Transmembrane protein 196

Overview
NameTransmembrane protein 196
Smed IDSMED30014270
Length (bp)986
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Transmembrane protein 196 (SMED30014270) t-SNE clustered cells

Violin plots show distribution of expression levels for Transmembrane protein 196 (SMED30014270) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Transmembrane protein 196 (SMED30014270) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Transmembrane protein 196 (SMED30014270) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014270

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014270SMESG000026737.1 Contig4234newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014270SMESG000026737.1 Contig4234uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014270SMESG000044431.1 Contig4234newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014270SMESG000044431.1 Contig4234uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
head regionSMED30014270SMESG000026737.1 SmedASXL_002320SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30014270SMESG000026737.1 dd_Smed_v4_14043_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014270SMESG000026737.1 dd_Smed_v6_14043_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Transmembrane protein 196 vs. Ensembl Zebrafish
Match: FO904989.1 (transmembrane protein 196 [Source:NCBI gene;Acc:798466])

HSP 1 Score: 66.6254 bits (161), Expect = 1.109e-12
Identity = 48/154 (31.17%), Postives = 78/154 (50.65%), Query Frame = 2
Query:  161 RSVVLIVVGLSVMHILMGVVSICLGTISSIKGKIWMAHK-----VSPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESE 607
            R ++  ++ LSV+ I +GV SI LG +   + K    HK      SP+WSG  F++ G+ G+L  R +T  IM+ +++  +   +C I+  Q  R  +V       T R   +  + L  LGISS     C    +++CRL++  + RM  E E
Sbjct:    5 RKIIWSLLVLSVLEIGLGVSSIALGAVGISRAK--AQHKTQQGDASPVWSGVCFLLCGLCGMLCARKRTGLIMILFSSCCICGLICGILNFQFVR-ALVKRP---DTMRSLHLAVMSLACLGISS-----CTLSTWLTCRLASSEQQRMFLERE 147          
BLAST of Transmembrane protein 196 vs. Ensembl Zebrafish
Match: tmem196b (transmembrane protein 196b [Source:ZFIN;Acc:ZDB-GENE-110914-248])

HSP 1 Score: 48.1358 bits (113), Expect = 1.243e-6
Identity = 30/112 (26.79%), Postives = 53/112 (47.32%), Query Frame = 2
Query:  272 HKVSPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESE 607
            H  SPIWSGA F+V G+ G+L  + +T   M+ ++A  +   +  I+ +Q  R             R   + +  L  L + S   L C    +++CRL++  + R+  E +
Sbjct:   15 HSFSPIWSGACFLVCGLSGILCAKKRTGLTMILFSACCICGLIGGILNVQFVR---------AMMKRASSLHSFHLAFLCLDSLGILGCTLSTWLTCRLASSEQKRLFLERD 117          
BLAST of Transmembrane protein 196 vs. Ensembl Xenopus
Match: tmem196 (transmembrane protein 196 [Source:NCBI gene;Acc:100125062])

HSP 1 Score: 54.6842 bits (130), Expect = 1.930e-8
Identity = 37/152 (24.34%), Postives = 79/152 (51.97%), Query Frame = 2
Query:  161 RSVVLIVVGLSVMHILMGVVSICLGTISSIKGKIWMAHKV---SPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESE 607
            R ++  ++ LSV+ I +G+ S+ +G ++  + ++    ++   SP+WSGA F++ GV G+   + ++  IM+ ++A  +   +  I+ IQ  R   +N        R   + +L L ++ ++      C    +++CRL++  + RM  E E
Sbjct:    5 RQIIGSLLVLSVLEIGLGLSSVAVGAVTFFRVRMEQKPQLGDSSPVWSGACFLICGVCGIFCAKKKSGLIMILFSACCICGLIGGILNIQFLR--ALNK-------RSSSLYSLYLASMSLACIGISGCTISTWLTCRLASYEQRRMFLERE 147          
BLAST of Transmembrane protein 196 vs. Ensembl Mouse
Match: Tmem196 (transmembrane protein 196 [Source:MGI Symbol;Acc:MGI:2685374])

