Retrovirus-related Pol polyprotein from transposon opus

Overview
NameRetrovirus-related Pol polyprotein from transposon opus
Smed IDSMED30014267
Length (bp)645
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Retrovirus-related Pol polyprotein from transposon opus (SMED30014267) t-SNE clustered cells

Violin plots show distribution of expression levels for Retrovirus-related Pol polyprotein from transposon opus (SMED30014267) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Retrovirus-related Pol polyprotein from transposon opus (SMED30014267) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Retrovirus-related Pol polyprotein from transposon opus (SMED30014267) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014267

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30014267 dd_Smed_v4_13905_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30014267 dd_Smed_v4_13905_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Zebrafish
Match: BX890543.1 (pep chromosome:GRCz11:14:42224893:42231293:-1 gene:ENSDARG00000114583.1 transcript:ENSDART00000185486.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX890543.1)

HSP 1 Score: 48.9062 bits (115), Expect = 1.745e-6
Identity = 22/77 (28.57%), Postives = 42/77 (54.55%), Query Frame = 3
Query:  315 ALNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFH 545
             LN++T +  +P+       +    A   + ++  NAY+ V++ E  + KTAF+T    + + ++PFG+  APA+F 
Sbjct:  571 GLNDITVKNRYPLPLMSSAFELLQGAKVFTKLDLRNAYHLVRIREGDEWKTAFNTPTGHFEYRVLPFGLTNAPAVFQ 647          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Zebrafish
Match: BX511082.1 (pep chromosome:GRCz11:9:14291932:14297132:1 gene:ENSDARG00000113678.1 transcript:ENSDART00000183119.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX511082.1)

HSP 1 Score: 48.1358 bits (113), Expect = 3.794e-6
Identity = 22/77 (28.57%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  315 ALNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFH 545
             LN +T +  +P+       +    A+  + ++  NAY+ V++ E  + KTAF+T    + + ++PFG++ APA+F 
Sbjct:  582 GLNAITVKNTYPLPLMSSAFERLQGASFFTKLDLRNAYHLVRIREGDEWKTAFNTPRGHFEYCVLPFGLSNAPAVFQ 658          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Zebrafish
Match: FO704673.1 (pep chromosome:GRCz11:12:14545475:14551077:-1 gene:ENSDARG00000112601.1 transcript:ENSDART00000188717.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:FO704673.1)

HSP 1 Score: 47.7506 bits (112), Expect = 4.697e-6
Identity = 23/77 (29.87%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  315 ALNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFH 545
             LNN+T +  +P+      ++   EA   + ++  +AY  +++ E  + KTAF T    Y + +MP+G+A +PA+F 
Sbjct:  561 GLNNITVKYRYPLPLVPPALEQLREARIYTKLDLRSAYNLIRIREGDEWKTAFLTTRGHYEYLVMPYGLANSPAVFQ 637          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 60.4622 bits (145), Expect = 1.867e-14
Identity = 28/77 (36.36%), Postives = 45/77 (58.44%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            LN+VT    +P+ +  EL+D  G A  ++T++    Y+Q+ L   ++ K+AF T    Y F +MPFG+  APA F +
Sbjct:  396 LNDVTTTDAYPMPRVDELLDRLGNAKYLTTLDLSRGYWQIPLAPSAQEKSAFLTPFGLYQFTVMPFGMRNAPATFQR 472          

HSP 2 Score: 37.3502 bits (85), Expect = 1.867e-14
Identity = 16/38 (42.11%), Postives = 22/38 (57.89%), Query Frame = 1
Query:  208 MEHFGIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            M  FG+I   HSPW  P+V   +KD    R C+++R L
Sbjct:  360 MLAFGVITPSHSPWASPVVLVPKKD-GSTRFCVDYRRL 396          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Xenopus
Match: alkbh5 (alkB homolog 5, RNA demethylase [Source:Xenbase;Acc:XB-GENE-987580])

HSP 1 Score: 66.2402 bits (160), Expect = 1.929e-14
Identity = 30/77 (38.96%), Postives = 48/77 (62.34%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            LN V++   +P+ +  ELI+  G+A  ++T++    Y+QV L E +K KTAFST   Q+ +  +PFG+  APA F +
Sbjct:  294 LNEVSKFDAYPMPRVDELIERLGQARYITTLDLTKGYWQVPLTEGAKEKTAFSTPEGQWQYKRLPFGLHGAPATFQR 370          

