24%), Postives = 49/68 (72.06%), Query Frame = 2
Query: 2384 DIKKS-ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGI 2584
            DI+ S +  W   EV++ + S++G ++++K F ++++DG AF+ L Q D++KV+ +KLGPA+K+ + I
Sbjct:  534 DIQASQVARWTVDEVAEFVQSLLGCEEHAKCFKKEQIDGKAFLLLTQADIVKVMRIKLGPALKIYNSI 601          
BLAST of Malignant brain tumor-like protein vs. UniProt/SwissProt
Match: sp|Q96JM7|LMBL3_HUMAN (Lethal(3)malignant brain tumor-like protein 3 OS=Homo sapiens OX=9606 GN=L3MBTL3 PE=1 SV=2)

HSP 1 Score: 308.531 bits (789), Expect = 6.399e-91
Identity = 185/470 (39.36%), Postives = 254/470 (54.04%), Query Frame = 2
Query:  389 TIEDADERKEKSKNGFKNPLNTSSYGRKRKRRIIDGEVV--GFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPT----FDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVPINNSTES 1780
            T ED +ER ++ +N     +   S   +RKRR  D  V+  G   K ++             ++ W+ YL+      VPAKLF        +    YN K  F V  KLEGVDP ++S++CVLT+ E+ G R++LHFDGY D +DFW  +D+  I P GWCE    KL  PK Y    F+W  YL   K++AA +S  F  +N     + F +G KLEAVDK+N   ICVATV D++    LVHFD+WD SYD W   SSP + PVG+C+++ + L  P  Y  ++  FSWD YL+ TNS   P   F+ +    F     M+ EV+DKR P  IRVA +A   ++ +V + FD W+  Y+Y ID  S   +I P+GWC K G  LQPP +     +AS E   C   GCKG GH K  R+      + CPY+E NLNKD    DR    +   +  +S + P N  T++
Sbjct:  183 TKEDGEERDDEMENKQDVRILRGSQRARRKRRG-DSAVLKQGLPPKGKK-------------AWCWASYLEEEKAVAVPAKLFKE------HQSFPYN-KNGFKVGMKLEGVDPEHQSVYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLHPPKGYKEEEFNWQTYLKTCKAQAAPKS-LFENQNITVIPSGFRVGMKLEAVDKKNPSFICVATVTDMVDNRFLVHFDNWDESYDYWCEASSPHIHPVGWCKEHRRTLITPPGYP-NVKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKK--MKLEVVDKRNPMFIRVATVAD-TDDHRVKVHFDGWNNCYDYWIDADSP--DIHPVGWCSKTGHPLQPPLSPLELMEAS-EHGGCSTPGCKGIGHFKRARHLGPHSAANCPYSEINLNKDRIFPDR----LSGEMPPASPSFPRNKRTDA 619          

HSP 2 Score: 62.7734 bits (151), Expect = 1.323e-8
Identity = 25/72 (34.72%), Postives = 48/72 (66.67%), Query Frame = 2
Query: 2399 ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKET 2614
            +  W++ EVS+ I S+ G +++ K F ++++DG AF+ + Q D++K++ +KLGPA+K+ + I   K   K +
Sbjct:  705 VSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNS 776          
BLAST of Malignant brain tumor-like protein vs. UniProt/SwissProt
Match: sp|Q8BLB7|LMBL3_MOUSE (Lethal(3)malignant brain tumor-like protein 3 OS=Mus musculus OX=10090 GN=L3mbtl3 PE=1 SV=1)

HSP 1 Score: 304.679 bits (779), Expect = 1.679e-88
Identity = 170/432 (39.35%), Postives = 239/432 (55.32%), Query Frame = 2
Query:  491 DGEVVGFSSKTRREK------LERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESS---ACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVP 1759
            DG ++  S + RR++      L++        ++ W+ YL+      VP KLF        +    YN K  F V  KLEGVDP++++++CVLT+ E+ G R++LHFDGY D +DFW  +D+  I P GWCE    KL+ PK Y    F+W  YL   K++AA +S  F  +N     + F +G KLEA DK++  +ICVATV D++    LVHFD+WD SYD W   +SP + PVG+C+++ + L  P  Y H +  FSWD YL+ TNS   P   F+ +    F     M+ E +DKR P  IRVA +A   ++ ++ + FD WS  Y+Y ID  S   +I P+GWC K G  LQ P +    +E S    CP  GC+G GH K  RY   Q  + CPY+E NL+K+    DR+      S D S  T P
Sbjct:  199 DGRILRGSQRARRKRRGDSAVLKQGLPPKGKKTWCWASYLEEEKAVAVPTKLFKE------HQSFPYN-KNGFKVGMKLEGVDPDHQAMYCVLTVAEVCGYRIKLHFDGYSDCYDFWVNADALDIHPVGWCEKTGHKLRPPKGYKEEEFNWQSYLKTCKAQAAPKS-LFENQNITVIPSGFRVGMKLEAADKKSPSVICVATVTDMVDNRFLVHFDNWDESYDYWCESNSPHIHPVGWCKEHRRTLITPPGYSH-VKHFSWDKYLEETNSLPAPARAFKVKPPHGFQKK--MKLEAVDKRNPLFIRVATVAD-TDDHRIKVHFDGWSSCYDYWIDADSP--DIHPVGWCSKTGHPLQAPLSPAELMEPSETGGCPTLGCRGVGHFKKSRYLGTQSGANCPYSEINLSKERIFPDRL------SGDTSPPTTP 610          

HSP 2 Score: 62.7734 bits (151), Expect = 1.444e-8
Identity = 25/72 (34.72%), Postives = 48/72 (66.67%), Query Frame = 2
Query: 2399 ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKET 2614
            +  W++ EVS+ I S+ G +++ K F ++++DG AF+ + Q D++K++ +KLGPA+K+ + I   K   K +
Sbjct:  808 VSKWSTDEVSEFIQSLPGCEEHGKVFKDEQIDGEAFLLMTQTDIVKIMSIKLGPALKIFNSILMFKAAEKNS 879          
BLAST of Malignant brain tumor-like protein vs. UniProt/SwissProt
Match: sp|B1B1A0|LMBL4_MOUSE (Lethal(3)malignant brain tumor-like protein 4 OS=Mus musculus OX=10090 GN=L3mbtl4 PE=2 SV=2)

HSP 1 Score: 290.812 bits (743), Expect = 8.237e-86
Identity = 151/395 (38.23%), Postives = 219/395 (55.44%), Query Frame = 2
Query:  539 ERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEY-NSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP---PTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRI 1711
            +RE++ + + ++ W +YL+  +    P +LF          D  +   +  F V  +LEG+D    S+FCVL++ E+ G RLRLHFDGY   +DFWT + S  I P GWC+    +L  P+DY    F W  YL   + + A +  F    +       F +G KLEAVD+RN  ++CVAT+ DI+ + + VHFDS D S+D W   +SP + PVG+C++  + L  P  Y H    FSW  YL+ + S++VP   F  R    F  +  M+ E +DKR PQLIRVA IA ++ +++V I FD W  KY+Y +D  S   +I PIGWC   G  L+ P             ACP  GC+G GH++GPRY+ H    GCPY++ NL ++    DR+
Sbjct:   41 KRESSVTTAETWSWEQYLREGNAVAAPVELFSK--------DQSFPEHENGFQVGMRLEGIDARRPSVFCVLSVAEVCGYRLRLHFDGYLSCYDFWTNAGSPDIHPVGWCQKTKHELHIPRDYRKDKFVWMDYLKACRLQNAPKKLFRNRSSNGPVPREFQVGMKLEAVDRRNPCLMCVATIADIVEDRVRVHFDSLDDSFDYWCDVNSPYIQPVGWCQENGRTLVAPQGYPHP-DKFSWTDYLRASQSKAVPAKAFGMRTPHGFLPN--MKLEAVDKRNPQLIRVATIADVD-DYRVKIHFDGWDHKYDYWVDADSQ--DIHPIGWCDVTGHPLEVPYGSKHVKILPGQPACPTPGCRGIGHIRGPRYAGHHSAFGCPYSDVNLKREAALQDRL 421          

HSP 2 Score: 63.5438 bits (153), Expect = 7.182e-9
Identity = 26/68 (38.24%), Postives = 49/68 (72.06%), Query Frame = 2
Query: 2384 DIKKS-ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGI 2584
            DI+ S +  W   EV++ + S++G ++++K F ++++DG AF+ L Q D++KV+ +KLGPA+K+ + I
Sbjct:  534 DIQASQVARWTVDEVAEFVQSLLGCEEHAKCFKKEQIDGKAFLLLTQADIVKVMRIKLGPALKIYNSI 601          
BLAST of Malignant brain tumor-like protein vs. UniProt/SwissProt
Match: sp|Q8NA19|LMBL4_HUMAN (Lethal(3)malignant brain tumor-like protein 4 OS=Homo sapiens OX=9606 GN=L3MBTL4 PE=1 SV=2)

HSP 1 Score: 290.041 bits (741), Expect = 1.445e-85
Identity = 156/398 (39.20%), Postives = 223/398 (56.03%), Query Frame = 2
Query:  536 LERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEY-NSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCF--FIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQ-PPPTFDASI--ESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRI 1711
            L    + +   ++ W  YLK       P +LF          D  +   +  F +  +LEG+DP + S+FCVL++ E+ G RLRLHFDGY   +DFWT + S  I P GWCE    +L  PK Y    F W  YL   K + A +  F       P+S    F +G KLEAVD++N  ++CVAT+ DI+ + +LVHFD+WD SYD W   +SP + PVG+C++  + L  P  Y  +  +FSW  YL+ T + +VP  +F+ R    F  +  M+ EV+DKR P+LIRVA I  ++++ +V + FD W  KY+Y ++  S   +I PIGWC   G  L+ P  T D  I    + CP  GC+G GH++GPRYS H    GCPY++ NL K+    DR+
Sbjct:   40 LSHVPSAAAQGAWSWEWYLKEQKAVAAPVELFSK--------DQSFPEHENGFQIGMRLEGIDPRHPSVFCVLSVAEVCGYRLRLHFDGYLSCYDFWTNAGSPDIHPVGWCEKTKHELHIPKGYRKDKFVWMDYLKACKLQNAPKKLFRNRSPNGPMS--KEFQVGMKLEAVDRKNPSLVCVATIADIVEDRLLVHFDNWDDSYDYWCDVNSPYVQPVGWCQENGRTLIAPQGYP-NPENFSWTEYLEATQTNAVPAKVFKMRLPHGFLPN--MKLEVVDKRNPRLIRVATIVDVDDQ-RVKVHFDGWDHKYDYWVEADSP--DIHPIGWCDVTGHPLEVPQRTNDLKILPGQAVCPTPGCRGIGHIRGPRYSGHHSAFGCPYSDMNLKKEATLHDRL 421          

HSP 2 Score: 63.5438 bits (153), Expect = 5.611e-9
Identity = 26/73 (35.62%), Postives = 50/73 (68.49%), Query Frame = 2
Query: 2384 DIKKS-ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQ 2599
            DI+ S +  W   EV++ + S++G ++++K F ++++DG AF+ L Q D++KV+ +KLGPA+K+ + I   + 
Sbjct:  534 DIRASQVARWTVDEVAEFVQSLLGCEEHAKCFKKEQIDGKAFLLLTQTDIVKVMKIKLGPALKIYNSILMFRH 606          
BLAST of Malignant brain tumor-like protein vs. UniProt/SwissProt
Match: sp|E1C2V1|LMBL1_CHICK (Lethal(3)malignant brain tumor-like protein 1 OS=Gallus gallus OX=9031 GN=L3MBTL1 PE=3 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 7.576e-83
Identity = 157/381 (41.21%), Postives = 214/381 (56.17%), Query Frame = 2
Query:  548 TAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYK--FSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP--PTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECN 1678
             ++ K   + W+ YL+       P  LF          D +  S++K  F V  KLEG+DP + S++ +LT+ E+ G R+RLHFDGY +  DFW  +DS  I PAGW E    KLQ PK Y    FSW  YL  TK++AA +   F+++N       F +G KLEAVD+ N  +ICVATV D++ +  LVHFD+WD +YD W   SSP + PVG+C+++ K L+ P  Y  D  +F W+ YLK T + +VP   F+ R    F   V M+ E +D+R P  IRVA +  + E+ ++ I FD WS  Y++ ID  +   +I PIGWC K G  LQPP  P   AS   S CP  GCK   H K  +YS H R   CP   C+
Sbjct:  292 ASEEKKEGWSWASYLEEQKAVAAPLDLFQ---------DYQVASQHKNGFKVGMKLEGIDPQHPSMYFILTVAEVCGYRMRLHFDGYSECHDFWLNADSPDIHPAGWFEETGHKLQPPKGYKEEEFSWTNYLKITKAQAAPKH-LFVIRNTHEAPPGFEVGMKLEAVDRMNPSLICVATVTDVVDDRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQEHGKPLTPPQDYP-DPDNFIWEKYLKETGASAVPAWAFKVRPPHGF--LVNMKLEAVDRRTPSFIRVASVEDV-EDHRIKIHFDGWSHVYDFWID--ADHPDIHPIGWCSKTGHPLQPPLRPKEPASSAHSGCPTLGCKNIPHTKSSKYSFHHRK--CPTPGCD 654          

HSP 2 Score: 55.0694 bits (131), Expect = 3.003e-6
Identity = 22/67 (32.84%), Postives = 41/67 (61.19%), Query Frame = 2
Query: 2396 SILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLK 2596
            ++  W   EV   + ++ G +  +K F ++ +DG AF+ L Q D++K++ +KLGPA+K+ + I   K
Sbjct:  774 TVAKWTIDEVFSFVQTLTGCEDQAKLFKDEMIDGEAFLLLTQADIVKIMSVKLGPALKIYNAILMFK 840          
BLAST of Malignant brain tumor-like protein vs. TrEMBL
Match: A0A481NV20 (Malignant brain tumor-like protein OS=Dugesia japonica OX=6161 GN=mbt PE=2 SV=1)