HSP 1 Score: 54.299 bits (129), Expect = 2.290e-8
Identity = 45/149 (30.20%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  188 LSVMHILMGVVSICLGTIS---SIKGKIWMAHKVSPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVC--FGGCFVS----CRLSTLVKLRMLDESE 607
            LSV+ I +GV S+ +G +S   +++         SP+WSG  F++ G+ G+L  + ++  +M+ ++A      +C ++G      GI+N     Q  R     T  L  L ++S   L C   GGC VS    CRL++  + RM  E E
Sbjct:   14 LSVLEIGLGVSSVAVGAVSFSLALREHTPQLGDSSPVWSGVCFLLCGICGILCAKKKSGLVMILFSACC----ICGLIG------GILNF----QFLRAVTKKTSSLYPLHLASMS-LACIGIGGCTVSSWLTCRLASYEQRRMFSERE 147          
BLAST of Transmembrane protein 196 vs. Ensembl Mouse
Match: Tmem196 (transmembrane protein 196 [Source:MGI Symbol;Acc:MGI:2685374])

HSP 1 Score: 48.521 bits (114), Expect = 1.329e-6
Identity = 36/115 (31.30%), Postives = 57/115 (49.57%), Query Frame = 2
Query:  281 SPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVC--FGGCFVS----CRLSTLVKLRMLDESE 607
            SP+WSG  F++ G+ G+L  + ++  +M+ ++A      +C ++G      GI+N     Q  R     T  L  L ++S   L C   GGC VS    CRL++  + RM  E E
Sbjct:   16 SPVWSGVCFLLCGICGILCAKKKSGLVMILFSACC----ICGLIG------GILNF----QFLRAVTKKTSSLYPLHLASMS-LACIGIGGCTVSSWLTCRLASYEQRRMFSERE 115          
BLAST of Transmembrane protein 196 vs. UniProt/SwissProt
Match: sp|A4IIU3|TM196_XENTR (Transmembrane protein 196 OS=Xenopus tropicalis OX=8364 GN=tmem196 PE=2 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.022e-7
Identity = 37/152 (24.34%), Postives = 79/152 (51.97%), Query Frame = 2
Query:  161 RSVVLIVVGLSVMHILMGVVSICLGTISSIKGKIWMAHKV---SPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESE 607
            R ++  ++ LSV+ I +G+ S+ +G ++  + ++    ++   SP+WSGA F++ GV G+   + ++  IM+ ++A  +   +  I+ IQ  R   +N        R   + +L L ++ ++      C    +++CRL++  + RM  E E
Sbjct:    5 RQIIGSLLVLSVLEIGLGLSSVAVGAVTFFRVRMEQKPQLGDSSPVWSGACFLICGVCGIFCAKKKSGLIMILFSACCICGLIGGILNIQFLR--ALNK-------RSSSLYSLYLASMSLACIGISGCTISTWLTCRLASYEQRRMFLERE 147          
BLAST of Transmembrane protein 196 vs. UniProt/SwissProt
Match: sp|Q5HYL7|TM196_HUMAN (Transmembrane protein 196 OS=Homo sapiens OX=9606 GN=TMEM196 PE=1 SV=2)