HSP 2 Score: 31.5722 bits (70), Expect = 1.929e-14
Identity = 15/38 (39.47%), Postives = 21/38 (55.26%), Query Frame = 1
Query:  208 MEHFGIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            M    +I+E HS W+ P+V   + D   IR C +FR L
Sbjct:  258 MLELDVIEESHSEWSSPIVLVPKPD-GSIRFCNDFRKL 294          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Xenopus
Match: ENSXETT00000037253.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:109420360:109422640:1 gene:ENSXETG00000015234.1 transcript:ENSXETT00000037253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 3.600e-8
Identity = 26/78 (33.33%), Postives = 44/78 (56.41%), Query Frame = 3
Query:  315 ALNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
             LN +T +  +P+    EL D    A   S ++   AY  +++ E  + KTAF+T++  Y + +MPFG+  APA+F +
Sbjct:  578 GLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQE 655          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Xenopus
Match: denr (density-regulated protein [Source:Xenbase;Acc:XB-GENE-1002798])

HSP 1 Score: 54.299 bits (129), Expect = 3.848e-8
Identity = 26/78 (33.33%), Postives = 44/78 (56.41%), Query Frame = 3
Query:  315 ALNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
             LN +T +  +P+    EL D    A   S ++   AY  +++ E  + KTAF+T++  Y + +MPFG+  APA+F +
Sbjct:  578 GLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQE 655          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Xenopus
Match: castor1 (cytosolic arginine sensor for mTORC1 subunit 1 [Source:Xenbase;Acc:XB-GENE-960689])

HSP 1 Score: 54.299 bits (129), Expect = 3.923e-8
Identity = 26/78 (33.33%), Postives = 44/78 (56.41%), Query Frame = 3
Query:  315 ALNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
             LN +T +  +P+    EL D    A   S ++   AY  +++ E  + KTAF+T++  Y + +MPFG+  APA+F +
Sbjct:  578 GLNKITVKNRYPLPLISELFDQLKGAKIFSKLDLRGAYNLIRIREGDEWKTAFNTRDGHYEYLVMPFGLCNAPAVFQE 655          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. UniProt/SwissProt
Match: sp|P20825|POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 5.968e-11
Identity = 30/77 (38.96%), Postives = 46/77 (59.74%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            LN +T    +PI    E++   G+    +TI+    ++Q+++DEES  KTAFSTK+  Y +  MPFG+  APA F +
Sbjct:  270 LNEITIPDRYPIPNMDEILGKLGKCQYFTTIDLAKGFHQIEMDEESISKTAFSTKSGHYEYLRMPFGLRNAPATFQR 346          

HSP 2 Score: 25.7942 bits (55), Expect = 5.968e-11
Identity = 13/38 (34.21%), Postives = 23/38 (60.53%), Query Frame = 1
Query:  220 GIIKECHSPWNKPL-VCGKRKD---KDDIRICLEFRHL 321
            G+I+E +SP+N P  V  K+ D    +  R+ +++R L
Sbjct:  233 GLIRESNSPYNSPTWVVPKKPDASGANKYRVVIDYRKL 270          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. UniProt/SwissProt
Match: sp|P04323|POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 58.9214 bits (141), Expect = 6.318e-11
Identity = 29/77 (37.66%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            LN +T     PI    E++   G     +TI+    ++Q+++D ES  KTAFSTK+  Y +  MPFG+  APA F +
Sbjct:  271 LNEITVGDRHPIPNMDEILGKLGRCNYFTTIDLAKGFHQIEMDPESVSKTAFSTKHGHYEYLRMPFGLKNAPATFQR 347          

HSP 2 Score: 28.8758 bits (63), Expect = 6.318e-11
Identity = 15/38 (39.47%), Postives = 24/38 (63.16%), Query Frame = 1
Query:  220 GIIKECHSPWNKPL-VCGKRKD---KDDIRICLEFRHL 321
            GII+  +SP+N P+ V  K++D   K   RI +++R L
Sbjct:  234 GIIRTSNSPYNSPIWVVPKKQDASGKQKFRIVIDYRKL 271          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. UniProt/SwissProt
Match: sp|Q8I7P9|POL5_DROME (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 3.775e-8
Identity = 28/77 (36.36%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            LN VT    +PI      + + G A   +T++  + ++Q+ + E    KTAFST N +Y F  +PFG+  APAIF +
Sbjct:  187 LNTVTIPDTYPIPDINATLASLGNAKYFTTLDLTSGFHQIHMKESDIPKTAFSTLNGKYEFLRLPFGLKNAPAIFQR 263          

HSP 2 Score: 24.2534 bits (51), Expect = 3.775e-8
Identity = 12/38 (31.58%), Postives = 22/38 (57.89%), Query Frame = 1
Query:  220 GIIKECHSPWNKPLVCGKRKDKDD----IRICLEFRHL 321
            GII+  +SP+N P+    +K K +     R+ ++F+ L
Sbjct:  150 GIIRPSNSPYNSPIWIVPKKPKPNGEKQYRMVVDFKRL 187          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. UniProt/SwissProt
Match: sp|P10394|POL4_DROME (Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster OX=7227 GN=POL PE=4 SV=1)