HSP 1 Score: 1325.07 bits (3428), Expect = 0.000e+0
Identity = 686/852 (80.52%), Postives = 754/852 (88.50%), Query Frame = 2
Query:  101 MNKTKDPGLEFMKYSKNQFCKSLINPYFDPLVWNKDVGYLPGSTLKFRHNKMGLLELWXXXXXXXXXXXXXXXXXXXXXXXXHDDITVNKIEKTEPTIEDADERKEK---SKNGFKNPLNTSSYGRKRKRRIIDGEVVGFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVPINNSTESVL--DNVQDEPINSVQKXXXXXXXXXXXXXXXXSMKENKNPIQNDFIKDLSMNQNEIPEDSQL---LDNSPCDFHQIKIYDFPPTLSLQELKDQDENLELFREDQKFFFQYHPPKNLIPNPVAIVSSSVLKPYTNRTPYHPSDDYRRIMEWNILEQILPSLKLVKEENSQIIQDIQXXXXXXXXXXXXXXXXXXXXXXXXDQIKEMDIKKSILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKETKLSEFA 2632
            M KTKDPGLEF+KYSKNQFCKSL+NP+FDPLVWNKD+GYLPGSTLKFR NKMG+LELWEENKQ   + S              D++ + K EK +   E  DERKEK   +KNG K+PLNTSSYGRKRKRRIIDGEVVGF++KTRREKLERET KSKSSSFDW+EYLKSIDGRTVPAKLFDNIGIRFSN DME  +K KF+VNQKLEG+DPNNESLFCVLTIVE+ GSR+RLHFDGYQDQFDFWTL DSQLIFP GW E NN+KLQ PKDY N PF+W  YLTKTKSEAA ESCF IVKNPIS +NNF+IGQKLEAVDKRNSGMICVATVKDIIG+N+LVHFDSWDSSYDMWAH  SPLLLPVGYCED EKVLSIPSAYGHDLSSFSW+SYLKLTNS SVPNS+FEERNQWWFD++VGMRCEVIDKRCPQLIR AHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILP+GWC KNGC+LQPPPTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFK+ DRIPLSIIQS+D S   +PI+N  E VL  +N+Q+E + SVQKPLEIEIPIDD+EPMDLSMKENK PIQ++ + D S++QNEI +DSQ+   L+NSPCDFH  KIYDFPP+LSLQELK+ DEN ELF+EDQKFFFQ +PPKNLIPNPVAIVSSSVL+PYTNR PYHPSDDYRRIMEWNI+EQILP LK VK+ENSQ+IQ++Q  KNLK K KNKK +NKK+NSN++D IK+M+IKKSI  WNS EVS LIS VIGTDQY+KTF+EQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYL+QLF ETKLSE A
Sbjct:    1 MQKTKDPGLEFIKYSKNQFCKSLLNPFFDPLVWNKDIGYLPGSTLKFRQNKMGMLELWEENKQDSKENSNSESPE-------RDNLIITKTEKIDLISEIIDERKEKLEKNKNGIKSPLNTSSYGRKRKRRIIDGEVVGFAAKTRREKLERETIKSKSSSFDWTEYLKSIDGRTVPAKLFDNIGIRFSNSDME--NKTKFAVNQKLEGIDPNNESLFCVLTIVEVSGSRIRLHFDGYQDQFDFWTLVDSQLIFPPGWSEKNNKKLQPPKDYNNIPFTWAAYLTKTKSEAAQESCFSIVKNPISSRNNFVIGQKLEAVDKRNSGMICVATVKDIIGDNVLVHFDSWDSSYDMWAHCCSPLLLPVGYCEDNEKVLSIPSAYGHDLSSFSWESYLKLTNSTSVPNSVFEERNQWWFDIEVGMRCEVIDKRCPQLIRTAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPVGWCAKNGCILQPPPTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKSADRIPLSIIQSIDNSIENIPIHNKLEEVLISENIQEETVISVQKPLEIEIPIDDVEPMDLSMKENKFPIQDELVTDQSIDQNEILDDSQIPDNLNNSPCDFHHNKIYDFPPSLSLQELKEHDENFELFKEDQKFFFQSNPPKNLIPNPVAIVSSSVLRPYTNRIPYHPSDDYRRIMEWNIVEQILPPLKSVKDENSQVIQELQ-NKNLKGKCKNKKIANKKRNSNVSDHIKDMNIKKSIFQWNSYEVSHLISLVIGTDQYTKTFVEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLRQLFPETKLSEIA 842          
BLAST of Malignant brain tumor-like protein vs. TrEMBL
Match: A0A3R7ES61 (Lethal(3)malignant brain tumor-like protein 3 (Fragment) OS=Clonorchis sinensis OX=79923 GN=L3mbtl3 PE=4 SV=1)

HSP 1 Score: 376.711 bits (966), Expect = 6.810e-116
Identity = 200/452 (44.25%), Postives = 264/452 (58.41%), Query Frame = 2
Query:  563 SSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSN------IDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTN---FPFSWPVYLTKTKSEAAHESCFFIVKNPISDK---NNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEER---NQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDA--------------------SIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKD-FKTIDRIPLSIIQSLDESSATVPINNSTESVLDNVQDEPI 1810
            S SFDW  YLK I   +VP   F ++ +   N      +         F  +Q +EG+DP++ESLFC   IVE++G RLRL F GY +++DFWT  DS  +FP GWC +N R+LQ PK Y++     F W  +LTK    A     F +  +  +++   + F +G KLEAVDKRN G+ CVATVKD IG+ IL+HFD WDS +D WAH +S LL PVGYCE+ E VLSIPS +    + F+W  YLK TNS+ VP   FE+R    Q    L VG RCE +DKRCPQLIRVA+I     +  +TIG+D W+EKYN  + L +S  ++ P G+C   G  LQPPP +++                    + ++ ACP  GCKGYGHVKGPRYS HQR SGCPYA+ NL KD  +  +R+  S I S    S +VP     E    +  + P+
Sbjct:    1 SGSFDWPSYLKEIGASSVPTSHFIHVPLEIRNDCISPRLGTNTPLTSSFKCDQCMEGIDPHHESLFCAFKIVEVVGRRLRLRFLGYPEKYDFWTTVDSPFLFPVGWCAHNKRRLQPPKGYSDREQLTFDWDAFLTKEGYTAVPRHLFRVSWDCPTNELPPHMFRVGHKLEAVDKRNPGIACVATVKDNIGDYILIHFDGWDSGFDQWAHITSELLHPVGYCEEKELVLSIPSEWSTRPTGFTWKQYLKETNSKPVPKEAFEKRPKSRQSSDQLQVGQRCEAVDKRCPQLIRVANIVANTPQGFLTIGYDGWAEKYN--VCLEASSPDLFPAGYCQATGHPLQPPPGYESDNDMNSVHDGHSNSSTSSINTAQTGACPTVGCKGYGHVKGPRYSYHQRVSGCPYADANLKKDVIRPHERLASSNIASPVPDSTSVPQMPRLEQAALSFNNTPV 450          
BLAST of Malignant brain tumor-like protein vs. TrEMBL
Match: A0A4S2LKJ7 (SAM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006514 PE=4 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 2.224e-114
Identity = 204/471 (43.31%), Postives = 274/471 (58.17%), Query Frame = 2
Query:  455 SSYGRKRKRRIIDGEVVGFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSN------IDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTN---FPFSWPVYLTKTKSEAAHESCFFIVKNPISDK---NNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEER---NQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDA--------------------SIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKD-FKTIDRIPLSIIQSLDESSATVP 1759
            S+ GR RK+R  + +V     + +  +    T   +S SFDW  YLK     +VP   F ++ +   N      +         F  +Q +EG+DP++ESLFC   IVE++G RLRL F GY +++DFWT  DS  +FP GWC +N R+LQ PK Y++     F W  +LTK    A     F +  +  +++   + F +G KLEAVDKRN G+ CVATVKD IG+ IL+HFD WDS +D WAH +S LL PVGYCE+ E VLSIPS +    + F+W  YLK TNS+ VP   FE+R    Q    L VG RCE +DKRCPQLIRVA+I     +  +TIG+D W+EKYN  + L +S  ++ P G+C   G  LQPPP +++                    + ++ ACP  GCKGYGHVKGPRYS HQR SGCPYA+ NL +D  +  +R+  S I S    S +VP
Sbjct:   21 STVGRPRKQRNPESDVTDIPIQPKERQSVIPTPIIRSGSFDWPSYLKESGASSVPTSHFIHVPLEIQNDCISPRLGANTPLTSSFKCDQCMEGIDPHHESLFCAFKIVEVVGRRLRLRFLGYPEKYDFWTTVDSPFLFPVGWCAHNKRRLQPPKGYSDREQLTFDWDAFLTKEGYTAVPRHLFRVSWDCPTNELPPHMFRVGHKLEAVDKRNPGIACVATVKDNIGDYILIHFDGWDSGFDQWAHITSELLHPVGYCEEKELVLSIPSEWSTRPTGFTWKQYLKETNSKPVPKEAFEKRPKSRQSSDQLQVGQRCEAVDKRCPQLIRVANIVANTPQGFLTIGYDGWAEKYN--VCLEASSPDLFPAGYCQATGHPLQPPPGYESDNDMNSVHDGHSNSSTSSVNTAQAGACPTVGCKGYGHVKGPRYSYHQRVSGCPYADANLKRDVIRPHERLASSNIASPVPDSTSVP 489          

HSP 2 Score: 83.5741 bits (205), Expect = 1.793e-12
Identity = 35/74 (47.30%), Postives = 49/74 (66.22%), Query Frame = 2
Query: 2408 WNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKETKLSEF 2629
            WN   V   I ++ G  Q++  F E E+DGAA +CL+Q DLM++LGMKLGPA+KV+  IQ L++    T +SE 
Sbjct: 1060 WNVDMVGSFIGTLPGCKQFAPKFTENEIDGAALLCLEQHDLMQILGMKLGPAVKVAGAIQTLRRSLMATPISEL 1133          
BLAST of Malignant brain tumor-like protein vs. TrEMBL
Match: A0A4S2LKQ7 (SAM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006514 PE=4 SV=1)

HSP 1 Score: 388.652 bits (997), Expect = 4.075e-114
Identity = 204/471 (43.31%), Postives = 274/471 (58.17%), Query Frame = 2
Query:  455 SSYGRKRKRRIIDGEVVGFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSN------IDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTN---FPFSWPVYLTKTKSEAAHESCFFIVKNPISDK---NNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEER---NQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDA--------------------SIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKD-FKTIDRIPLSIIQSLDESSATVP 1759
            S+ GR RK+R  + +V     + +  +    T   +S SFDW  YLK     +VP   F ++ +   N      +         F  +Q +EG+DP++ESLFC   IVE++G RLRL F GY +++DFWT  DS  +FP GWC +N R+LQ PK Y++     F W  +LTK    A     F +  +  +++   + F +G KLEAVDKRN G+ CVATVKD IG+ IL+HFD WDS +D WAH +S LL PVGYCE+ E VLSIPS +    + F+W  YLK TNS+ VP   FE+R    Q    L VG RCE +DKRCPQLIRVA+I     +  +TIG+D W+EKYN  + L +S  ++ P G+C   G  LQPPP +++                    + ++ ACP  GCKGYGHVKGPRYS HQR SGCPYA+ NL +D  +  +R+  S I S    S +VP
Sbjct:   89 STVGRPRKQRNPESDVTDIPIQPKERQSVIPTPIIRSGSFDWPSYLKESGASSVPTSHFIHVPLEIQNDCISPRLGANTPLTSSFKCDQCMEGIDPHHESLFCAFKIVEVVGRRLRLRFLGYPEKYDFWTTVDSPFLFPVGWCAHNKRRLQPPKGYSDREQLTFDWDAFLTKEGYTAVPRHLFRVSWDCPTNELPPHMFRVGHKLEAVDKRNPGIACVATVKDNIGDYILIHFDGWDSGFDQWAHITSELLHPVGYCEEKELVLSIPSEWSTRPTGFTWKQYLKETNSKPVPKEAFEKRPKSRQSSDQLQVGQRCEAVDKRCPQLIRVANIVANTPQGFLTIGYDGWAEKYN--VCLEASSPDLFPAGYCQATGHPLQPPPGYESDNDMNSVHDGHSNSSTSSVNTAQAGACPTVGCKGYGHVKGPRYSYHQRVSGCPYADANLKRDVIRPHERLASSNIASPVPDSTSVP 557          

HSP 2 Score: 83.5741 bits (205), Expect = 1.912e-12
Identity = 35/74 (47.30%), Postives = 49/74 (66.22%), Query Frame = 2
Query: 2408 WNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKETKLSEF 2629
            WN   V   I ++ G  Q++  F E E+DGAA +CL+Q DLM++LGMKLGPA+KV+  IQ L++    T +SE 
Sbjct: 1128 WNVDMVGSFIGTLPGCKQFAPKFTENEIDGAALLCLEQHDLMQILGMKLGPAVKVAGAIQTLRRSLMATPISEL 1201          
BLAST of Malignant brain tumor-like protein vs. TrEMBL
Match: A0A4S2LKK1 (SAM domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006514 PE=4 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 4.610e-114
Identity = 204/471 (43.31%), Postives = 274/471 (58.17%), Query Frame = 2
Query:  455 SSYGRKRKRRIIDGEVVGFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSN------IDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTN---FPFSWPVYLTKTKSEAAHESCFFIVKNPISDK---NNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEER---NQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDA--------------------SIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKD-FKTIDRIPLSIIQSLDESSATVP 1759
            S+ GR RK+R  + +V     + +  +    T   +S SFDW  YLK     +VP   F ++ +   N      +         F  +Q +EG+DP++ESLFC   IVE++G RLRL F GY +++DFWT  DS  +FP GWC +N R+LQ PK Y++     F W  +LTK    A     F +  +  +++   + F +G KLEAVDKRN G+ CVATVKD IG+ IL+HFD WDS +D WAH +S LL PVGYCE+ E VLSIPS +    + F+W  YLK TNS+ VP   FE+R    Q    L VG RCE +DKRCPQLIRVA+I     +  +TIG+D W+EKYN  + L +S  ++ P G+C   G  LQPPP +++                    + ++ ACP  GCKGYGHVKGPRYS HQR SGCPYA+ NL +D  +  +R+  S I S    S +VP
Sbjct:   68 STVGRPRKQRNPESDVTDIPIQPKERQSVIPTPIIRSGSFDWPSYLKESGASSVPTSHFIHVPLEIQNDCISPRLGANTPLTSSFKCDQCMEGIDPHHESLFCAFKIVEVVGRRLRLRFLGYPEKYDFWTTVDSPFLFPVGWCAHNKRRLQPPKGYSDREQLTFDWDAFLTKEGYTAVPRHLFRVSWDCPTNELPPHMFRVGHKLEAVDKRNPGIACVATVKDNIGDYILIHFDGWDSGFDQWAHITSELLHPVGYCEEKELVLSIPSEWSTRPTGFTWKQYLKETNSKPVPKEAFEKRPKSRQSSDQLQVGQRCEAVDKRCPQLIRVANIVANTPQGFLTIGYDGWAEKYN--VCLEASSPDLFPAGYCQATGHPLQPPPGYESDNDMNSVHDGHSNSSTSSVNTAQAGACPTVGCKGYGHVKGPRYSYHQRVSGCPYADANLKRDVIRPHERLASSNIASPVPDSTSVP 536          