HSP 1 Score: 52.7582 bits (125), Expect = 4.273e-7
Identity = 43/149 (28.86%), Postives = 75/149 (50.34%), Query Frame = 2
Query:  188 LSVMHILMGVVSICLGTIS---SIKGKIWMAHKVSPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVC--FGGC----FVSCRLSTLVKLRMLDESE 607
            LSV+ I +GV S+ +G +S   +++         SP+WSG  F++ G+ G+L  + ++  +M+ ++A      +C ++G      GI+N     Q  R     T  L  L ++S   L C   GGC    +++CRL++  + RM  E E
Sbjct:   14 LSVLEIGLGVSSVAVGAVSFSLALREHKPQLGDSSPVWSGVCFLLCGICGILCAKKKSGLVMILFSACC----ICGLIG------GILNF----QFLRAVTKKTSSLYPLHLASMS-LACIGIGGCTLSSWLTCRLASYEQRRMFSERE 147          
BLAST of Transmembrane protein 196 vs. TrEMBL
Match: A0A1I8GVV6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.883e-50
Identity = 86/170 (50.59%), Postives = 124/170 (72.94%), Query Frame = 2
Query:  158 YRSVVLIVVGLSVMHILMGVVSICLGTISSIKGKIWMAHKVSPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESEGPFIVEIYGDKDVEIIPHKK 667
            Y+SV+  V+ L+V+H+++G +SI LGT+S+I+  +WMAH+VSPIWSG  F VTG+IG+  +R QT YI+LC++A ++VS + A++ IQL RLG+VNHTTDG T++KD +D LLL  LG +  EC+VC     +SCRL+ L K  M  + EG F VE+YG+KDV ++    
Sbjct:    4 YQSVLASVLVLAVIHLILGSLSIMLGTVSTIQAVVWMAHRVSPIWSGGFFFVTGMIGIACVRRQTIYIILCFSAFSVVSLLTAVISIQLLRLGLVNHTTDGHTYQKDTLDQLLLGALGAAGAECVVCIVSGIISCRLAKLAKCEMAKKREGMFYVEVYGEKDVMVVSRSN 173          
BLAST of Transmembrane protein 196 vs. TrEMBL
Match: A0A1I8FGE3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 172.555 bits (436), Expect = 7.297e-49
Identity = 90/176 (51.14%), Postives = 129/176 (73.30%), Query Frame = 2
Query:  140 LCSCLQ---YRSVVLIVVGLSVMHILMGVVSICLGTISSIKGKIWMAHKVSPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMD-TLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESEGPFIVEIYGDKDVEII 655
            LC CL+   Y+SV+  V+ L+V+H+++G +SI LGT+S+I+  +WMAH+VSPIWSG  F VTG+IG+  +R QT YI+LC++A ++VS + A++ IQL RLG+VNHTTDG T++KD +D  LLL  LG +  EC+VC     +SCRL+ L K  M  + EG F VE+YG+KDV ++
Sbjct:   27 LCWCLEMQLYQSVLASVLVLAVIHLILGSLSIMLGTVSTIQAVVWMAHRVSPIWSGGFFFVTGMIGIACVRRQTIYIILCFSAFSVVSLLTAVISIQLLRLGLVNHTTDGHTYQKDTLDQLLLLGALGAAGAECVVCIVSGIISCRLAKLAKCEMAKKREGMFYVEVYGEKDVMVV 202          
BLAST of Transmembrane protein 196 vs. TrEMBL
Match: R7UCT9 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_225997 PE=4 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 8.536e-47
Identity = 77/159 (48.43%), Postives = 110/159 (69.18%), Query Frame = 2
Query:  188 LSVMHILMGVVSICLGTISSIKGKIWMAHKVSPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESEGPFIVEIYGDKDVEIIPHK 664
            LSV H  +GV+SIC+G  +SI+ ++W+AH VSPIWSGA F VT ++G  S R +T Y+++C+TA  +VS V AIV IQL RLG+VNHTTDG TF+K+ +D  +LV LG +  E +VC      S RL+ L K+ +  + EGPF +E+ G KD+ ++  +
Sbjct:   11 LSVFHGCLGVISICVGLFASIRAEVWLAHSVSPIWSGAFFAVTAILGFASTRRKTPYMIMCFTAFCVVSMVTAIVSIQLLRLGLVNHTTDGHTFQKEDLDMCILVALGTTGLEIVVCLVSPIPSWRLAKLAKIELQAKREGPFHIEVLGQKDIVVVSRQ 169          
BLAST of Transmembrane protein 196 vs. TrEMBL
Match: A0A1I8I4H2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 179.104 bits (453), Expect = 1.151e-46
Identity = 87/166 (52.41%), Postives = 121/166 (72.89%), Query Frame = 2
Query:  158 YRSVVLIVVGLSVMHILMGVVSICLGTISSIKGKIWMAHKVSPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESEGPFIVEIYGDKDVEII 655
            YR+V+  V+ L+ +HI +G +SI LGTISSI+  IWMAH+VSPIWSG  F+VTG IG++ ++ QT YI+LC++A ++VS + A++ IQL RLG+VNHTTDG T++K+ +DTLLL  LG +  EC+VC     VSCRL+ L K     + E  F VE+YG KDV ++
Sbjct:  429 YRAVLTAVLVLAGVHIALGSLSIVLGTISSIQAVIWMAHRVSPIWSGGFFLVTGTIGVVCVKRQTVYIILCFSAFSVVSLLTAVISIQLLRLGLVNHTTDGHTYQKETLDTLLLCALGAAGTECVVCVVSGIVSCRLAKLAKSEAGAKREAVFHVEVYGQKDVVVV 594          
BLAST of Transmembrane protein 196 vs. TrEMBL
Match: A0A1S3IJU1 (uncharacterized protein LOC106164882 OS=Lingula unguis OX=7574 GN=LOC106164882 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.576e-45
Identity = 73/155 (47.10%), Postives = 113/155 (72.90%), Query Frame = 2
Query:  161 RSVVLIVVGLSVMHILMGVVSICLGTISSIKGKIWMAHKVSPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESEGPFIVE 625
            ++++  VVGLS+ H+++G VS+CLG +SSI+ ++W+AH VSPIWSG  FI+TG++G    + +++Y++LC+TA ++VS V A+V IQL RLG++NHT DG TF+K+K D L++V L  +  ECL+C    FVSCR++   K  +  + EG F V+
Sbjct:    2 QAIIAAVVGLSIFHLVLGAVSVCLGVVSSIQAEVWLAHSVSPIWSGGFFILTGILGFACAKKKSAYLILCFTAFSVVSLVTAVVSIQLLRLGLINHTNDGNTFQKEKKDFLIIVALATAGTECLICIISSFVSCRVARAAKKELFKKREGTFSVQ 156          
BLAST of Transmembrane protein 196 vs. Ensembl Cavefish
Match: ENSAMXT00000031080.1 (transmembrane protein 196 [Source:NCBI gene;Acc:103038744])