HSP 1 Score: 54.6842 bits (130), Expect = 1.584e-7
Identity = 24/68 (35.29%), Postives = 41/68 (60.29%), Query Frame = 3
Query:  345 FPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            FP+ +  +++D  G A   S ++  + ++Q++LDE S+  T+FST N  Y F  +PFG+  AP  F +
Sbjct:  388 FPLPRIDDILDQLGRAKYFSCLDLMSGFHQIELDEGSRDITSFSTSNGSYRFTRLPFGLKIAPNSFQR 455          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. UniProt/SwissProt
Match: sp|Q7LHG5|YI31B_YEAST (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2)

HSP 1 Score: 54.6842 bits (130), Expect = 1.774e-7
Identity = 24/77 (31.17%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            LN  T    FP+ +   L+   G A   +T++  + Y+Q+ ++ + + KTAF T + +Y + +MPFG+  AP+ F +
Sbjct:  681 LNKATISDPFPLPRIDNLLSRIGNAQIFTTLDLHSGYHQIPMEPKDRYKTAFVTPSGKYEYTVMPFGLVNAPSTFAR 757          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. TrEMBL
Match: A0A1X7SFT9 (Reverse transcriptase domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 2.105e-15
Identity = 32/87 (36.78%), Postives = 56/87 (64.37%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHKTNEYGVRWTQ 578
            LN VT+   +P+ + +EL+DT G+A  ++T++    Y+QV +D++ + KTAF++    Y F  MPFG++ APA F +  +  +R T+
Sbjct:  151 LNQVTKFDAYPMPRVEELLDTIGDAEFITTLDLAKGYWQVPVDKKDREKTAFTSPRGLYQFKTMPFGLSGAPATFQRMMDEILRGTE 237          

HSP 2 Score: 37.7354 bits (86), Expect = 2.105e-15
Identity = 18/38 (47.37%), Postives = 25/38 (65.79%), Query Frame = 1
Query:  208 MEHFGIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            ME  GII++  S W  PLV  K+KD   IR+C+++R L
Sbjct:  115 MERDGIIEKSSSEWASPLVIVKKKD-GGIRLCVDYRQL 151          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. TrEMBL
Match: A0A1X7SFW8 (Reverse transcriptase domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.353e-15
Identity = 32/87 (36.78%), Postives = 56/87 (64.37%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHKTNEYGVRWTQ 578
            LN VT+   +P+ + +EL+DT G+A  ++T++    Y+QV ++E+ + KTAF++    Y F  MPFG++ APA F +  +  +R T+
Sbjct:   43 LNQVTKFDAYPMPRVEELLDTIGDAEFITTLDLAKGYWQVPVNEKDREKTAFTSPRGLYQFKTMPFGLSGAPATFQRMMDEILRGTE 129          

HSP 2 Score: 37.7354 bits (86), Expect = 2.353e-15
Identity = 18/38 (47.37%), Postives = 25/38 (65.79%), Query Frame = 1
Query:  208 MEHFGIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            ME  GII++  S W  PLV  K+KD   IR+C+++R L
Sbjct:    7 MERDGIIEKSSSEWASPLVIVKKKD-GGIRLCVDYRQL 43          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. TrEMBL
Match: A0A1X7SFX7 (Reverse transcriptase domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 2.688e-15
Identity = 32/87 (36.78%), Postives = 56/87 (64.37%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHKTNEYGVRWTQ 578
            LN VT+   +P+ + +EL+DT G+A  ++T++    Y+QV ++E+ + KTAF++    Y F  MPFG++ APA F +  +  +R T+
Sbjct:   96 LNQVTKFDAYPMPRVEELLDTIGDAEFITTLDLAKGYWQVPVNEKDREKTAFTSPQGLYQFKTMPFGLSGAPATFQRMMDEILRGTE 182          

HSP 2 Score: 37.7354 bits (86), Expect = 2.688e-15
Identity = 18/38 (47.37%), Postives = 25/38 (65.79%), Query Frame = 1
Query:  208 MEHFGIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            ME  GII++  S W  PLV  K+KD   IR+C+++R L
Sbjct:   60 MERDGIIEKSSSEWASPLVIVKKKD-GGIRLCVDYRQL 96          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. TrEMBL
Match: A0A1X7T3B8 (Reverse transcriptase domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.165e-15
Identity = 32/87 (36.78%), Postives = 56/87 (64.37%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHKTNEYGVRWTQ 578
            LN VT+   +P+ + +EL+DT G+A  ++T++    Y+QV ++E+ + KTAF++    Y F  MPFG++ APA F +  +  +R T+
Sbjct:  298 LNQVTKFDAYPMPRVEELLDTIGDAEFITTLDLAKGYWQVPVNEKDREKTAFTSPRGLYQFKTMPFGLSGAPATFQRMMDEILRGTE 384          