HSP 2 Score: 83.5741 bits (205), Expect = 1.852e-12
Identity = 35/74 (47.30%), Postives = 49/74 (66.22%), Query Frame = 2
Query: 2408 WNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKETKLSEF 2629
            WN   V   I ++ G  Q++  F E E+DGAA +CL+Q DLM++LGMKLGPA+KV+  IQ L++    T +SE 
Sbjct: 1107 WNVDMVGSFIGTLPGCKQFAPKFTENEIDGAALLCLEQHDLMQILGMKLGPAVKVAGAIQTLRRSLMATPISEL 1180          
BLAST of Malignant brain tumor-like protein vs. Ensembl Cavefish
Match: l3mbtl1b (L3MBTL histone methyl-lysine binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-100922-38])

HSP 1 Score: 305.449 bits (781), Expect = 8.631e-91
Identity = 170/437 (38.90%), Postives = 242/437 (55.38%), Query Frame = 2
Query:  512 SSKTRRE-KLER--ETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRI----PLSI--------IQSLDESSATVPINNSTE 1777
            +SK R+  K+ R   TA  K  ++ W  YL+       P KLF               S+  F V  KLEG+DP + +LFCVLT+ E+ G R+RLHFDGY + +DFW  +DS  + P GWCE    KL  PK   +  F+W  Y+   + + A +  F  +   ++  + F  G KLEAVD++N  +ICVAT+  ++   +L+HFD+WD +YD W   SSP + PVG+CED E  L+ P+ Y     SFSW+ YL+ T S++ P   F++R    F   VGM+ E +DKR P LIRV+ I+ L E+F+V I FD W+E+Y+Y  D  S   ++ P+GWC       +PP     +     CP  GC G GH+KGPRY  H     CPY+E NLNK+    DR+    P+++         +SL+++ A  P  NS E
Sbjct:  202 TSKGRKAAKIARLVTTAPVKKKAWSWPAYLEEEKAVAAPLKLF-------KEHQSFPQSRNMFKVGMKLEGLDPCHPALFCVLTVAEVQGYRIRLHFDGYPECYDFWVNADSWDVKPPGWCEKMGLKLLLPKGCRDGEFNWNTYVKNCRGQLAPKHLFKSLNTSVT-PSGFRAGMKLEAVDRKNPSLICVATISAVVDNRLLIHFDNWDDTYDYWCDASSPYIHPVGFCEDTELTLTTPAEYKQP-KSFSWEKYLEETGSQAAPARAFKQRPPHGF--QVGMKLESVDKRNPMLIRVSTISDL-EDFRVKIHFDGWTEEYDYWADADSP--DLHPVGWCSS-----EPP-----APPGQGCPTPGCNGVGHIKGPRYGTHYTAVSCPYSELNLNKEGLVPDRLSGERPVTLSGPPRHRRTESLNQTPAHTPTGNSLE 614          

HSP 2 Score: 62.3882 bits (150), Expect = 1.799e-9
Identity = 26/73 (35.62%), Postives = 48/73 (65.75%), Query Frame = 2
Query: 2393 KSILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKE 2611
            K++  WN++EV+  +  + G  +++  F  +++DG AF+ L Q D++K+L +KLGPA+K+ + I  LK   +E
Sbjct:  687 KTVAKWNTEEVATFVRKLPGCREHATIFRNEQIDGEAFLLLTQSDIVKILSIKLGPALKIYNCILMLKSADEE 759          
BLAST of Malignant brain tumor-like protein vs. Ensembl Cavefish
Match: L3MBTL4 (L3MBTL histone methyl-lysine binding protein 4 [Source:HGNC Symbol;Acc:HGNC:26677])

HSP 1 Score: 276.944 bits (707), Expect = 1.692e-83
Identity = 143/352 (40.62%), Postives = 210/352 (59.66%), Query Frame = 2
Query:  674 NSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFI--IGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGH-DLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP--PT-FDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRI 1711
            N+K  F V  +LEG+DP + S+FCVL++ E++G RLRL  D Y + +DFW  +DS  I P GWCE+   KL  PK Y    F W  YL    ++AA ++  F  +N +S  +     +G KLEAVD++N  ++CVATV DI     LVHFD+WD +YD W   +SP + PVG+C+D+ + L+ P   GH +   F W+ YL+  ++ +VP+  F  R    F   VGMR E +D+R P LIRVA I    E+++V + FD W  K+++ +D  S   ++ P+GWC + G  L+PP  P+   + +    CP  GCKG GH+KG +Y+ H    GCPY++ N+ K+    DR+
Sbjct:   51 NNKSGFRVGMRLEGIDPLHPSMFCVLSVAEVIGCRLRLRIDSYAECYDFWVNADSPDIRPVGWCESTGHKLHPPKGYKINEFDWEKYLEACNAQAAPKN-LFKSQNSVSVPSGAESDVGMKLEAVDRKNPCLVCVATVADIADNRFLVHFDNWDDTYDYWCDATSPHIHPVGWCQDHGRPLTAPQ--GHPNPEHFVWEEYLEDNSASAVPSQAFCMRAPHGF--QVGMRLEAVDRRNPMLIRVATIVD-TEDYRVKVHFDGWHTKFDFWVD--SDLPDLHPVGWCGRTGHPLEPPLRPSDLKSPVTQGVCPTPGCKGVGHIKGAKYTGHHSAFGCPYSDINMKKEVVLPDRL 394          

HSP 2 Score: 135.576 bits (340), Expect = 1.894e-33
Identity = 76/211 (36.02%), Postives = 112/211 (53.08%), Query Frame = 2
Query:  560 KSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFP-FSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYC 1189
            K + FDW +YL++ + +  P  LF       S   +   S  +  V  KLE VD  N  L CV T+ +I  +R  +HFD + D +D+W  + S  I P GWC+++ R L +P+ + N   F W  YL +  S +A  S  F ++ P    + F +G +LEAVD+RN  +I VAT+ D     + VHFD W + +D W     P L PVG+C
Sbjct:  128 KINEFDWEKYLEACNAQAAPKNLFK------SQNSVSVPSGAESDVGMKLEAVDRKNPCLVCVATVADIADNRFLVHFDNWDDTYDYWCDATSPHIHPVGWCQDHGRPLTAPQGHPNPEHFVWEEYL-EDNSASAVPSQAFCMRAP----HGFQVGMRLEAVDRRNPMLIRVATIVDTEDYRVKVHFDGWHTKFDFWVDSDLPDLHPVGWC 327          
BLAST of Malignant brain tumor-like protein vs. Ensembl Cavefish
Match: l3mbtl1a (lethal(3)malignant brain tumor-like protein 1 [Source:NCBI gene;Acc:103027483])

HSP 1 Score: 266.929 bits (681), Expect = 3.588e-76
Identity = 155/407 (38.08%), Postives = 209/407 (51.35%), Query Frame = 2
Query:  572 FDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKN-NFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPP----------------------------------TFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNK 1687
            + W++YL+       P KLF       S    E  S ++  +  KLEG+DP + S++ VLT+ E+ G RLRLHFDGY D  DFW  ++   I P GWCE+   KL +PK Y    FSW  YL  TK++AA +  F    +  +DK+  F +G KLEAVD+ N  +ICVATV D++G   LVHFD+WD +YD W    SP + PVG+C++    L+ P  Y  D   FSW+ YL+ T S +VP   F+ R    F   V M+ E +DKR P LIR A + +++   ++ I FD WS  Y+   D  S   +I P+GWC   G   +PPP                                  T   S     CP  GC G GHV G R++ H   SGCP AE N  +
Sbjct:  280 WSWAQYLEEQKAVAAPPKLFQE-----SQRVPECLSSFRQGM--KLEGIDPQHPSMYFVLTVAEVCGYRLRLHFDGYSDCHDFWVNANCSDIHPPGWCESTGHKLYTPKGYKEEEFSWASYLKLTKAQAAPKELF--TSSAKTDKDCGFEVGMKLEAVDRMNPSLICVATVTDLVGNRFLVHFDNWDDTYDYWCDARSPYIHPVGWCQERGLPLTPPQDYP-DPGKFSWERYLEETGSTAVPAEAFKVRPPHSF--QVNMKLEAVDKRSPGLIRAATVQEVDTH-RIKIHFDGWSHVYDEWTD--SDNPDIHPVGWCESTGHPFKPPPDPSSTQQHGPKENTDFGQPSYTSAPFKTVPHSRNTSKYSFHHRKCPTPGCDGSGHVTG-RFTAHHCISGCPLAERNQGR 670          

HSP 2 Score: 121.709 bits (304), Expect = 8.529e-28
Identity = 71/214 (33.18%), Postives = 109/214 (50.93%), Query Frame = 2
Query:  914 PFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFD--LDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP 1549
            P+SW  YL + K+ AA    F   +      ++F  G KLE +D ++  M  V TV ++ G  + +HFD +   +D W + +   + P G+CE     L  P  Y  +   FSW SYLKLT +++ P  +F    +   D   +VGM+ E +D+  P LI VA +  L    +  + FD+W + Y+Y  D  S +  I P+GWC + G  L PP
Sbjct:  279 PWSWAQYLEEQKAVAAPPKLFQESQRVPECLSSFRQGMKLEGIDPQHPSMYFVLTVAEVCGYRLRLHFDGYSDCHDFWVNANCSDIHPPGWCESTGHKLYTPKGYKEE--EFSWASYLKLTKAQAAPKELFTSSAKTDKDCGFEVGMKLEAVDRMNPSLICVATVTDLVGN-RFLVHFDNWDDTYDYWCDARSPY--IHPVGWCQERGLPLTPP 487          

HSP 3 Score: 56.225 bits (134), Expect = 1.610e-7
Identity = 22/66 (33.33%), Postives = 44/66 (66.67%), Query Frame = 2
Query: 2399 ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLK 2596
            +  W+ +EV   + ++IG ++ ++ F ++ +DG AF+ L Q D++K++ +KLGPA+K+ + I   K
Sbjct:  762 VATWSVEEVFGFVQNLIGCEEQAQLFKDEMIDGEAFLLLTQTDIVKIMSIKLGPALKIYNAILMFK 827          
BLAST of Malignant brain tumor-like protein vs. Ensembl Cavefish
Match: l3mbtl3 (L3MBTL histone methyl-lysine binding protein 3 [Source:ZFIN;Acc:ZDB-GENE-040724-127])

HSP 1 Score: 253.832 bits (647), Expect = 1.418e-74
Identity = 138/335 (41.19%), Postives = 188/335 (56.12%), Query Frame = 2
Query:  557 SKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNS----KYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP 1549
             K  S+ W+ YL+       P KLF            EY S    K  F V  +LEG+DP + S++CVL+I E+ G R+RLHFD Y + +DFW  ++S  I P GWCE    KLQ PK   +  FSW  YL   K +AA ++  F  +N +     F IG KLEAVDK+N   ICVATV D++    LVHFD WD SYD W   +SP + PVG+C++  K L+ P  +  D +SFSW+ YL+ T S   P   F+ +        V M+ E +DKR P L+RVA +    ++ ++ I FD W+++Y+Y +D  S   +I P GWC K G  LQPP
Sbjct:  148 GKKKSWCWASYLEQEKAIAAPNKLFK-----------EYQSFPQCKNGFRVGMRLEGIDPEHPSMYCVLSISEVSGHRIRLHFDKYSECYDFWVNANSPDIHPIGWCEKTGHKLQPPKGIKSEAFSWCSYLKMNKIQAAPKA-LFDSQNTMVTPLGFRIGMKLEAVDKKNPSFICVATVTDLVESRFLVHFDDWDESYDYWCDATSPYIHPVGWCQENGKTLTTPPGFP-DTTSFSWEKYLEETGSLPAPARAFKAKPP--HSFQVNMKLEAVDKRNPMLVRVASVVD-TDDHRIKIHFDGWTDEYDYWVDADSP--DIHPAGWCAKTGHPLQPP 464          

HSP 2 Score: 138.272 bits (347), Expect = 3.602e-34
Identity = 76/216 (35.19%), Postives = 115/216 (53.24%), Query Frame = 2
Query:  917 FSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLD--VGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTF 1558
            + W  YL + K+ AA    F   ++    KN F +G +LE +D  +  M CV ++ ++ G  I +HFD +   YD W + +SP + P+G+CE     L  P   G    +FSW SYLK+   ++ P ++F+ +N     L   +GM+ E +DK+ P  I VA +  L E  +  + FDDW E Y+Y  D  S +  I P+GWC +NG  L  PP F
Sbjct:  153 WCWASYLEQEKAIAAPNKLFKEYQSFPQCKNGFRVGMRLEGIDPEHPSMYCVLSISEVSGHRIRLHFDKYSECYDFWVNANSPDIHPIGWCEKTGHKLQPPK--GIKSEAFSWCSYLKMNKIQAAPKALFDSQNTMVTPLGFRIGMKLEAVDKKNPSFICVATVTDLVES-RFLVHFDDWDESYDYWCDATSPY--IHPVGWCQENGKTLTTPPGF 363          
BLAST of Malignant brain tumor-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000001859.2 (Scm polycomb group protein like 2 [Source:NCBI gene;Acc:103028396])