HSP 1 Score: 56.6102 bits (135), Expect = 2.930e-9
Identity = 40/154 (25.97%), Postives = 74/154 (48.05%), Query Frame = 2
Query:  161 RSVVLIVVGLSVMHILMGVVSICLGTISSIKGKIWMAHK-----VSPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESE 607
            R ++  ++ LSV+ + +GV SI LG +     ++   HK      SP+WSG  F+V G+ G+L  + +T  +M+ ++A  +   +  I+  Q  R  +             + DTL L  + ++      C    +++CRL++  + RM  E E
Sbjct:    5 RKIIWSLLLLSVLEMGLGVSSIALGAVG--ISRVRAGHKTQQGDASPVWSGVCFLVCGLCGMLCAKKRTGLVMILFSACCICGLIGGILNFQFVRALV------------KRPDTLHLAAMSLACLGISSCTLSTWLTCRLASSEQQRMFLERE 144          
BLAST of Transmembrane protein 196 vs. Ensembl Cavefish
Match: tmem196b (transmembrane protein 196b [Source:ZFIN;Acc:ZDB-GENE-110914-248])

HSP 1 Score: 46.595 bits (109), Expect = 6.416e-6
Identity = 47/155 (30.32%), Postives = 76/155 (49.03%), Query Frame = 2
Query:  161 RSVVLIVVGLSVMHILMGVVSICLGTISSIKGKIWMAH--KVSPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVS----CRLSTLVKLRMLDESE 607
            + +V  +V +S+    +GV S+ LG +  ++G +   H    +PIWSG  F++ G+ GLL  R +T   M+ ++A  +   +  I+ IQ  R         G   R D +  L L +L   S  C +  GGC +S    CRL++  + RM  E E
Sbjct:    5 QKIVWSLVMISLFETGVGVASVILGVLE-LQGVMQQTHLSTATPIWSGVFFLLCGLCGLLCARKRTGLTMILFSACCICGLIGGILNIQFVR---------GYARRMDAVPPLHLASL---SLAC-IGIGGCILSTWLTCRLASSEQQRMFIERE 145          
BLAST of Transmembrane protein 196 vs. Ensembl Medaka
Match: ENSORLT00000004991.2 (transmembrane protein 196 [Source:NCBI gene;Acc:101167632])

HSP 1 Score: 56.225 bits (134), Expect = 3.075e-9
Identity = 45/147 (30.61%), Postives = 70/147 (47.62%), Query Frame = 2
Query:  182 VGLSVMHILMGVVSICLGTISSIKGKIWMAHK-----VSPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESE 607
            VGL V  I++G V I     S ++G+    HK      SP+WSG  F+V G+ G+L  R +T  IM+ ++A  +   +  I+  Q  R          +   K  +  + L  LGISS     C    +++CRL++  + RM  E E
Sbjct:   19 VGLGVASIVLGAVGI-----SWVRGE----HKPRQGDASPVWSGLCFLVCGICGVLCARRRTGLIMILFSACCICGLIGGILNFQFVR-------ALSKQPSKMHLAAMTLACLGISS-----CTLSTWLTCRLASSEQQRMFMERE 144          
BLAST of Transmembrane protein 196 vs. Ensembl Medaka
Match: ENSORLT00000031093.1 (transmembrane protein 196 [Source:NCBI gene;Acc:101167632])