HSP 2 Score: 37.7354 bits (86), Expect = 3.165e-15
Identity = 18/38 (47.37%), Postives = 25/38 (65.79%), Query Frame = 1
Query:  208 MEHFGIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            ME  GII++  S W  PLV  K+KD   IR+C+++R L
Sbjct:  262 MERDGIIEKSSSEWASPLVIVKKKD-GGIRLCVDYRQL 298          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. TrEMBL
Match: A0A1X7U0T5 (Reverse transcriptase domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 3.707e-15
Identity = 32/87 (36.78%), Postives = 56/87 (64.37%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHKTNEYGVRWTQ 578
            LN VT+   +P+ + +EL+DT G+A  ++T++    Y+QV ++E+ + KTAF++    Y F  MPFG++ APA F +  +  +R T+
Sbjct:  298 LNQVTKFDAYPMPRVEELLDTIGDAEFITTLDLAKGYWQVPVNEKDREKTAFTSPRGLYQFKTMPFGLSGAPATFQRMMDEILRGTE 384          

HSP 2 Score: 37.3502 bits (85), Expect = 3.707e-15
Identity = 17/38 (44.74%), Postives = 25/38 (65.79%), Query Frame = 1
Query:  208 MEHFGIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            ME  G+I++  S W  PLV  K+KD   IR+C+++R L
Sbjct:  262 MERDGVIEKSSSEWASPLVIVKKKD-GGIRLCVDYRQL 298          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Cavefish
Match: ENSAMXT00000034038.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:3120146:3124090:1 gene:ENSAMXG00000040885.1 transcript:ENSAMXT00000034038.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 3.427e-14
Identity = 29/77 (37.66%), Postives = 47/77 (61.04%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            LN+ + R  FP+ + +E ++  GEA   ST++  + Y+QV++ E  K KTAFST    +  N MPFG+  +P+ F +
Sbjct:  297 LNSCSTRDAFPLPRVEEALEALGEAKYFSTLDLTSGYWQVEVAEADKHKTAFSTPMGLFEANRMPFGLQNSPSTFQR 373          

HSP 2 Score: 34.6538 bits (78), Expect = 3.427e-14
Identity = 15/38 (39.47%), Postives = 24/38 (63.16%), Query Frame = 1
Query:  208 MEHFGIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            ME  G+I+   SP+  P+V   +KD   +RIC+++R L
Sbjct:  261 MEEAGVIRPSKSPYASPIVVVTKKD-GSLRICMDYRKL 297          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Cavefish
Match: ENSAMXT00000038088.1 (pep primary_assembly:Astyanax_mexicanus-2.0:23:13869500:13874588:-1 gene:ENSAMXG00000037864.1 transcript:ENSAMXT00000038088.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 1.595e-13
Identity = 29/84 (34.52%), Postives = 49/84 (58.33%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHKTNEYGVR 569
            LN VT +  FP+ + +E + T  +A   +T++  + Y+QV +  + + KTAF+T    Y F  MPFG+  APA F +  ++ +R
Sbjct:  396 LNAVTHKDAFPLPRIEETLTTLTQAEWFTTLDLASGYWQVGVHPDDQPKTAFATPLGLYHFRRMPFGLCNAPATFQRLMQHCLR 479          

HSP 2 Score: 33.113 bits (74), Expect = 1.595e-13
Identity = 14/34 (41.18%), Postives = 21/34 (61.76%), Query Frame = 1
Query:  220 GIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            G+I E  SPW  P+V  ++KD    R C+++R L
Sbjct:  364 GVISESSSPWAAPVVMVRKKD-GSWRFCVDYRKL 396          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Cavefish
Match: ENSAMXT00000044431.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000182.1:892613:897532:1 gene:ENSAMXG00000038169.1 transcript:ENSAMXT00000044431.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 1.951e-13
Identity = 31/84 (36.90%), Postives = 48/84 (57.14%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHKTNEYGVR 569
            LN V+    +PI +  +LID  G A  +ST +    Y+QV L  ++K KTAFST +  + +  +PFG+  APA F +  +  +R
Sbjct:  828 LNKVSAFDSYPIPRIDDLIDRLGTARFISTFDLTKGYWQVPLSPQAKPKTAFSTPSGHWHYRFLPFGLHGAPATFQRLMDVVLR 911          