HSP 1 Score: 153.68 bits (387), Expect = 3.289e-38
Identity = 88/241 (36.51%), Postives = 115/241 (47.72%), Query Frame = 2
Query:  521 TRREKLERETAKSKS-------SSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPI-SDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIP 1219
            +R+EK  R T  S          +F W EYLK       PA  F    I  SN          F    KLE  DP N +  C+ T++ + G RLRL  DG  +  DFW L DS  I P G CE N   LQ P  +     SWP++L +T + A         K P+   +N F  G KLEAVDK+N  +IC ATV ++ G+ + V FD W  ++D W  Y S  + PVG+C   +  L  P
Sbjct:   15 SRKEKAGRSTPVSAGPAPVKVPEAFSWEEYLKETSSTPAPASCFKQSRIPPSN---------DFKAGMKLEARDPRNSTSVCIATVMGMTGIRLRLRLDGSDNTNDFWRLVDSADIQPIGTCEKNGDMLQPPLGFRMNASSWPMFLLRTLNGAEMAPGSAFKKEPLRPSQNGFKPGMKLEAVDKKNPYLICPATVGEVKGDEVFVMFDGWRGAFDYWCRYDSRDIFPVGWCTVTKHSLQPP 246          

HSP 2 Score: 115.161 bits (287), Expect = 7.523e-26
Identity = 75/217 (34.56%), Postives = 109/217 (50.23%), Query Frame = 2
Query:  917 FSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYL--KLTNSESVPNSIFEER----NQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP 1549
            FSW  YL +T S  A  SCF   + P S  N+F  G KLEA D RNS  +C+ATV  + G  + +  D  D++ D W    S  + P+G CE    +L  P   G  +++ SW  +L   L  +E  P S F++     +Q  F    GM+ E +DK+ P LI  A + ++  + +V + FD W   ++Y     S   +I P+GWC      LQPP
Sbjct:   39 FSWEEYLKETSSTPAPASCFKQSRIPPS--NDFKAGMKLEARDPRNSTSVCIATVMGMTGIRLRLRLDGSDNTNDFWRLVDSADIQPIGTCEKNGDMLQPP--LGFRMNASSWPMFLLRTLNGAEMAPGSAFKKEPLRPSQNGF--KPGMKLEAVDKKNPYLICPATVGEVKGD-EVFVMFDGWRGAFDYWCRYDSR--DIFPVGWCTVTKHSLQPP 246          
BLAST of Malignant brain tumor-like protein vs. Ensembl Sea Lamprey
Match: l3mbtl1b (L3MBTL histone methyl-lysine binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-100922-38])

HSP 1 Score: 302.368 bits (773), Expect = 1.778e-90
Identity = 157/395 (39.75%), Postives = 222/395 (56.20%), Query Frame = 2
Query:  542 RETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP-PTFDASIESSA--CPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPL 1717
            ++ AKS+   + W  Y+K+      P KLF               S   F V  +LEG DP + SL CVL++ E+LG RLRLHFDGY + +DFW  ++S  I PAGWC     +L  PK Y+   FSWP YL   K++AA +  F     P +  ++F  G KLEAVD++N  ++CVA+V D      LVHFD+WD +YD W   +SP + PVG+C+  +  L+ P  +  D   FSW+ YL+   ++ VP  +F+ R    F   +GM+ EV+D+R P LIR A +A   ++  + + FD W   Y+Y ++  S   +I P+GWC + G  LQPP  T D S+      CP  GC G GH++G +YS H    GCPY+E NL KD+   DR+ L
Sbjct:  190 QQLAKSRKEDWSWDTYIKAEQAIAAPLKLFTEYCSVREQCQTFPTSSNGFQVGMRLEGADPQHPSLHCVLSVTEVLGYRLRLHFDGYLENYDFWVNANSLEIHPAGWCNTTGHRLLPPKGYSEEEFSWPAYLKVCKAQAAPKHLFKGQSRPAT-THSFEEGAKLEAVDRKNPSLVCVASVADHADSRFLVHFDNWDDTYDYWCDATSPYIHPVGWCQRNDVPLTPPLGHPED-REFSWEIYLEEMGADPVPARVFKPRPPHGF--RIGMKIEVVDRRNPVLIRAASVAA-TDDHHIKVRFDGWKALYDYWLEADSP--DIHPVGWCSRTGHPLQPPIGTKDVSVLPGPNDCPTPGCTGVGHIRGAKYSGHHSAFGCPYSEMNLTKDWANPDRLGL 577          

HSP 2 Score: 62.003 bits (149), Expect = 4.954e-10
Identity = 27/71 (38.03%), Postives = 46/71 (64.79%), Query Frame = 2
Query: 2408 WNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKETKL 2620
            W   EV++ IS++ G D+ +K F  +++DG AF+ L Q DL+K++ +KLGPA+K+ + I   +     T+L
Sbjct:  686 WGVDEVAKFISALPGCDEQAKFFQNEQIDGPAFLLLTQCDLVKIMAIKLGPALKIYNSILMFQNADSRTEL 756          
BLAST of Malignant brain tumor-like protein vs. Ensembl Sea Lamprey
Match: l3mbtl1b (L3MBTL histone methyl-lysine binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-100922-38])

HSP 1 Score: 264.233 bits (674), Expect = 1.204e-78
Identity = 137/349 (39.26%), Postives = 196/349 (56.16%), Query Frame = 2
Query:  506 GFSSKTRREKLERETAKS-KSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP 1549
            G   K RR ++    A + K  ++ W  YL+   G   P +LF               S+  F V  +LEG+DP + SL CVL++ E+ G R+RLHFDGY + +DFW  +DS  I P GWCE  N KLQ PK +    F+WP YL   K++AA     F  +N       F +G KLEAVDK+N  ++CVAT+ D++    LVHFD+WD SYD W   SSP + PVG+C+++ + L+ P  Y  +   FSW+ YL+   +++ P   F++R         GMR E +D+R P L+ VA IA  ++  ++ + FD WS +YNY +D  +   +I P+GWC K G  LQ P
Sbjct:  185 GHVGKRRRLRVPVAAASTTKKRAWTWMLYLEEDKGVAAPVRLF-------RESQSFPQSRNGFKVGMRLEGIDPKHPSLVCVLSVAEVCGYRVRLHFDGYSECYDFWVNADSPDIHPVGWCEKTNHKLQPPKGHKEEEFAWPAYLKTVKAQAAPRQ-LFKNQNTTVTPMGFRVGMKLEAVDKKNPALVCVATITDVVDSRFLVHFDTWDDSYDYWCDSSSPYIHPVGWCQEHGRPLTPPQNYS-EGKKFSWEKYLEENGAQAAPARAFKQRPT--HGFQPGMRLEAVDRRNPTLVCVATIANCDDH-RIKVHFDGWSPEYNYWLD--ADCPDIHPVGWCEKTGHPLQLP 519          

HSP 2 Score: 132.88 bits (333), Expect = 9.100e-33
Identity = 69/216 (31.94%), Postives = 115/216 (53.24%), Query Frame = 2
Query:  917 FSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWW--FDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTF 1558
            ++W +YL + K  AA    F   ++    +N F +G +LE +D ++  ++CV +V ++ G  + +HFD +   YD W +  SP + PVG+CE     L  P   GH    F+W +YLK   +++ P  +F+ +N         VGM+ E +DK+ P L+ VA I  + +  +  + FD W + Y+Y  D  S +  I P+GWC ++G  L PP  +
Sbjct:  208 WTWMLYLEEDKGVAAPVRLFRESQSFPQSRNGFKVGMRLEGIDPKHPSLVCVLSVAEVCGYRVRLHFDGYSECYDFWVNADSPDIHPVGWCEKTNHKLQPPK--GHKEEEFAWPAYLKTVKAQAAPRQLFKNQNTTVTPMGFRVGMKLEAVDKKNPALVCVATITDVVDS-RFLVHFDTWDDSYDYWCDSSSPY--IHPVGWCQEHGRPLTPPQNY 418          
BLAST of Malignant brain tumor-like protein vs. Ensembl Sea Lamprey
Match: l3mbtl1b (L3MBTL histone methyl-lysine binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-100922-38])

HSP 1 Score: 150.214 bits (378), Expect = 1.539e-41
Identity = 75/179 (41.90%), Postives = 110/179 (61.45%), Query Frame = 2
Query: 1013 FIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP 1549
            F +G KLEAVDK+N  ++CVAT+ D++    LVHFD+WD SYD W   SSP + PVG+C+++ + L+ P  Y      FSW+ YL+   +++ P   F++R    F    GMR E +D+R P L+ VA IA  ++  ++ + FD WS +YNY +D  +   +I P+GWC K G  LQ P
Sbjct:   31 FRVGMKLEAVDKKNPALVCVATITDVVDSRFLVHFDTWDDSYDYWCDSSSPYIHPVGWCQEHGRPLTPPQNYSEG-KKFSWEKYLEENGAQAAPARAFKQRPTHGF--QPGMRLEAVDRRNPTLVCVATIANCDDH-RIKVHFDGWSPEYNYWLD--ADCPDIHPVGWCEKTGHPLQLP 203          

HSP 2 Score: 135.576 bits (340), Expect = 1.775e-36
Identity = 70/178 (39.33%), Postives = 98/178 (55.06%), Query Frame = 2
Query:  689 FSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTN-FPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIP 1219
            F V  KLE VD  N +L CV TI +++ SR  +HFD + D +D+W  S S  I P GWC+ + R L  P++Y+    FSW  YL +  ++AA    F   + P    + F  G +LEAVD+RN  ++CVAT+ +     I VHFD W   Y+ W     P + PVG+CE     L +P
Sbjct:   31 FRVGMKLEAVDKKNPALVCVATITDVVDSRFLVHFDTWDDSYDYWCDSSSPYIHPVGWCQEHGRPLTPPQNYSEGKKFSWEKYLEENGAQAAPARAF--KQRP---THGFQPGMRLEAVDRRNPTLVCVATIANCDDHRIKVHFDGWSPEYNYWLDADCPDIHPVGWCEKTGHPLQLP 203          

HSP 3 Score: 70.8626 bits (172), Expect = 4.112e-14
Identity = 37/118 (31.36%), Postives = 56/118 (47.46%), Query Frame = 2
Query:  557 SKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSP-KDYT 907
            S+   F W +YL+    +  PA+ F            +    + F    +LE VD  N +L CV TI      R+++HFDG+  ++++W  +D   I P GWCE     LQ P  +YT
Sbjct:  103 SEGKKFSWEKYLEENGAQAAPARAF------------KQRPTHGFQPGMRLEAVDRRNPTLVCVATIANCDDHRIKVHFDGWSPEYNYWLDADCPDIHPVGWCEKTGHPLQLPVSEYT 208          

HSP 4 Score: 52.7582 bits (125), Expect = 6.858e-8
Identity = 27/73 (36.99%), Postives = 42/73 (57.53%), Query Frame = 2
Query: 1340 VGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTF 1558
            VGM+ E +DK+ P L+ VA I  + +  +  + FD W + Y+Y  D  S +  I P+GWC ++G  L PP  +
Sbjct:   33 VGMKLEAVDKKNPALVCVATITDVVDS-RFLVHFDTWDDSYDYWCDSSSPY--IHPVGWCQEHGRPLTPPQNY 102          
BLAST of Malignant brain tumor-like protein vs. Ensembl Sea Lamprey
Match: mbtd1 (mbt domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-060810-138])

HSP 1 Score: 133.265 bits (334), Expect = 1.560e-32
Identity = 96/296 (32.43%), Postives = 142/296 (47.97%), Query Frame = 2
Query:  683 YKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHF-DGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILV----HFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIF--EERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP 1549
            + F    +LE VD    S   V  +  ++G RLRL + DG   + DFW    S LI P GW      + +SP+                 S  A    F IVK     +  F  G KLEA+D  N   ICVATV+ ++G+  L+      ++ D +     H  SP + PVG+CE  +  L+ P   G++ + F+W  YL+ T+S + P S+F  E  N       VGM+ E +D   P+LI VA + ++     + I FD W ++Y+  +D  S   ++ P+GWC   G  LQPP
Sbjct:  287 FPFKRGMRLEVVDKAQISRTRVALVDSVIGGRLRLAYRDGAGTEDDFWCHMRSPLIHPIGWSRAVGHQHKSPEGAKKH----------DGSSDAGSYLFPIVKEMPQKQECFREGMKLEAIDPLNLSSICVATVRKVLGDGFLMIGIDGSEAADGTDWFCYHSMSPSIFPVGFCEINQIELASPR--GYNKTPFNWFEYLRETSSPAAPVSLFNKEIPNH---GFRVGMKLEAVDLMEPRLICVATVVRIVNRL-LRIHFDGWEDEYDQWVDCQSP--DLFPVGWCELTGYQLQPP 564          

HSP 2 Score: 80.8777 bits (198), Expect = 6.385e-16
Identity = 40/110 (36.36%), Postives = 55/110 (50.00%), Query Frame = 2
Query:  566 SSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSP 895
            + F+W EYL+       P  LF+           +    + F V  KLE VD     L CV T+V I+   LR+HFDG++D++D W    S  +FP GWCE    +LQ P
Sbjct:  466 TPFNWFEYLRETSSPAAPVSLFN-----------KEIPNHGFRVGMKLEAVDLMEPRLICVATVVRIVNRLLRIHFDGWEDEYDQWVDCQSPDLFPVGWCELTGYQLQPP 564          

HSP 3 Score: 80.1073 bits (196), Expect = 1.159e-15
Identity = 85/365 (23.29%), Postives = 146/365 (40.00%), Query Frame = 2
Query:  521 TRREKLERETAKSKSSSFDWSEYL--KSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPN---NESLFCVLTIVEILGSRLRLHFDGYQD--QFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENI-LVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIP-SAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSW-------TNILPIGWCVKNGCVLQPPPTFDAS 1567
            T + + +R++ K+ S  F+W  Y+   S+   +V       +   + +I          +   ++E V+ +   +  +F +  ++++ G +  L ++GY+     DFW    +  + P GWC    + L  P+   +   +W  +L K  + +      F  K   S    F  G +LE VDK       VA V  +IG  + L + D   +  D W H  SPL+ P+G+          P  A  HD SS +      +          F E          GM+ E ID      I VA + K+  +  + IG D  SE  +     G+ W        +I P+G+C  N   L  P  ++ +
Sbjct:  128 TLQSQAKRKSIKTPSDGFEWGRYIWKNSLTAASVGCFKHAPMADHWGDI----------TEGMRVEVVNTDCVVSSKVFWIAWVIKLAGYKGLLRYEGYESDSSRDFWCNLCTPDVHPIGWCATIGKPLVPPQTIMHRCSNWKAFLVKKLTGSKTLPPDFQAKVQESLSFPFKRGMRLEVVDKAQISRTRVALVDSVIGGRLRLAYRDGAGTEDDFWCHMRSPLIHPIGWSRAVGHQHKSPEGAKKHDGSSDAGSYLFPIVKEMPQKQECFRE----------GMKLEAIDPLNLSSICVATVRKVLGDGFLMIGIDG-SEAAD-----GTDWFCYHSMSPSIFPVGFCEINQIELASPRGYNKT 466          