HSP 1 Score: 56.225 bits (134), Expect = 4.948e-9
Identity = 45/147 (30.61%), Postives = 70/147 (47.62%), Query Frame = 2
Query:  182 VGLSVMHILMGVVSICLGTISSIKGKIWMAHK-----VSPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESE 607
            VGL V  I++G V I     S ++G+    HK      SP+WSG  F+V G+ G+L  R +T  IM+ ++A  +   +  I+  Q  R          +   K  +  + L  LGISS     C    +++CRL++  + RM  E E
Sbjct:   19 VGLGVASIVLGAVGI-----SWVRGE----HKPRQGDASPVWSGLCFLVCGICGVLCARRRTGLIMILFSACCICGLIGGILNFQFVR-------ALSKQPSKMHLAAMTLACLGISS-----CTLSTWLTCRLASSEQQRMFMERE 144          
BLAST of Transmembrane protein 196 vs. Planmine SMEST
Match: SMESG000026737.1 (SMESG000026737.1)

HSP 1 Score: 307.375 bits (786), Expect = 2.359e-106
Identity = 149/149 (100.00%), Postives = 149/149 (100.00%), Query Frame = 2
Query:  362 MLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESEGPFIVEIYGDKDVEIIPHKKLQKYRTATEGSMASSVNRLGNTSRPHSMLDTQIIVNEAAEEISLVEE 808
            MLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESEGPFIVEIYGDKDVEIIPHKKLQKYRTATEGSMASSVNRLGNTSRPHSMLDTQIIVNEAAEEISLVEE
Sbjct:    1 MLCYTASTLVSFVCAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGCFVSCRLSTLVKLRMLDESEGPFIVEIYGDKDVEIIPHKKLQKYRTATEGSMASSVNRLGNTSRPHSMLDTQIIVNEAAEEISLVEE 149          
BLAST of Transmembrane protein 196 vs. Planmine SMEST
Match: SMESG000026736.1 (SMESG000026736.1)

HSP 1 Score: 65.4698 bits (158), Expect = 5.468e-14
Identity = 32/32 (100.00%), Postives = 32/32 (100.00%), Query Frame = 1
Query:  889 ISSDIAKNRELEAKIFKVITVRSPIHEELFHL 984
            ISSDIAKNRELEAKIFKVITVRSPIHEELFHL
Sbjct:   21 ISSDIAKNRELEAKIFKVITVRSPIHEELFHL 52          