HSP 2 Score: 30.4166 bits (67), Expect = 1.951e-13
Identity = 15/38 (39.47%), Postives = 20/38 (52.63%), Query Frame = 1
Query:  208 MEHFGIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            M   GII+   SPW+ P+V   + D    R C +FR L
Sbjct:  792 MLEMGIIEPSDSPWSSPIVLVPKPD-GSWRFCNDFRRL 828          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Cavefish
Match: ENSAMXT00000037150.1 (pep primary_assembly:Astyanax_mexicanus-2.0:10:22265216:22268869:1 gene:ENSAMXG00000033912.1 transcript:ENSAMXT00000037150.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 3.523e-12
Identity = 30/80 (37.50%), Postives = 44/80 (55.00%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHKTNE 557
            LN  T R  +P+ + +E +D    A   ST++  + Y QV + E+ + KTAF T    + FN MPFG+  APA F +  E
Sbjct:  382 LNAKTRRDAYPLPRIEESLDALAGAKWFSTLDLASGYNQVPVSEKDRYKTAFCTPFGLFEFNRMPFGLCNAPATFQRLME 461          

HSP 2 Score: 29.261 bits (64), Expect = 3.523e-12
Identity = 11/33 (33.33%), Postives = 22/33 (66.67%), Query Frame = 1
Query:  223 IIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            +I+   SP++ P+V   +KD   +R+C+++R L
Sbjct:  351 VIRNSASPYSSPIVLVTKKD-GSLRLCVDYRQL 382          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Cavefish
Match: ENSAMXT00000041754.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001938.1:55959:59870:1 gene:ENSAMXG00000043385.1 transcript:ENSAMXT00000041754.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 3.878e-12
Identity = 30/80 (37.50%), Postives = 44/80 (55.00%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHKTNE 557
            LN  T R  +P+ + +E +D    A   ST++  + Y QV ++E+ K KTAF T    + FN MPFG+  AP  F +  E
Sbjct:  366 LNAKTRRDSYPLPRIEESLDALCGAKWFSTLDLASGYNQVPVEEKDKSKTAFCTPFGLFEFNRMPFGLCNAPGTFQRLME 445          

HSP 2 Score: 31.187 bits (69), Expect = 3.878e-12
Identity = 12/33 (36.36%), Postives = 23/33 (69.70%), Query Frame = 1
Query:  223 IIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            +I+E  SP++ P+V   +KD   +R+C+++R L
Sbjct:  335 VIRESSSPFSSPIVLVTKKD-GSLRLCVDYRQL 366          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Medaka
Match: ENSORLT00000038047.1 (pep primary_assembly:ASM223467v1:5:20995901:21001966:-1 gene:ENSORLG00000030265.1 transcript:ENSORLT00000038047.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.822e-13
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            LN V+E   +P+ +  +L++  G A  ++T++    Y+QV L    +  TAF T    + F +MPFG+  APA F +
Sbjct: 1135 LNAVSEFDAYPMPRIDDLLEKIGAANFITTLDLCKGYWQVPLSNTCRPYTAFKTPAGLFQFTVMPFGLHGAPATFQR 1211          

HSP 2 Score: 37.3502 bits (85), Expect = 1.822e-13
Identity = 16/38 (42.11%), Postives = 25/38 (65.79%), Query Frame = 1
Query:  208 MEHFGIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            M   G+I+  +S W+ P+V   +KD D +RIC++FR L
Sbjct: 1099 MLELGVIEPSNSEWSSPVVIVPKKD-DSLRICIDFRKL 1135          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Medaka
Match: ENSORLT00000040552.1 (pep primary_assembly:ASM223467v1:6:4563337:4567860:1 gene:ENSORLG00000025739.1 transcript:ENSORLT00000040552.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.898e-13
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            LN V+E   +P+ +  +L++  G A  ++T++    Y+QV L    +  TAF T    + F +MPFG+  APA F +
Sbjct: 1135 LNAVSEFDAYPMPRIDDLLEKIGAANFITTLDLCKGYWQVPLSNTCRPYTAFKTPAGLFQFTVMPFGLHGAPATFQR 1211          

HSP 2 Score: 37.3502 bits (85), Expect = 1.898e-13
Identity = 16/38 (42.11%), Postives = 25/38 (65.79%), Query Frame = 1
Query:  208 MEHFGIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            M   G+I+  +S W+ P+V   +KD D +RIC++FR L
Sbjct: 1099 MLELGVIEPSNSEWSSPVVIVPKKD-DSLRICIDFRKL 1135          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Medaka
Match: ENSORLT00000030651.1 (pep primary_assembly:ASM223467v1:5:21308959:21315033:-1 gene:ENSORLG00000024220.1 transcript:ENSORLT00000030651.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 1.898e-13
Identity = 26/77 (33.77%), Postives = 43/77 (55.84%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            LN V+E   +P+ +  +L++  G A  ++T++    Y+QV L    +  TAF T    + F +MPFG+  APA F +
Sbjct: 1134 LNAVSEFDAYPMPRIDDLLEKIGAANFITTLDLCKGYWQVPLSNTCRPYTAFKTPAGLFQFTVMPFGLHGAPATFQR 1210          