HSP 4 Score: 62.3882 bits (150), Expect = 2.955e-10
Identity = 65/247 (26.32%), Postives = 108/247 (43.72%), Query Frame = 2
Query:  827 LSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDK-NNFIIGQKLEAVDKR---NSGMICVATVKDIIGENILVHFDSW--DSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYL--KLTNSESVPNSIFEERNQ--WWFDLDVGMRCEVIDKRCPQLIRVAHI-----AKLNEEFQVTIGFDD--WSEKYNYKIDLGSSWTNILPIGW 1516
            L+ S ++      +   + +++P D     F W  Y+ K    AA   CF     P++D   +   G ++E V+     +S +  +A V  + G   L+ ++ +  DSS D W +  +P + P+G+C    K L  P    H  S  +W ++L  KLT S+++P   F+ + Q    F    GMR EV+DK      RVA +      +L   ++   G +D  W    +  I          PIGW
Sbjct:  119 LTQSSMLQATLQSQAKRKSIKTPSDG----FEWGRYIWKNSLTAASVGCF--KHAPMADHWGDITEGMRVEVVNTDCVVSSKVFWIAWVIKLAGYKGLLRYEGYESDSSRDFWCNLCTPDVHPIGWCATIGKPLVPPQTIMHRCS--NWKAFLVKKLTGSKTLPPD-FQAKVQESLSFPFKRGMRLEVVDKAQISRTRVALVDSVIGGRLRLAYRDGAGTEDDFWCHMRSPLIH---------PIGW 347          
BLAST of Malignant brain tumor-like protein vs. Ensembl Sea Lamprey
Match: SFMBT1 (Scm like with four mbt domains 1 [Source:HGNC Symbol;Acc:HGNC:20255])

HSP 1 Score: 54.299 bits (129), Expect = 9.191e-8
Identity = 35/110 (31.82%), Postives = 49/110 (44.55%), Query Frame = 2
Query:  572 FDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQD-QFDFWTLSDSQLIFPAGWCENNNRKLQSPK 898
            FDW+EYLKS      P   F         +D     ++ F    +LE V+P   S  CV T+  +    + L  +G Q  Q D      S  IFP GW E+N   L++P+
Sbjct:  348 FDWAEYLKSSGAEAAPGSCFP--------MD---EPQHGFIQGMRLEVVNPLLPSELCVATVTHLRHHLMWLRLEGLQQPQPDCIVDVRSMDIFPVGWSESNGYPLRAPR 446          

HSP 2 Score: 51.2174 bits (121), Expect = 7.751e-7
Identity = 41/165 (24.85%), Postives = 62/165 (37.58%), Query Frame = 2
Query:  611 TVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGS-RLRLHFDGYQDQF----DFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDI 1090
             VP ++F  +           +  ++FS   KLE V P         T+ ++L      +  D    +           D     PA W   N      P  Y    F W  YL  + +EAA  SCF + +     ++ FI G +LE V+      +CVATV  +
Sbjct:  250 AVPPEIFKEVA---------ESRSHRFSQGMKLEAVHPTLPFSIAPATVTKVLSEWFFVVEMDTAGGEVAPLAPLVCSLDGPTALPAQWSLKNGVPCTPPPGYEGQDFDWAEYLKSSGAEAAPGSCFPMDE----PQHGFIQGMRLEVVNPLLPSELCVATVTHL 401          
BLAST of Malignant brain tumor-like protein vs. Ensembl Nematostella
Match: EDO39278 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAH5])

HSP 1 Score: 286.96 bits (733), Expect = 1.618e-87
Identity = 161/386 (41.71%), Postives = 224/386 (58.03%), Query Frame = 2
Query:  563 SSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSK--YKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPIS-DKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRI 1711
            S  F W++YL +   + VP   F     R  N D+E  +    +F  N KLE VDP + S  CV TIV + G+RLRLHFDG+ + +DFWT +DS  IFP GWC  N + L   +      F+W  YL K  + AA E  F     P+S  K+ F  G KLEA+D++N  +ICVATV ++IG   LVHFD WD +YD W     P + PVG+C      L+ P+    ++ SFSW+ +L+ T + + P  +F++R+   F      + E +DKR P LIR A IA++ E+++V++ FD W + Y+   D  S  T + P+G+C + G  L+PP T    I S ACP  GCKG GHVKG +YS+H  T GCPY+  NLNKD   +DR+
Sbjct:   19 SKPFTWADYLYTSGAKPVPVSTF-----RQENPDIEVFTMPCEEFKKNMKLEAVDPKHPSYICVCTIVRVKGARLRLHFDGWSECYDFWTNADSPFIFPVGWCAKNGQVLHPQRGVLPKDFNWEKYLKKQNATAAPEHLF----TPVSPTKHGFKTGMKLEAIDRKNPDLICVATVTNVIGNRFLVHFDEWDDTYDYWCEEDCPYIHPVGWCSANGGKLNPPN--DDEVDSFSWEEHLRTTGATAAPPELFKKRSLPAF--KPYQKLEAVDKRNPSLIRCATIARV-EDYRVSVHFDGWDDVYDDWYDADS--TELHPVGYCERTGHPLEPPLTTADKISSVACPTPGCKGIGHVKGAKYSSHHSTFGCPYSLQNLNKDSCLVDRL 388          
BLAST of Malignant brain tumor-like protein vs. Ensembl Nematostella
Match: EDO39310 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAH4])

HSP 1 Score: 283.108 bits (723), Expect = 2.667e-87
Identity = 159/389 (40.87%), Postives = 224/389 (57.58%), Query Frame = 2
Query:  563 SSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPIS-DKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP-----PTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRI 1711
            S  F W +YL++ + + VP  +F  + + F     E      F  + KLE VDP + S  CV TIV + G+RLRLHFDG+ + +DFWT +DS  I+P GWCE N + +  P+ ++   F+W  YLTK K+  A    F     P+S  K+ F  G KLEA+D++N  +ICVATV ++IG   LVHFD WD +YD W     P + PVG+C      L+ P+    ++ +F W+ YLK TNS + P  +F++R    F    G R E +DKR P LIR A + K+  E++V + FD W + Y+   D  S  T + P+ +C K G  L+ P      + +  I S+ACP  GCKG GHVKG +YS+H  T GCPY+  NLNKD   +DR+
Sbjct:    6 SKPFVWVDYLQACNAKAVPVSVFQQL-LMFPKPCTE------FKKDMKLEAVDPKHPSYICVCTIVRVKGARLRLHFDGWSESYDFWTNADSPFIYPVGWCEKNGQIISPPRGFSKSDFNWETYLTKMKALPAPSHLF----KPVSPTKHGFKTGMKLEAIDRKNPDLICVATVTNVIGNRFLVHFDEWDDTYDYWCEEDCPYIHPVGWCAANGGKLNPPN--DDEVDTFQWEEYLKKTNSLAAPPELFKKRFTPGF--KPGHRLEAVDKRNPSLIRAATVVKV-VEYRVFVHFDGWDDIYDDWYDADS--TEVHPVSYCEKTGHPLEAPLSEYKSSREDKISSAACPTPGCKGIGHVKGAKYSSHHSTFGCPYSLQNLNKDSCLVDRL 376          
BLAST of Malignant brain tumor-like protein vs. Ensembl Nematostella
Match: EDO41107 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5E0])

HSP 1 Score: 110.153 bits (274), Expect = 2.107e-27
Identity = 74/220 (33.64%), Postives = 103/220 (46.82%), Query Frame = 2
Query:  572 FDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFI-IGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAY 1228
            F+W +YL            F             YN    F V  KLE  DP      CV T+V +LGSR+R+ FDG     D W + DS  I P GWCE N   LQ P  + + P ++  +++K+ ++A         K P + + NF   G KLEA D +N  +ICVA+V D+ G+ I + FD +  S D WA + S  + P  +C      L  P  Y
Sbjct:    2 FNWDQYLARTRSEAAHWTFFRQTPA------PPYNG---FKVGMKLEVTDPRIVDTVCVGTVVGVLGSRIRVRFDGTDASNDVWHVVDSNEIHPCGWCEKNGGMLQPPMGFKSDPGNYHKFISKSLADAELAPGRLFKKEPPAPERNFFQKGMKLEATDPKNHALICVASVGDVQGDKIRIDFDGYLGS-DYWARFDSRSIFPARWCNFTGHPLQPPGRY 211          

HSP 2 Score: 91.2781 bits (225), Expect = 7.924e-21
Identity = 72/219 (32.88%), Postives = 102/219 (46.58%), Query Frame = 2
Query:  914 PFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFE------ERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDW-SEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP 1549
            PF+W  YL +T+SEAAH +  F  + P    N F +G KLE  D R    +CV TV  ++G  I V FD  D+S D+W    S  + P G+CE    +L  P  +  D  ++       L ++E  P  +F+      ERN        GM+ E  D +   LI VA +  +  + ++ I FD +    Y  + D  S    I P  WC   G  LQPP
Sbjct:    1 PFNWDQYLARTRSEAAHWT--FFRQTPAPPYNGFKVGMKLEVTDPRIVDTVCVGTVVGVLGSRIRVRFDGTDASNDVWHVVDSNEIHPCGWCEKNGGMLQPPMGFKSDPGNYHKFISKSLADAELAPGRLFKKEPPAPERNF----FQKGMKLEATDPKNHALICVASVGDVQGD-KIRIDFDGYLGSDYWARFDSRS----IFPARWCNFTGHPLQPP 208          
BLAST of Malignant brain tumor-like protein vs. Ensembl Nematostella
Match: EDO44413 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVM8])

HSP 1 Score: 108.612 bits (270), Expect = 1.078e-24
Identity = 64/181 (35.36%), Postives = 89/181 (49.17%), Query Frame = 2
Query:  683 YKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTL-SDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPS 1222
            ++F V  K E +DP + S   V+T++++L  R      G      ++   ++S+ IFP GW  + +  L  P+DY+   FSWP YL KT    A    F   +      N F IG KLEAVD R   ++C ATV D+ G  + +HFD WD SYD      S  + PV YC      L  P 
Sbjct:  333 HQFKVGMKFEAIDPFSPSHIVVVTVIKVL--RFNYFVLGVDSLATYFVCHANSRNIFPCGWARSQSLPLTPPRDYSPETFSWPEYLDKTGGIEAPVHLFKQERR----MNGFRIGMKLEAVDLREPALVCPATVTDVKGPLLRIHFDGWDDSYDQLVDMDSLDIFPVSYCVSVGHPLQPPG 507          

HSP 2 Score: 89.7373 bits (221), Expect = 1.174e-18
Identity = 90/334 (26.95%), Postives = 132/334 (39.52%), Query Frame = 2
Query:  569 SFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQD--QFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILV-HFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQ----WWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP 1549
            +FDWS+YLK    ++VPA +F ++ +      +    K +  VN  ++ VD + E  F V T+ ++   R+ L ++GY+D    DFW    S  I P GWC   N+ L  P        +W  YL K  S A   S  F+ +  I  K  +  G  +  +     G   V   K      I V      D + D W HY S  + P+G+           S  GH L        +   N+   P   F + +           VGM+ E ID   P  I V  + K+       +G D  +    Y +   +S  NI P GW       L PP
Sbjct:   91 TFDWSDYLKKTGAKSVPAFMFKHVCMNPCLKGVHVGMKVEV-VNCGMDVVD-DTEVAFWVATVKQLRQHRVLLRYEGYEDDDSADFWFDLRSMNIHPVGWCAKRNKLLIPPPAIRENCTNWRDYLFKCLSGAKTFSAEFL-QQVIETKGCYNTGMCVTMIVDVYLGQTEVIETKGCYNTGICVTMIVDADVAEDFWCHYLSSEIHPIGW----------SSLVGHTLQ-----PPIGKYNNLDAPQEFFVQDSTGTAPGLHQFKVGMKFEAIDPFSPSHIVVVTVIKVLRFNYFVLGVDSLA---TYFVCHANS-RNIFPCGWARSQSLPLTPP 402          

HSP 3 Score: 79.7221 bits (195), Expect = 1.589e-15
Identity = 69/247 (27.94%), Postives = 103/247 (41.70%), Query Frame = 2
Query:  815 DFWTLSDSQLIFPAGWCENNNRKLQSP-KDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIF-EERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP 1549
            DFW    S  I P GW       LQ P   Y N       ++  +   A                + F +G K EA+D  +   I V TV  ++  N  V      ++Y +  H +S  + P G+       L+ P  Y  +  +FSW  YL  T     P  +F +ER    F   +GM+ E +D R P L+  A +  +     + I FD W + Y+  +D+ S   +I P+ +CV  G  LQPP
Sbjct:  281 DFWCHYLSSEIHPIGWSSLVGHTLQPPIGKYNNLDAPQEFFVQDSTGTA-------------PGLHQFKVGMKFEAIDPFSPSHIVVVTVIKVLRFNYFVLGVDSLATYFV-CHANSRNIFPCGWARSQSLPLTPPRDYSPE--TFSWPEYLDKTGGIEAPVHLFKQERRMNGFR--IGMKLEAVDLREPALVCPATVTDVKGPL-LRIHFDGWDDSYDQLVDMDS--LDIFPVSYCVSVGHPLQPP 506          