HSP 2 Score: 30.4166 bits (67), Expect = 5.468e-14
Identity = 12/13 (92.31%), Postives = 13/13 (100.00%), Query Frame = 2
Query:  809 NPSEEETRMLMEV 847
            NPSEEETRMLME+
Sbjct:    9 NPSEEETRMLMEI 21          
The following BLAST results are available for this feature:
BLAST of Transmembrane protein 196 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 196 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 196 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 196 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
FO904989.11.109e-1231.17transmembrane protein 196 [Source:NCBI gene;Acc:79... [more]
tmem196b1.243e-626.79transmembrane protein 196b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Transmembrane protein 196 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tmem1961.930e-824.34transmembrane protein 196 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 196 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tmem1962.290e-830.20transmembrane protein 196 [Source:MGI Symbol;Acc:M... [more]
Tmem1961.329e-631.30transmembrane protein 196 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Transmembrane protein 196 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|A4IIU3|TM196_XENTR1.022e-724.34Transmembrane protein 196 OS=Xenopus tropicalis OX... [more]
sp|Q5HYL7|TM196_HUMAN4.273e-728.86Transmembrane protein 196 OS=Homo sapiens OX=9606 ... [more]
back to top
BLAST of Transmembrane protein 196 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GVV65.883e-5050.59Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FGE37.297e-4951.14Uncharacterized protein OS=Macrostomum lignano OX=... [more]
R7UCT98.536e-4748.43Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1I8I4H21.151e-4652.41Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3IJU11.576e-4547.10uncharacterized protein LOC106164882 OS=Lingula un... [more]
back to top
BLAST of Transmembrane protein 196 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000031080.12.930e-925.97transmembrane protein 196 [Source:NCBI gene;Acc:10... [more]
tmem196b6.416e-630.32transmembrane protein 196b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Transmembrane protein 196 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 196 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 196 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Transmembrane protein 196 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000004991.23.075e-930.61transmembrane protein 196 [Source:NCBI gene;Acc:10... [more]
ENSORLT00000031093.14.948e-930.61transmembrane protein 196 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Transmembrane protein 196 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000026737.12.359e-106100.00SMESG000026737.1[more]
SMESG000026736.15.468e-14100.00SMESG000026736.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014270 ID=SMED30014270|Name=Transmembrane protein 196|organism=Schmidtea mediterranea sexual|type=transcript|length=986bp
TTCAAATTCTAAAGATTGAAACACACTCACGTGGTTGTATGTATAATTAA
TTTGTGTGTTTGAGAAGAGATAGGAAGTGTAAATTAAGATTGATTTTATT
ATGATGAAAACTACTCCAATTTTTTCGAGTAAAACAAAATTATGTTCTTG
TTTACAATATCGTTCTGTAGTTCTTATAGTTGTTGGTTTATCCGTAATGC
ATATATTAATGGGCGTAGTTTCAATTTGTCTTGGGACCATCAGTAGCATA
AAAGGGAAAATATGGATGGCTCATAAAGTATCTCCTATATGGAGCGGAGC
AGTATTCATTGTTACCGGTGTCATTGGATTATTGTCGCTCAGATATCAAA
CTTCTTACATTATGCTTTGTTACACTGCGTCAACGCTCGTATCGTTTGTC
TGTGCTATTGTTGGCATACAGCTATCAAGATTAGGAATCGTGAATCATAC
GACTGATGGACAGACCTTTCGGAAAGACAAAATGGATACTCTTCTTTTGG
TAACTCTTGGAATAAGTAGTTTTGAATGTCTAGTGTGTTTTGGAGGATGT
TTTGTGAGTTGTCGGTTAAGTACACTTGTAAAGTTACGGATGCTCGACGA
AAGTGAAGGACCATTTATAGTGGAAATATACGGTGATAAAGATGTTGAAA
TAATTCCTCACAAGAAACTTCAAAAATACAGAACTGCTACAGAAGGCTCA
ATGGCCAGTTCAGTCAATCGGCTTGGCAACACCAGCCGACCACACTCAAT
GTTGGATACTCAAATAATAGTTAATGAAGCTGCGGAAGAAATATCTTTAG
TCGAAGAGAATCCAAGCGAGGAGGAAACTAGAATGTTAATGGAGGTAATG
GAGGGTTATGTGATCACTTTTGATTCTATATTGTGTAGATCAGTTCAGAT
ATTGCCAAGAACAGAGAATTGGAAGCAAAGATTTTCAAAGTTATAACAGT
AAGATCTCCAATTCACGAAGAACTTTTTCATTTAGC
back to top

protein sequence of SMED30014270-orf-1

>SMED30014270-orf-1 ID=SMED30014270-orf-1|Name=SMED30014270-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=282bp
MMKTTPIFSSKTKLCSCLQYRSVVLIVVGLSVMHILMGVVSICLGTISSI
KGKIWMAHKVSPIWSGAVFIVTGVIGLLSLRYQTSYIMLCYTASTLVSFV
CAIVGIQLSRLGIVNHTTDGQTFRKDKMDTLLLVTLGISSFECLVCFGGC
FVSCRLSTLVKLRMLDESEGPFIVEIYGDKDVEIIPHKKLQKYRTATEGS
MASSVNRLGNTSRPHSMLDTQIIVNEAAEEISLVEENPSEEETRMLMEVM
EGYVITFDSILCRSVQILPRTENWKQRFSKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR037661TMEM196
IPR007237CD20-like
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007237CD20-like familyPFAMPF04103CD20coord: 30..119
e-value: 3.3E-11
score: 43.5
IPR037661Transmembrane protein 196PANTHERPTHR28681FAMILY NOT NAMEDcoord: 21..176
NoneNo IPR availableTMHMMTMhelixcoord: 89..111
NoneNo IPR availableTMHMMTMhelixcoord: 60..82
NoneNo IPR availableTMHMMTMhelixcoord: 23..45
NoneNo IPR availableTMHMMTMhelixcoord: 131..153