HSP 2 Score: 37.3502 bits (85), Expect = 1.898e-13
Identity = 16/38 (42.11%), Postives = 25/38 (65.79%), Query Frame = 1
Query:  208 MEHFGIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            M   G+I+  +S W+ P+V   +KD D +RIC++FR L
Sbjct: 1098 MLELGVIEPSNSEWSSPVVIVPKKD-DSLRICIDFRKL 1134          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Medaka
Match: ENSORLT00000045141.1 (pep primary_assembly:ASM223467v1:23:22495254:22500491:-1 gene:ENSORLG00000029628.1 transcript:ENSORLT00000045141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 2.376e-13
Identity = 28/77 (36.36%), Postives = 46/77 (59.74%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            LN VT +  +P+ + +E +D  G+A   ST++    Y+QV ++EE + KTA +T    + +  MPFG+  APA F +
Sbjct:  778 LNQVTCKDAYPLPRVEEALDALGDAHLFSTLDLTAGYFQVAMNEEDQGKTAVTTPFGLFEWTRMPFGLCNAPATFQR 854          

HSP 2 Score: 33.113 bits (74), Expect = 2.376e-13
Identity = 15/34 (44.12%), Postives = 20/34 (58.82%), Query Frame = 1
Query:  220 GIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            GI+KE  SPW  P V   +KD   +R C ++R L
Sbjct:  746 GILKESTSPWASPAVIVIKKD-GSVRFCCDYRRL 778          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Medaka
Match: ENSORLT00000034492.1 (pep primary_assembly:ASM223467v1:15:13490768:13497120:-1 gene:ENSORLG00000024904.1 transcript:ENSORLT00000034492.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 6.885e-13
Identity = 27/77 (35.06%), Postives = 46/77 (59.74%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            LN+V+E   +P+ +  +L++  G A  ++T++    Y+QV L   S+  TAF T +  + F +MPFG+  APA F +
Sbjct: 1101 LNSVSEFDAYPMPRIDDLLEKIGSAAYITTLDMCKGYWQVPLAASSRPYTAFQTPSGLFQFTVMPFGLHGAPATFQR 1177          

HSP 2 Score: 31.5722 bits (70), Expect = 6.885e-13
Identity = 14/34 (41.18%), Postives = 22/34 (64.71%), Query Frame = 1
Query:  220 GIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            G+I+  +S W  P+V   +KD   +RIC++FR L
Sbjct: 1069 GVIEPSNSEWCSPVVIVTKKD-GSLRICIDFRKL 1101          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Planmine SMEST
Match: SMESG000029259.1 (SMESG000029259.1)

HSP 1 Score: 89.3521 bits (220), Expect = 6.359e-30
Identity = 42/77 (54.55%), Postives = 54/77 (70.13%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            LN +TER  FP+    E++D    +   S+I+ GNAYYQVKLD+ES+ KTAFSTK  Q+ FN MPFG+AAAP  F +
Sbjct: 2787 LNKITERQAFPMPNVDEILDILHGSRYFSSIDLGNAYYQVKLDKESQEKTAFSTKEGQFCFNRMPFGIAAAPGTFQE 2863          

HSP 2 Score: 59.3066 bits (142), Expect = 6.359e-30
Identity = 23/38 (60.53%), Postives = 32/38 (84.21%), Query Frame = 1
Query:  208 MEHFGIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            +E+ GII++C+SPWN PLVC  +K+K DIR+CL+FR L
Sbjct: 2750 LENNGIIRKCNSPWNTPLVCVWKKEKKDIRLCLDFRQL 2787          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Planmine SMEST
Match: SMESG000013664.1 (SMESG000013664.1)

HSP 1 Score: 87.8113 bits (216), Expect = 3.080e-23
Identity = 43/79 (54.43%), Postives = 55/79 (69.62%), Query Frame = 3
Query:  315 ALNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHKT 551
            ALN VTE PIFPI  T+E++D    A   +T++ GNAYYQV+L +ES+LKTAFST N QY FN MPFG+     + +K 
Sbjct:  418 ALNWVTEIPIFPIPNTQEMLDILYGAKYFNTLDLGNAYYQVELQDESRLKTAFSTNNTQYCFNRMPFGIVTFQKLMNKV 496          