HSP 4 Score: 66.6254 bits (161), Expect = 2.521e-11
Identity = 37/109 (33.94%), Postives = 49/109 (44.95%), Query Frame = 2
Query:  569 SFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSP 895
            +F W EYL    G   P  LF          +   N    F +  KLE VD    +L C  T+ ++ G  LR+HFDG+ D +D     DS  IFP  +C +    LQ P
Sbjct:  409 TFSWPEYLDKTGGIEAPVHLFKQ--------ERRMNG---FRIGMKLEAVDLREPALVCPATVTDVKGPLLRIHFDGWDDSYDQLVDMDSLDIFPVSYCVSVGHPLQPP 506          
BLAST of Malignant brain tumor-like protein vs. Ensembl Nematostella
Match: EDO34899 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN41])

HSP 1 Score: 87.8113 bits (216), Expect = 5.808e-18
Identity = 80/343 (23.32%), Postives = 139/343 (40.52%), Query Frame = 2
Query:  578 WSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVD-PNNESLFCVLTIVEILGSRLRLHFDGYQDQF--DFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDS-SYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGH--------DLSSFSWDSYLKLTNSESVPNSIFEERNQW--WFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDL--GSSWTNILPIGWCVKNGCVLQPPPTF 1558
            W +YLK    ++VP   F ++ +         N    F    K+E  D  +N   + V TI+ + G  L L FDGY +    DFW  + +  + P GWC   N  L  P+       +W  +L     +A         +    + +   IG  LE  D  +     VA+V +  G  + + +   +S  +D+W +Y S  +  +G+ + Y   L  P             D+S+   D   +L+ + +  ++  ++ +Q         GM+ E ++   P  I VA ++++  E    +  DD+      KI     +   NI P  WC KN   + PP  +
Sbjct:    3 WEDYLKKCRAKSVPKSAFKHVSV---------NPTSGFRRGMKVEAKDYKSNSGTYWVATIIMVSGPLLLLRFDGYGNDRSEDFWCDASTPDVQPIGWCAKTNTILIPPQALRQQNTNWAQFLMDNLKDAVAAPESLFKQQEAGESSGVPIGTMLELQDYDDPLCYWVASVVERFGLRLKLRYAGAESEEHDVWVYYLSDNVHKLGWGKRYGLTLQAPKGTSTLESLTNRVDMSAII-DDLNRLSTTSNNGSTSLKKNDQLPPIHGFKSGMKLEAVNPTDPSSICVATVSRVVNEHYFVVTIDDFVVPEARKISFWCHAKSRNIFPCRWCEKNKVSVVPPAGY 335          

HSP 2 Score: 87.8113 bits (216), Expect = 6.738e-18
Identity = 59/189 (31.22%), Postives = 85/189 (44.97%), Query Frame = 2
Query:  683 YKFSVNQKLEGVDPNNESLFCVLTIVEILGSR-LRLHFDGY----QDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAH---YSSPLLLPVGYCEDYEKVLSIPSA 1225
            + F    KLE V+P + S  CV T+  ++      +  D +      +  FW  + S+ IFP  WCE N   +  P  Y   PF W  YL  ++ E A  S F    +     + F  G KLEAV++    +I  ATVK I+G  + +  D++ S  D+  H     S  L PVG+C      L  P A
Sbjct:  257 HGFKSGMKLEAVNPTDPSSICVATVSRVVNEHYFVVTIDDFVVPEARKISFWCHAKSRNIFPCRWCEKNKVSVVPPAGYQTKPFHWDAYLISSRQEPALASLF----DQTVPNHGFEAGYKLEAVNQIERDVISAATVKQIMGRTMWIQLDAYTS--DVVEHIYDVESCDLFPVGWCGMQGHPLLTPQA 439          

HSP 3 Score: 77.7962 bits (190), Expect = 9.630e-15
Identity = 87/372 (23.39%), Postives = 156/372 (41.94%), Query Frame = 2
Query:  491 DGEVVGFSSKTRREKLERETAKSKSSSFDWSEYLKS--IDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQ-DQFDFWTLSDSQLIFPAGWCENNNRKLQSPK------DYTNFPFSWPVY--LTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGEN-ILVHFDSW----DSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEER--NQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDW-SEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP 1549
            D + +G+ +KT    +  +  + +++  +W+++L     D    P  LF            E        +   LE  D ++   + V ++VE  G RL+L + G + ++ D W    S  +   GW +     LQ+PK        TN      +   L +  + + + S      + +   + F  G KLEAV+  +   ICVATV  ++ E+  +V  D +          W H  S  + P  +CE   KV  +P A G+    F WD+YL  +  E    S+F++   N      + G + E +++    +I  A + ++     + I  D + S+   +  D+ S   ++ P+GWC   G  L  P
Sbjct:   85 DVQPIGWCAKTNTILIPPQALRQQNT--NWAQFLMDNLKDAVAAPESLFKQ---------QEAGESSGVPIGTMLELQDYDDPLCYWVASVVERFGLRLKLRYAGAESEEHDVWVYYLSDNVHKLGWGKRYGLTLQAPKGTSTLESLTNRVDMSAIIDDLNRLSTTSNNGSTSLKKNDQLPPIHGFKSGMKLEAVNPTDPSSICVATVSRVVNEHYFVVTIDDFVVPEARKISFWCHAKSRNIFPCRWCEK-NKVSVVPPA-GYQTKPFHWDAYLISSRQEPALASLFDQTVPNH---GFEAGYKLEAVNQIERDVISAATVKQIMGR-TMWIQLDAYTSDVVEHIYDVES--CDLFPVGWCGMQGHPLLTP 437          
BLAST of Malignant brain tumor-like protein vs. Ensembl Medaka
Match: l3mbtl1b (L3MBTL histone methyl-lysine binding protein 3 [Source:NCBI gene;Acc:101169969])

HSP 1 Score: 296.975 bits (759), Expect = 7.113e-88
Identity = 158/405 (39.01%), Postives = 230/405 (56.79%), Query Frame = 2
Query:  512 SSKTRR-EKLER--ETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP--PTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRI 1711
            ++K+RR  K+ +   T  +K  ++ W  YL+       P KLF               S+  F V  KLEG+DP++ SLFCVL++ EI G R+RLHFDGY +  DFW  +DS  + PAGWCE N  KL  PK   +  F+W +Y+   + + A +  F  +   ++  + F  G KLEA ++RN   ICVAT+  ++   +L+HFD WD ++D W   SSP + PVG+CE+    L+ P    +D  SFSW+ YL+ T S++ P   F+ R+   F   VGM+ E +DKR P LIRVA I    E+ ++ I FD WS +Y+Y ++  +   ++ P+GWC K G  LQ P  P+   +++   CP  GC G GH++GPRY  H     CPY+E NLNK+    DR+
Sbjct:  184 TTKSRRGAKIAKLVSTPPNKKRAWSWPAYLEEERAPAAPVKLF-------KEHQSFPQSRNAFKVGMKLEGLDPSHPSLFCVLSVAEIQGYRVRLHFDGYPECHDFWANADSWDMKPAGWCEKNGHKLLLPKGCKDGEFNWSMYVKNCRGQLAPKHLFKSLNTSVT-PSGFRAGMKLEAANRRNPQSICVATIAAVVDNRLLIHFDDWDDTHDYWCDASSPYIHPVGFCEEVGLTLTTP----NDDKSFSWEKYLEETGSQAAPARAFKPRHPHGF--QVGMKVEAVDKRNPMLIRVATIVD-TEDHRLKIHFDGWSSEYDYWVE--TDCPDLHPVGWCQKTGHPLQYPNGPSDLLTVQGQGCPTPGCNGVGHIRGPRYGTHYTQVSCPYSEINLNKEGLLPDRL 571          

HSP 2 Score: 62.7734 bits (151), Expect = 1.200e-9
Identity = 26/73 (35.62%), Postives = 48/73 (65.75%), Query Frame = 2
Query: 2393 KSILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKE 2611
            K +  W+++EV+  +  + G  +++ TF  +++DG AF+ L Q D++K+L +KLGPA+K+ + I  LK   +E
Sbjct:  666 KRVATWSAEEVATFVKGLPGCKEHATTFKTEQIDGEAFLLLTQADIVKILSIKLGPALKIYNSILMLKNADEE 738          
BLAST of Malignant brain tumor-like protein vs. Ensembl Medaka
Match: l3mbtl1b (L3MBTL histone methyl-lysine binding protein 3 [Source:NCBI gene;Acc:101169969])

HSP 1 Score: 298.13 bits (762), Expect = 3.831e-87
Identity = 158/405 (39.01%), Postives = 230/405 (56.79%), Query Frame = 2
Query:  512 SSKTRR-EKLER--ETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP--PTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRI 1711
            ++K+RR  K+ +   T  +K  ++ W  YL+       P KLF               S+  F V  KLEG+DP++ SLFCVL++ EI G R+RLHFDGY +  DFW  +DS  + PAGWCE N  KL  PK   +  F+W +Y+   + + A +  F  +   ++  + F  G KLEA ++RN   ICVAT+  ++   +L+HFD WD ++D W   SSP + PVG+CE+    L+ P    +D  SFSW+ YL+ T S++ P   F+ R+   F   VGM+ E +DKR P LIRVA I    E+ ++ I FD WS +Y+Y ++  +   ++ P+GWC K G  LQ P  P+   +++   CP  GC G GH++GPRY  H     CPY+E NLNK+    DR+
Sbjct:  234 TTKSRRGAKIAKLVSTPPNKKRAWSWPAYLEEERAPAAPVKLF-------KEHQSFPQSRNAFKVGMKLEGLDPSHPSLFCVLSVAEIQGYRVRLHFDGYPECHDFWANADSWDMKPAGWCEKNGHKLLLPKGCKDGEFNWSMYVKNCRGQLAPKHLFKSLNTSVT-PSGFRAGMKLEAANRRNPQSICVATIAAVVDNRLLIHFDDWDDTHDYWCDASSPYIHPVGFCEEVGLTLTTP----NDDKSFSWEKYLEETGSQAAPARAFKPRHPHGF--QVGMKVEAVDKRNPMLIRVATIVD-TEDHRLKIHFDGWSSEYDYWVE--TDCPDLHPVGWCQKTGHPLQYPNGPSDLLTVQGQGCPTPGCNGVGHIRGPRYGTHYTQVSCPYSEINLNKEGLLPDRL 621          

HSP 2 Score: 62.7734 bits (151), Expect = 1.565e-9
Identity = 25/68 (36.76%), Postives = 46/68 (67.65%), Query Frame = 2
Query: 2393 KSILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLK 2596
            K +  W+++EV+  +  + G  +++ TF  +++DG AF+ L Q D++K+L +KLGPA+K+ + I  LK
Sbjct:  769 KRVATWSAEEVATFVKGLPGCKEHATTFKTEQIDGEAFLLLTQADIVKILSIKLGPALKIYNSILMLK 836          
BLAST of Malignant brain tumor-like protein vs. Ensembl Medaka
Match: l3mbtl1b (L3MBTL histone methyl-lysine binding protein 3 [Source:NCBI gene;Acc:101169969])

HSP 1 Score: 297.36 bits (760), Expect = 5.677e-87
Identity = 158/405 (39.01%), Postives = 230/405 (56.79%), Query Frame = 2
Query:  512 SSKTRR-EKLER--ETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP--PTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRI 1711
            ++K+RR  K+ +   T  +K  ++ W  YL+       P KLF               S+  F V  KLEG+DP++ SLFCVL++ EI G R+RLHFDGY +  DFW  +DS  + PAGWCE N  KL  PK   +  F+W +Y+   + + A +  F  +   ++  + F  G KLEA ++RN   ICVAT+  ++   +L+HFD WD ++D W   SSP + PVG+CE+    L+ P    +D  SFSW+ YL+ T S++ P   F+ R+   F   VGM+ E +DKR P LIRVA I    E+ ++ I FD WS +Y+Y ++  +   ++ P+GWC K G  LQ P  P+   +++   CP  GC G GH++GPRY  H     CPY+E NLNK+    DR+
Sbjct:  234 TTKSRRGAKIAKLVSTPPNKKRAWSWPAYLEEERAPAAPVKLF-------KEHQSFPQSRNAFKVGMKLEGLDPSHPSLFCVLSVAEIQGYRVRLHFDGYPECHDFWANADSWDMKPAGWCEKNGHKLLLPKGCKDGEFNWSMYVKNCRGQLAPKHLFKSLNTSVT-PSGFRAGMKLEAANRRNPQSICVATIAAVVDNRLLIHFDDWDDTHDYWCDASSPYIHPVGFCEEVGLTLTTP----NDDKSFSWEKYLEETGSQAAPARAFKPRHPHGF--QVGMKVEAVDKRNPMLIRVATIVD-TEDHRLKIHFDGWSSEYDYWVE--TDCPDLHPVGWCQKTGHPLQYPNGPSDLLTVQGQGCPTPGCNGVGHIRGPRYGTHYTQVSCPYSEINLNKEGLLPDRL 621          

HSP 2 Score: 62.7734 bits (151), Expect = 1.552e-9
Identity = 25/68 (36.76%), Postives = 46/68 (67.65%), Query Frame = 2
Query: 2393 KSILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLK 2596
            K +  W+++EV+  +  + G  +++ TF  +++DG AF+ L Q D++K+L +KLGPA+K+ + I  LK
Sbjct:  769 KRVATWSAEEVATFVKGLPGCKEHATTFKTEQIDGEAFLLLTQADIVKILSIKLGPALKIYNSILMLK 836          
BLAST of Malignant brain tumor-like protein vs. Ensembl Medaka
Match: l3mbtl1a (L3MBTL histone methyl-lysine binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-090312-120])