HSP 2 Score: 38.5058 bits (88), Expect = 3.080e-23
Identity = 16/25 (64.00%), Postives = 21/25 (84.00%), Query Frame = 1
Query:  247 WNKPLVCGKRKDKDDIRICLEFRHL 321
            +N PLVC K KDK++IRICL++R L
Sbjct:  395 FNSPLVCVKMKDKNEIRICLDYRAL 419          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Planmine SMEST
Match: SMESG000029866.1 (SMESG000029866.1)

HSP 1 Score: 72.4034 bits (176), Expect = 5.195e-22
Identity = 34/67 (50.75%), Postives = 48/67 (71.64%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFG 518
            LN  +ERPIFPI   +E++D+   A   +T++ G+ +YQ++LDE SKLKTAF+TK+KQY    MPF 
Sbjct:  139 LNKSSERPIFPIPNIEEILDSIYGAKYFTTVDLGSVFYQIELDESSKLKTAFATKSKQYCSYRMPFD 205          

HSP 2 Score: 49.6766 bits (117), Expect = 5.195e-22
Identity = 21/32 (65.62%), Postives = 27/32 (84.38%), Query Frame = 1
Query:  217 FGIIKECHSPWNKPLVCGKRKDKDDIRICLEF 312
            +GIIKE  SPWN PLVC K+KD ++IR+CL+F
Sbjct:  105 YGIIKEFTSPWNTPLVCIKKKDCENIRLCLDF 136          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Planmine SMEST
Match: SMESG000049864.1 (SMESG000049864.1)

HSP 1 Score: 80.4925 bits (197), Expect = 2.570e-21
Identity = 42/96 (43.75%), Postives = 63/96 (65.62%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHKTNEYGVRWTQLENSSGISR 605
            LN+VTE+  FP+   + L++  G++   S+I+ G AYYQV+L+E S++KTAF  K  Q+ FN +PFG++ APAI  K  E+G       N+ G+SR
Sbjct:  735 LNSVTEKFSFPMTDKQLLLNRLGKSNIFSSIDLGQAYYQVELNENSQIKTAFCKKEGQFCFNRLPFGLSTAPAI-RKGEEHG-------NADGMSR 822          

HSP 2 Score: 39.2762 bits (90), Expect = 2.570e-21
Identity = 16/34 (47.06%), Postives = 24/34 (70.59%), Query Frame = 1
Query:  220 GIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            G++++C SPWN PLV   + D   I++CL+FR L
Sbjct:  703 GVVRKCQSPWNTPLVIVGKPD-GSIKMCLDFRLL 735          
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Planmine SMEST
Match: SMESG000062996.1 (SMESG000062996.1)

HSP 1 Score: 78.9518 bits (193), Expect = 3.090e-21
Identity = 37/77 (48.05%), Postives = 54/77 (70.13%), Query Frame = 3
Query:  318 LNNVTERPIFPILKTKELIDT*GEATCVSTINFGNAYYQVKLDEESKLKTAFSTKNKQYVFNLMPFGVAAAPAIFHK 548
            LN+VTE+  FPI + + L+D  G++   S+I+   AYYQV+L+E S++K  FSTK  Q+ FN +PFG++ APA F K
Sbjct:  155 LNSVTEKFSFPIPEMQLLLDCLGKSMIFSSIDLRQAYYQVELNENSQIKAEFSTKEGQFCFNRLPFGLSTAPATFQK 231          