HSP 1 Score: 234.572 bits (597), Expect = 1.096e-67
Identity = 137/336 (40.77%), Postives = 184/336 (54.76%), Query Frame = 2
Query:  680 KYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNK 1687
            K  F    KLEG+DP + S++ VLT+ E+ G RLRLHFDGY D  DFW  ++S  I PAGWCE+   KL +PK      F+W  YL  TK++ A +   F     I     F IG KLEAVD+ N  +ICVATV D +    LVHFD+WD +YD +   SSP + P+G+C++    L+ P  Y  D   FSW  YL+ T +++V   +F+   Q        M+ E +DKR P LIRVA + ++ E  ++ I +D WS  Y+  +D  S   +I P GWC   G  L+             CP  GC G GHV G R++ H   SGCP AE N  +
Sbjct:    7 KNGFKQGMKLEGIDPQHPSMYFVLTVAEVCGYRLRLHFDGYSDCHDFWVNANSLDIHPAGWCESTGHKLHTPK-CKEEEFTWTNYLKMTKAQVAPKE-LFSSPGRIDVNCGFEIGMKLEAVDRMNPSLICVATVTDAVDNRFLVHFDNWDDTYD-YCDASSPYIHPIGWCQERNLPLTPPQDYP-DQGRFSWCLYLEETGAKAVAAEVFKHSFQ------PQMKLEAVDKRSPGLIRVATVEEV-ETHRIKIHYDGWSHVYDEWMD--SDHPDIHPAGWCEATGHPLK------------KCPTPGCDGSGHVTG-RFTAHHCISGCPLAERNQGR 316          

HSP 2 Score: 140.584 bits (353), Expect = 5.399e-35
Identity = 96/299 (32.11%), Postives = 138/299 (46.15%), Query Frame = 2
Query:  545 ETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTN-FPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIG 1438
             T K K   F W+ YLK    +  P +LF + G     ID+       F +  KLE VD  N SL CV T+ + + +R  +HFD + D +D+   S S  I P GWC+  N  L  P+DY +   FSW +YL +T ++A     F         K++F    KLEAVDKR+ G+I VATV+++    I +H+D W   YD W     P + P G+CE     L      G D S        + T    +      ERNQ        ++ E+ D  C + +     +K N  ++  IG
Sbjct:   76 HTPKCKEEEFTWTNYLKMTKAQVAPKELFSSPG----RIDVNCG----FEIGMKLEAVDRMNPSLICVATVTDAVDNRFLVHFDNWDDTYDYCDAS-SPYIHPIGWCQERNLPLTPPQDYPDQGRFSWCLYLEETGAKAVAAEVF---------KHSFQPQMKLEAVDKRSPGLIRVATVEEVETHRIKIHYDGWSHVYDEWMDSDHPDIHPAGWCEATGHPLKKCPTPGCDGSGHVTG---RFTAHHCISGCPLAERNQ------GRLKAELSDSECKRNLFFGQRSKKN-HYRGRIG 346          

HSP 3 Score: 61.2326 bits (147), Expect = 3.299e-9
Identity = 24/66 (36.36%), Postives = 46/66 (69.70%), Query Frame = 2
Query: 2399 ILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLK 2596
            +  W+ +EV + + ++IG ++ ++ F E+ +DG AF+ L Q D++K++ +KLGPA+K+S+ I   K
Sbjct:  405 VAAWSVEEVFRFVQNLIGCEEQARLFKEEMIDGEAFLLLTQTDIVKIMSIKLGPALKISNAILMFK 470          
BLAST of Malignant brain tumor-like protein vs. Ensembl Medaka
Match: SCML2 (Scm polycomb group protein like 2 [Source:NCBI gene;Acc:101171821])

HSP 1 Score: 148.673 bits (374), Expect = 1.386e-36
Identity = 80/219 (36.53%), Postives = 106/219 (48.40%), Query Frame = 2
Query:  569 SFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNN-FIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPS 1222
            SF W +YLK       P   F    +  SN          F V  KLE  DP N +  C+ T++ + G RLRL  DG  +  DFW L DS  I P G CE N   LQ P  +     SWP++L +T + A         K P+    N F  G KLEAVDK+N  +IC AT+ D+ G+ + V FD W  ++D W  Y S  + P+G+C   +  L  P 
Sbjct:   34 SFSWEQYLKETSSTPAPPGCFRQSRVPPSN---------DFKVGMKLEAHDPRNSTSVCIATVMGMTGVRLRLRLDGSDNSNDFWRLVDSSDIQPIGTCEKNGDMLQPPLGFRMNASSWPMFLLRTLNGAEMAPVAAFKKEPLRPPQNLFKPGMKLEAVDKKNPYLICPATIGDVRGDEVFVMFDGWRGAFDYWCKYDSRDIFPMGWCSLTKHSLQPPG 243          

HSP 2 Score: 110.923 bits (276), Expect = 1.248e-24
Identity = 75/217 (34.56%), Postives = 107/217 (49.31%), Query Frame = 2
Query:  917 FSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYL--KLTNSESVPNSIFEER----NQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP 1549
            FSW  YL +T S  A   CF   + P S  N+F +G KLEA D RNS  +C+ATV  + G  + +  D  D+S D W    S  + P+G CE    +L  P   G  +++ SW  +L   L  +E  P + F++      Q  F    GM+ E +DK+ P LI  A I  +  + +V + FD W   ++Y     S   +I P+GWC      LQPP
Sbjct:   35 FSWEQYLKETSSTPAPPGCFRQSRVPPS--NDFKVGMKLEAHDPRNSTSVCIATVMGMTGVRLRLRLDGSDNSNDFWRLVDSSDIQPIGTCEKNGDMLQPP--LGFRMNASSWPMFLLRTLNGAEMAPVAAFKKEPLRPPQNLF--KPGMKLEAVDKKNPYLICPATIGDVRGD-EVFVMFDGWRGAFDYWCKYDSR--DIFPMGWCSLTKHSLQPP 242          

HSP 3 Score: 67.0106 bits (162), Expect = 7.044e-11
Identity = 32/81 (39.51%), Postives = 41/81 (50.62%), Query Frame = 2
Query:  689 FSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPV 931
            F    KLE VD  N  L C  TI ++ G  + + FDG++  FD+W   DS+ IFP GWC      LQ P +    P S  V
Sbjct:  174 FKPGMKLEAVDKKNPYLICPATIGDVRGDEVFVMFDGWRGAFDYWCKYDSRDIFPMGWCSLTKHSLQPPGNSVTLPKSLQV 254          

HSP 4 Score: 51.6026 bits (122), Expect = 3.363e-6
Identity = 38/119 (31.93%), Postives = 59/119 (49.58%), Query Frame = 2
Query: 1244 SFSWDSYLKLTNSESVPNSIFEE-RNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNE-EFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESSACPIY 1594
            SFSW+ YLK T+S   P   F + R     D  VGM+ E  D R    + +A +  +     ++ +   D S  +   +D     ++I PIG C KNG +LQPP  F   + +S+ P++
Sbjct:   34 SFSWEQYLKETSSTPAPPGCFRQSRVPPSNDFKVGMKLEAHDPRNSTSVCIATVMGMTGVRLRLRLDGSDNSNDFWRLVD----SSDIQPIGTCEKNGDMLQPPLGF--RMNASSWPMF 146          
BLAST of Malignant brain tumor-like protein vs. Planmine SMEST
Match: SMESG000025138.1 (SMESG000025138.1)

HSP 1 Score: 1235.32 bits (3195), Expect = 0.000e+0
Identity = 654/724 (90.33%), Postives = 666/724 (91.99%), Query Frame = 2
Query:  101 MNKTKDPGLEFMKYSKNQFCKSLINPYFDPLVWNKDVGYLPGSTLKFRHNKMGLLELWXXXXXXXXXXXXXXXXXXXXXXXXHDDITVNKIEKTEPTIEDADERKEKSKNGFKNPLNTSSYGRKRKRRIIDGEVVGFSSKTRREKLERETAKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVNQKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVPINNSTESVLDNVQDEPINSVQKXXXXXXXXXXXXXXXXSMKENKNPIQNDFIKDLSMNQNEIPEDSQLLDNSPCDFHQIKIYDFPPTLSLQELKDQDENLELFREDQKFFFQYHPPKNLIPNPVAIVSSSVLKPYTNRTPYHPSDDYRRIMEWNILEQILPSLKLVKEENS 2272
            MNKTKDPGLEFMKYSKNQFCKSLINPYFDPLVWNKDVGYLPGSTLKFRHNKMGLLELWEENKQVKN+ESKESKENSNSESPEHDDITVNKIEKTEPTIEDADERKEKSKNGFKNPLNTSSYGRKRKRRIIDGEVVGF        L +   KS +           I    +   + +   + +  I +EY+S     +      +   N  LFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCEN NRKLQSPKDYTN PFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVPINNSTES LDNVQDEPINSVQKPLEIEIPIDDIEPMDLSMKENKNPIQNDFIKDLSMNQNEIPEDSQLLDNSPCDFHQIKIYDFPPTLSLQELKDQDENLELFREDQKFFFQYHPPKNLIPNPVAIVSSSVLKPYTNRTPYHPSDDYRRIMEWNILEQILPSLKLVKEENS
Sbjct:    1 MNKTKDPGLEFMKYSKNQFCKSLINPYFDPLVWNKDVGYLPGSTLKFRHNKMGLLELWEENKQVKNEESKESKENSNSESPEHDDITVNKIEKTEPTIEDADERKEKSKNGFKNPLNTSSYGRKRKRRIIDGEVVGF--------LLKPDEKSWNGKLQNQNLAVLIGQNILNQSMAEQFQLNYLTI-LEYDS-----LTLIWNTIQNINSPLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIFPAGWCENYNRKLQSPKDYTNVPFSWPVYLTKTKSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNSIFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESSACPIYGCKGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSATVPINNSTESTLDNVQDEPINSVQKPLEIEIPIDDIEPMDLSMKENKNPIQNDFIKDLSMNQNEIPEDSQLLDNSPCDFHQIKIYDFPPTLSLQELKDQDENLELFREDQKFFFQYHPPKNLIPNPVAIVSSSVLKPYTNRTPYHPSDDYRRIMEWNILEQILPSLKLVKEENS 710          
BLAST of Malignant brain tumor-like protein vs. Planmine SMEST
Match: SMESG000038034.1 (SMESG000038034.1)

HSP 1 Score: 97.4413 bits (241), Expect = 1.177e-20
Identity = 57/163 (34.97%), Postives = 84/163 (51.53%), Query Frame = 2
Query:  740 FCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLI--FPAGWCENNNRKLQSPKDYTNFPFSWPVYLTKT-KSEAAHESCFFIVKNPISDKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIP 1219
            F +  +++  GSR+RL   G  D+ D W + DS LI  +P+G      ++L  P  + N    W   + +  K E      +F         N F IG+KLEAVD+RN+ +IC AT+ +I    +LV FD W  ++D WA Y+S  L PVG+C   +  L  P
Sbjct:   69 FSLAKVIDKKGSRVRLRHLGTDDRNDIWVMVDSDLIRPYPSG------KELTVPFGFMNSHSVWNRMVNRVDKEEKIAPKDWFQTPPKEPGSNMFQIGEKLEAVDRRNAQLICPATIGNIKDNFVLVSFDGWSGTFDYWACYNSQDLFPVGWCAKAKYRLQSP 225          

HSP 2 Score: 52.373 bits (124), Expect = 1.259e-6
Identity = 44/164 (26.83%), Postives = 69/164 (42.07%), Query Frame = 2
Query: 1070 VATVKDIIGENILVHFDSWDSSYDMWAHYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSES--VPNSIFEE--RNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDWSEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPP 1549
            +A V D  G  + +     D   D+W    S L+ P        K L++P  +G   S   W+  +   + E    P   F+   +        +G + E +D+R  QLI  A I  + + F V + FD WS  ++Y     S   ++ P+GWC K    LQ P
Sbjct:   71 LAKVIDKKGSRVRLRHLGTDDRNDIWVMVDSDLIRPYPSG----KELTVP--FGFMNSHSVWNRMVNRVDKEEKIAPKDWFQTPPKEPGSNMFQIGEKLEAVDRRNAQLICPATIGNIKDNF-VLVSFDGWSGTFDYWACYNSQ--DLFPVGWCAKAKYRLQSP 225          
BLAST of Malignant brain tumor-like protein vs. Planmine SMEST
Match: SMESG000020063.1 (SMESG000020063.1)

HSP 1 Score: 50.0618 bits (118), Expect = 7.508e-6
Identity = 22/73 (30.14%), Postives = 41/73 (56.16%), Query Frame = 2
Query: 2387 IKKSILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMK-VLGMKLGPAIKVSSGIQYLKQL 2602
            + + +  W+  +V++ +    G D Y   F+  E+DG A + L   +L++  L MK+GPA+K+ + I+  K L
Sbjct:  716 LDRPMWEWSVNDVAEFVKQTPGCDNYVSMFLNHEIDGEALLLLSNDNLIQGALNMKIGPALKLCARIEKRKAL 788          
BLAST of Malignant brain tumor-like protein vs. Planmine SMEST
Match: SMESG000020063.1 (SMESG000020063.1)

HSP 1 Score: 50.0618 bits (118), Expect = 7.700e-6
Identity = 22/66 (33.33%), Postives = 38/66 (57.58%), Query Frame = 2
Query: 2408 WNSQEVSQLISSVIGTDQYSKTFIEQEVDGAAFMCLKQMDLMK-VLGMKLGPAIKVSSGIQYLKQL 2602
            W+  +V++ +    G D Y   F+  E+DG A + L   +L++  L MK+GPA+K+ + I+  K L
Sbjct:  722 WSVNDVAEFVKQTPGCDNYVSMFLNHEIDGEALLLLSNDNLIQGALNMKIGPALKLCARIEKRKAL 787          
The following BLAST results are available for this feature:
BLAST of Malignant brain tumor-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
L3MBTL36.589e-9239.36L3MBTL histone methyl-lysine binding protein 3 [So... [more]
L3MBTL36.589e-9239.36L3MBTL histone methyl-lysine binding protein 3 [So... [more]
L3MBTL36.589e-9239.36L3MBTL histone methyl-lysine binding protein 3 [So... [more]
L3MBTL31.332e-9139.36L3MBTL histone methyl-lysine binding protein 3 [So... [more]
L3MBTL31.332e-9139.36L3MBTL histone methyl-lysine binding protein 3 [So... [more]
back to top
BLAST of Malignant brain tumor-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-612.024e-1926.83pep chromosome:WBcel235:I:7248828:7250816:-1 gene:... [more]
lin-612.024e-1926.83pep chromosome:WBcel235:I:7248828:7251422:-1 gene:... [more]
lin-617.061e-1925.91pep chromosome:WBcel235:I:7248828:7251282:-1 gene:... [more]
mbtr-11.626e-1022.58Malignant brain tumor repeat protein 1 [Source:Un... [more]
mbtr-12.028e-1022.08Malignant brain tumor repeat protein 1 [Source:Un... [more]
back to top
BLAST of Malignant brain tumor-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l(3)mbt1.681e-7037.31gene:FBgn0002441 transcript:FBtr0085175[more]
Scm2.211e-3539.61gene:FBgn0003334 transcript:FBtr0082102[more]
Scm2.211e-3539.61gene:FBgn0003334 transcript:FBtr0306008[more]
Sfmbt2.347e-3028.99gene:FBgn0032475 transcript:FBtr0080491[more]
Sfmbt2.688e-3028.99gene:FBgn0032475 transcript:FBtr0080492[more]
back to top
BLAST of Malignant brain tumor-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l3mbtl33.991e-9140.29L3MBTL histone methyl-lysine binding protein 3 [So... [more]
l3mbtl1b1.420e-8539.51L3MBTL histone methyl-lysine binding protein 1b [S... [more]
l3mbtl1b1.420e-8539.51L3MBTL histone methyl-lysine binding protein 1b [S... [more]
l3mbtl1a1.631e-7741.06L3MBTL histone methyl-lysine binding protein 1a [S... [more]
l3mbtl33.081e-7238.80L3MBTL histone methyl-lysine binding protein 3 [So... [more]
back to top
BLAST of Malignant brain tumor-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000055847.16.585e-9132.23L3MBTL3, histone methyl-lysine binding protein [So... [more]
ENSXETT00000055854.11.346e-8938.52L3MBTL3, histone methyl-lysine binding protein [So... [more]
ENSXETT00000055857.12.520e-8938.52L3MBTL3, histone methyl-lysine binding protein [So... [more]
ENSXETT00000055853.16.654e-8838.46L3MBTL3, histone methyl-lysine binding protein [So... [more]
hdac37.722e-8341.55histone deacetylase 3 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Malignant brain tumor-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
L3mbtl31.559e-8939.35L3MBTL3 histone methyl-lysine binding protein [Sou... [more]
L3mbtl32.400e-8939.35L3MBTL3 histone methyl-lysine binding protein [Sou... [more]
L3mbtl32.400e-8939.35L3MBTL3 histone methyl-lysine binding protein [Sou... [more]
L3mbtl42.527e-8738.23L3MBTL4 histone methyl-lysine binding protein [Sou... [more]
L3mbtl41.704e-8638.23L3MBTL4 histone methyl-lysine binding protein [Sou... [more]
back to top
BLAST of Malignant brain tumor-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96JM7|LMBL3_HUMAN6.399e-9139.36Lethal(3)malignant brain tumor-like protein 3 OS=H... [more]
sp|Q8BLB7|LMBL3_MOUSE1.679e-8839.35Lethal(3)malignant brain tumor-like protein 3 OS=M... [more]
sp|B1B1A0|LMBL4_MOUSE8.237e-8638.23Lethal(3)malignant brain tumor-like protein 4 OS=M... [more]
sp|Q8NA19|LMBL4_HUMAN1.445e-8539.20Lethal(3)malignant brain tumor-like protein 4 OS=H... [more]
sp|E1C2V1|LMBL1_CHICK7.576e-8341.21Lethal(3)malignant brain tumor-like protein 1 OS=G... [more]
back to top
BLAST of Malignant brain tumor-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A481NV200.000e+080.52Malignant brain tumor-like protein OS=Dugesia japo... [more]
A0A3R7ES616.810e-11644.25Lethal(3)malignant brain tumor-like protein 3 (Fra... [more]
A0A4S2LKJ72.224e-11443.31SAM domain-containing protein OS=Opisthorchis feli... [more]
A0A4S2LKQ74.075e-11443.31SAM domain-containing protein OS=Opisthorchis feli... [more]
A0A4S2LKK14.610e-11443.31SAM domain-containing protein OS=Opisthorchis feli... [more]
back to top
BLAST of Malignant brain tumor-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l3mbtl1b8.631e-9138.90L3MBTL histone methyl-lysine binding protein 1b [S... [more]
L3MBTL41.692e-8340.63L3MBTL histone methyl-lysine binding protein 4 [So... [more]
l3mbtl1a3.588e-7638.08lethal(3)malignant brain tumor-like protein 1 [Sou... [more]
l3mbtl31.418e-7441.19L3MBTL histone methyl-lysine binding protein 3 [So... [more]
ENSAMXT00000001859.23.289e-3836.51Scm polycomb group protein like 2 [Source:NCBI gen... [more]
back to top
BLAST of Malignant brain tumor-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l3mbtl1b1.778e-9039.75L3MBTL histone methyl-lysine binding protein 1b [S... [more]
l3mbtl1b1.204e-7839.26L3MBTL histone methyl-lysine binding protein 1b [S... [more]
l3mbtl1b1.539e-4141.90L3MBTL histone methyl-lysine binding protein 1b [S... [more]
mbtd11.560e-3232.43mbt domain containing 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
SFMBT19.191e-831.82Scm like with four mbt domains 1 [Source:HGNC Symb... [more]
back to top
BLAST of Malignant brain tumor-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Malignant brain tumor-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO392781.618e-8741.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393102.667e-8740.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411072.107e-2733.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444131.078e-2435.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348995.808e-1823.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Malignant brain tumor-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l3mbtl1b7.113e-8839.01L3MBTL histone methyl-lysine binding protein 3 [So... [more]
l3mbtl1b3.831e-8739.01L3MBTL histone methyl-lysine binding protein 3 [So... [more]
l3mbtl1b5.677e-8739.01L3MBTL histone methyl-lysine binding protein 3 [So... [more]
l3mbtl1a1.096e-6740.77L3MBTL histone methyl-lysine binding protein 1a [S... [more]
SCML21.386e-3636.53Scm polycomb group protein like 2 [Source:NCBI gen... [more]
back to top
BLAST of Malignant brain tumor-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000025138.10.000e+090.33SMESG000025138.1[more]
SMESG000038034.11.177e-2034.97SMESG000038034.1[more]
SMESG000020063.17.508e-630.14SMESG000020063.1[more]
SMESG000020063.17.700e-633.33SMESG000020063.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014280 ID=SMED30014280|Name=Malignant brain tumor-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2716bp
ATCAGAATTGCTTTTAATTTTAAAGCTATTTGTTATAATTATAATACTTA
ATTATGGGTTATTAAAGTCAAAATGATTTACTATTTCATTTTAGAGATTA
ATGAACAAAACTAAAGATCCGGGATTGGAATTTATGAAATATTCCAAAAA
CCAATTTTGCAAGTCCTTGATAAATCCATATTTTGATCCTTTAGTTTGGA
ATAAAGACGTAGGCTATTTACCAGGCTCAACTTTAAAATTTCGTCACAAT
AAAATGGGTTTGCTTGAACTATGGGAAGAAAATAAACAAGTAAAAAATAA
AGAGTCCAAGGAATCCAAAGAAAACAGCAATTCAGAATCACCAGAACACG
ATGACATAACTGTAAATAAAATTGAAAAAACCGAGCCAACAATAGAAGAT
GCCGATGAAAGAAAAGAAAAAAGTAAAAACGGTTTCAAAAATCCACTCAA
CACGTCTAGTTACGGTCGGAAACGTAAACGAAGAATTATCGATGGAGAGG
TGGTTGGATTTTCTTCTAAAACCAGACGAGAAAAGTTGGAACGGGAAACT
GCAAAATCAAAATCTAGCAGTTTTGATTGGTCAGAATATCTTAAATCAAT
CGATGGCAGAACAGTTCCAGCTAAACTATTTGACAATATTGGAATACGAT
TCTCTAACATTGATATGGAATACAATTCAAAATATAAATTCTCCGTAAAT
CAAAAACTTGAAGGAGTTGATCCGAACAATGAAAGTTTGTTCTGTGTGTT
GACAATTGTTGAGATTTTAGGTAGTCGATTGCGATTACATTTTGATGGTT
ATCAAGATCAATTTGATTTTTGGACCTTGTCAGATTCACAATTAATTTTT
CCAGCTGGCTGGTGTGAGAATAACAATAGAAAGTTACAATCTCCAAAAGA
TTACACAAATTTTCCATTTTCATGGCCTGTTTATTTAACAAAAACGAAAT
CAGAAGCCGCCCACGAAAGCTGTTTCTTTATTGTTAAAAATCCAATTTCA
GATAAAAATAATTTTATAATTGGTCAAAAGCTAGAGGCTGTTGATAAAAG
AAATTCTGGAATGATTTGTGTTGCAACCGTGAAAGATATAATTGGTGAAA
ATATTTTAGTGCATTTCGATAGCTGGGACTCTTCTTATGACATGTGGGCA
CATTACAGCTCACCTTTATTACTTCCGGTTGGATATTGTGAGGATTATGA
GAAAGTATTGTCAATACCATCAGCTTATGGACATGATTTAAGCTCATTTA
GTTGGGATAGCTATTTAAAGTTAACAAACTCAGAATCAGTGCCTAATTCA
ATTTTCGAAGAAAGAAACCAGTGGTGGTTCGATCTGGATGTGGGTATGCG
TTGTGAAGTTATTGATAAACGATGCCCGCAGCTCATCAGAGTGGCACATA
TTGCCAAGTTAAATGAAGAATTTCAAGTAACAATTGGTTTTGATGATTGG
TCAGAAAAATACAATTACAAAATTGACCTCGGCAGTTCATGGACTAATAT
TCTCCCAATTGGATGGTGCGTGAAAAACGGATGTGTTTTACAGCCTCCTC
CTACCTTCGATGCTTCTATTGAGTCAAGCGCGTGCCCTATTTATGGATGC
AAAGGATATGGCCACGTTAAAGGTCCTAGATATTCAAATCATCAAAGGAC
ATCTGGCTGTCCATACGCTGAATGCAATTTGAATAAAGATTTTAAAACAA
TTGATCGAATTCCCCTATCAATAATTCAGTCCCTGGATGAAAGCAGTGCA
ACAGTTCCTATCAATAATAGCACAGAATCAGTATTAGATAATGTTCAAGA
TGAGCCTATAAATTCTGTACAAAAACCTCTTGAAATAGAAATTCCAATAG
ATGATATAGAACCCATGGACCTTTCAATGAAAGAAAACAAAAATCCTATT
CAGAATGACTTTATCAAAGATTTATCAATGAATCAAAATGAAATACCTGA
AGATTCTCAACTTCTTGATAATTCACCTTGTGATTTTCATCAGATTAAAA
TTTATGATTTCCCCCCTACTTTATCTCTTCAGGAATTGAAAGATCAAGAC
GAAAATTTGGAGTTATTTCGGGAAGATCAAAAATTTTTCTTTCAATATCA
TCCACCGAAAAATCTTATTCCAAATCCAGTAGCCATTGTTTCCTCCTCGG
TATTAAAACCGTATACCAATCGAACACCTTATCACCCCAGTGATGATTAT
CGCCGCATTATGGAATGGAATATACTCGAGCAGATATTGCCCTCATTAAA
ATTGGTAAAAGAAGAAAATTCTCAGATAATTCAAGATATACAAAATAAAA
AAAATTTAAAAACAAAAAATAAAAACAAAAAAGGATCAAACAAAAAAAAG
AATTCCAATATTAATGACCAAATCAAAGAAATGGATATCAAAAAATCAAT
TCTACACTGGAATAGTCAAGAAGTTTCTCAATTAATATCTTCAGTTATTG
GAACTGATCAATATAGTAAAACTTTTATTGAACAAGAAGTTGATGGAGCT
GCATTTATGTGTCTTAAACAGATGGACTTAATGAAGGTTCTAGGTATGAA
ATTGGGACCGGCAATTAAAGTTTCTTCTGGTATTCAATATTTGAAACAGC
TTTTTAAGGAAACAAAACTATCGGAGTTTGCCTAATAAATTGTGCTCCAT
TGTTGTAATTTCATACTAGCTAGTGTTAAATTTATAATCTATGAAATCCT
TGAAATTGTAAATAAT
back to top

protein sequence of SMED30014280-orf-1

>SMED30014280-orf-1 ID=SMED30014280-orf-1|Name=SMED30014280-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=845bp
MNKTKDPGLEFMKYSKNQFCKSLINPYFDPLVWNKDVGYLPGSTLKFRHN
KMGLLELWEENKQVKNKESKESKENSNSESPEHDDITVNKIEKTEPTIED
ADERKEKSKNGFKNPLNTSSYGRKRKRRIIDGEVVGFSSKTRREKLERET
AKSKSSSFDWSEYLKSIDGRTVPAKLFDNIGIRFSNIDMEYNSKYKFSVN
QKLEGVDPNNESLFCVLTIVEILGSRLRLHFDGYQDQFDFWTLSDSQLIF
PAGWCENNNRKLQSPKDYTNFPFSWPVYLTKTKSEAAHESCFFIVKNPIS
DKNNFIIGQKLEAVDKRNSGMICVATVKDIIGENILVHFDSWDSSYDMWA
HYSSPLLLPVGYCEDYEKVLSIPSAYGHDLSSFSWDSYLKLTNSESVPNS
IFEERNQWWFDLDVGMRCEVIDKRCPQLIRVAHIAKLNEEFQVTIGFDDW
SEKYNYKIDLGSSWTNILPIGWCVKNGCVLQPPPTFDASIESSACPIYGC
KGYGHVKGPRYSNHQRTSGCPYAECNLNKDFKTIDRIPLSIIQSLDESSA
TVPINNSTESVLDNVQDEPINSVQKPLEIEIPIDDIEPMDLSMKENKNPI
QNDFIKDLSMNQNEIPEDSQLLDNSPCDFHQIKIYDFPPTLSLQELKDQD
ENLELFREDQKFFFQYHPPKNLIPNPVAIVSSSVLKPYTNRTPYHPSDDY
RRIMEWNILEQILPSLKLVKEENSQIIQDIQNKKNLKTKNKNKKGSNKKK
NSNINDQIKEMDIKKSILHWNSQEVSQLISSVIGTDQYSKTFIEQEVDGA
AFMCLKQMDLMKVLGMKLGPAIKVSSGIQYLKQLFKETKLSEFA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR004092Mbt
IPR001660SAM
IPR013761SAM/pointed_sf
IPR002515Znf_C2H2C
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0003700transcription factor activity, sequence-specific DNA binding