HSP 2 Score: 40.817 bits (94), Expect = 3.090e-21
Identity = 17/34 (50.00%), Postives = 24/34 (70.59%), Query Frame = 1
Query:  220 GIIKECHSPWNKPLVCGKRKDKDDIRICLEFRHL 321
            G++++C SPWN PLV   + D   IR+CL+FR L
Sbjct:  123 GVVRKCQSPWNTPLVIVGKPD-GSIRMCLDFRLL 155          
The following BLAST results are available for this feature:
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
BX890543.11.745e-628.57pep chromosome:GRCz11:14:42224893:42231293:-1 gene... [more]
BX511082.13.794e-628.57pep chromosome:GRCz11:9:14291932:14297132:1 gene:E... [more]
FO704673.14.697e-629.87pep chromosome:GRCz11:12:14545475:14551077:-1 gene... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
anxa61.867e-1436.36annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
alkbh51.929e-1438.96alkB homolog 5, RNA demethylase [Source:Xenbase;Ac... [more]
ENSXETT00000037253.13.600e-833.33pep primary_assembly:Xenopus_tropicalis_v9.1:3:109... [more]
denr3.848e-833.33density-regulated protein [Source:Xenbase;Acc:XB-G... [more]
castor13.923e-833.33cytosolic arginine sensor for mTORC1 subunit 1 [So... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20825|POL2_DROME5.968e-1138.96Retrovirus-related Pol polyprotein from transposon... [more]
sp|P04323|POL3_DROME6.318e-1137.66Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q8I7P9|POL5_DROME3.775e-836.36Retrovirus-related Pol polyprotein from transposon... [more]
sp|P10394|POL4_DROME1.584e-735.29Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q7LHG5|YI31B_YEAST1.774e-731.17Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomy... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1X7SFT92.105e-1536.78Reverse transcriptase domain-containing protein OS... [more]
A0A1X7SFW82.353e-1536.78Reverse transcriptase domain-containing protein OS... [more]
A0A1X7SFX72.688e-1536.78Reverse transcriptase domain-containing protein OS... [more]
A0A1X7T3B83.165e-1536.78Reverse transcriptase domain-containing protein OS... [more]
A0A1X7U0T53.707e-1536.78Reverse transcriptase domain-containing protein OS... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034038.13.427e-1437.66pep primary_assembly:Astyanax_mexicanus-2.0:14:312... [more]
ENSAMXT00000038088.11.595e-1334.52pep primary_assembly:Astyanax_mexicanus-2.0:23:138... [more]
ENSAMXT00000044431.11.951e-1336.90pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000037150.13.523e-1237.50pep primary_assembly:Astyanax_mexicanus-2.0:10:222... [more]
ENSAMXT00000041754.13.878e-1237.50pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000038047.11.822e-1333.77pep primary_assembly:ASM223467v1:5:20995901:210019... [more]
ENSORLT00000040552.11.898e-1333.77pep primary_assembly:ASM223467v1:6:4563337:4567860... [more]
ENSORLT00000030651.11.898e-1333.77pep primary_assembly:ASM223467v1:5:21308959:213150... [more]
ENSORLT00000045141.12.376e-1336.36pep primary_assembly:ASM223467v1:23:22495254:22500... [more]
ENSORLT00000034492.16.885e-1335.06pep primary_assembly:ASM223467v1:15:13490768:13497... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon opus vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029259.16.359e-3054.55SMESG000029259.1[more]
SMESG000013664.13.080e-2354.43SMESG000013664.1[more]
SMESG000029866.15.195e-2250.75SMESG000029866.1[more]
SMESG000049864.12.570e-2143.75SMESG000049864.1[more]
SMESG000062996.13.090e-2148.05SMESG000062996.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014267 ID=SMED30014267|Name=Retrovirus-related Pol polyprotein from transposon opus|organism=Schmidtea mediterranea sexual|type=transcript|length=645bp
CAGTAAGTCAGGTCATTTCAAACATCAATGCTTCGAGCTGCATGGAAAAA
TAAATCGCCAATATCAGAGAACAGTTGCTGCAATTGAGGATGAAGTAGGA
GATGAACAAACATGCCCAAACAGATATGCTCCACCACGAGAGAAGATGAT
AATTGCCAGTATGTATGAGTTGAATTATGATTGTTTGATTGCTTCGAATG
TTGATAAATGGAACATTTTGGAATAATAAAAGAGTGTCACTCTCCATGGA
ATAAACCACTAGTTTGTGGAAAGAGAAAAGATAAAGACGACATAAGAATT
TGTCTTGAATTTAGGCACTTAATAATGTCACAGAACGTCCAATATTTCCG
ATTTTAAAAACAAAAGAATTAATAGATACATAAGGAGAAGCTACATGCGT
TAGTACAATTAATTTTGGAAACGCATACTATCAGGTCAAGCTGGATGAAG
AATCGAAACTTAAAACTGCATTTTCAACCAAAAATAAACAATATGTTTTC
AACCTAATGCCATTCGGAGTAGCAGCGGCTCCAGCAATTTTTCATAAAAC
TAATGAATATGGTGTTAGATGGACTCAATTGGAAAATAGCAGTGGTATAT
CTAGATCAGTGTTACGCAAACTGTTTCTGTTCAAGGTACAGCTAC
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003676nucleic acid binding
GO:0003964RNA-directed DNA polymerase activity
GO:0004190aspartic-type endopeptidase activity
GO:0004518nuclease activity
GO:0004519endonuclease activity
GO:0008233peptidase activity
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: biological process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process
GO:0006508proteolysis
GO:0015074DNA integration
GO:0090305nucleic acid phosphodiester bond hydrolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.10.10.10coord: 1..49
e-value: 3.7E-7
score: 32.1
NoneNo IPR availableSUPERFAMILYSSF56672DNA/RNA polymerasescoord: 1..38