AMP deaminase

Overview
NameAMP deaminase
Smed IDSMED30014264
Length (bp)2078
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AMP deaminase (SMED30014264) t-SNE clustered cells

Violin plots show distribution of expression levels for AMP deaminase (SMED30014264) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014264

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30014264h1SMcG0002173 Contig27364uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014264h1SMcG0002173 Contig27364newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30014264h1SMcG0002173 PL06009B1B09smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
reproductive organSMED30014264h1SMcG0002173 Contig20519newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30014264h1SMcG0002173 Contig20519uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AMP deaminase vs. Ensembl Human
Match: AMPD2 (adenosine monophosphate deaminase 2 [Source:HGNC Symbol;Acc:HGNC:469])

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 322/546 (58.97%), Postives = 399/546 (73.08%), Query Frame = 1
Query:  316 MNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            M +GVV +    E  E   +        +P+    EF+ D   +  LI +GPI SF +RRL ++ SKFQMHVLLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++K+H  L+  ++ +   E  L E+F+S+ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W   + + S   +W++Q+PR++DV ++ G +ANF+EM+ N+F PLFE T +P SHPELH FL  V   DSVDDESKPE          P+ W + DNPPY YY+YY F N+  LNHLR +R      LRPHCGEAG I HL+S +MLA+NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGFS K+K HWLG NY +EG  GN+I  +NVP++R+ +R ETL  EL  L+   V  E
Sbjct:  244 MVRGVVHVYTRREPDEHCSEV------ELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRH--LEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELA-LITQAVQSE 780          
BLAST of AMP deaminase vs. Ensembl Human
Match: AMPD2 (adenosine monophosphate deaminase 2 [Source:HGNC Symbol;Acc:HGNC:469])

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 322/546 (58.97%), Postives = 399/546 (73.08%), Query Frame = 1
Query:  316 MNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            M +GVV +    E  E   +        +P+    EF+ D   +  LI +GPI SF +RRL ++ SKFQMHVLLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++K+H  L+  ++ +   E  L E+F+S+ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W   + + S   +W++Q+PR++DV ++ G +ANF+EM+ N+F PLFE T +P SHPELH FL  V   DSVDDESKPE          P+ W + DNPPY YY+YY F N+  LNHLR +R      LRPHCGEAG I HL+S +MLA+NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGFS K+K HWLG NY +EG  GN+I  +NVP++R+ +R ETL  EL  L+   V  E
Sbjct:  207 MVRGVVHVYTRREPDEHCSEV------ELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRH--LEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELA-LITQAVQSE 743          
BLAST of AMP deaminase vs. Ensembl Human
Match: AMPD2 (adenosine monophosphate deaminase 2 [Source:HGNC Symbol;Acc:HGNC:469])

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 322/546 (58.97%), Postives = 399/546 (73.08%), Query Frame = 1
Query:  316 MNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            M +GVV +    E  E   +        +P+    EF+ D   +  LI +GPI SF +RRL ++ SKFQMHVLLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++K+H  L+  ++ +   E  L E+F+S+ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W   + + S   +W++Q+PR++DV ++ G +ANF+EM+ N+F PLFE T +P SHPELH FL  V   DSVDDESKPE          P+ W + DNPPY YY+YY F N+  LNHLR +R      LRPHCGEAG I HL+S +MLA+NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGFS K+K HWLG NY +EG  GN+I  +NVP++R+ +R ETL  EL  L+   V  E
Sbjct:  325 MVRGVVHVYTRREPDEHCSEV------ELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRH--LEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELA-LITQAVQSE 861          
BLAST of AMP deaminase vs. Ensembl Human
Match: AMPD2 (adenosine monophosphate deaminase 2 [Source:HGNC Symbol;Acc:HGNC:469])

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 322/546 (58.97%), Postives = 399/546 (73.08%), Query Frame = 1
Query:  316 MNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            M +GVV +    E  E   +        +P+    EF+ D   +  LI +GPI SF +RRL ++ SKFQMHVLLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++K+H  L+  ++ +   E  L E+F+S+ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W   + + S   +W++Q+PR++DV ++ G +ANF+EM+ N+F PLFE T +P SHPELH FL  V   DSVDDESKPE          P+ W + DNPPY YY+YY F N+  LNHLR +R      LRPHCGEAG I HL+S +MLA+NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGFS K+K HWLG NY +EG  GN+I  +NVP++R+ +R ETL  EL  L+   V  E
Sbjct:  250 MVRGVVHVYTRREPDEHCSEV------ELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRH--LEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELA-LITQAVQSE 786          
BLAST of AMP deaminase vs. Ensembl Human
Match: AMPD2 (adenosine monophosphate deaminase 2 [Source:HGNC Symbol;Acc:HGNC:469])

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 322/546 (58.97%), Postives = 399/546 (73.08%), Query Frame = 1
Query:  316 MNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            M +GVV +    E  E   +        +P+    EF+ D   +  LI +GPI SF +RRL ++ SKFQMHVLLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++K+H  L+  ++ +   E  L E+F+S+ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W   + + S   +W++Q+PR++DV ++ G +ANF+EM+ N+F PLFE T +P SHPELH FL  V   DSVDDESKPE          P+ W + DNPPY YY+YY F N+  LNHLR +R      LRPHCGEAG I HL+S +MLA+NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGFS K+K HWLG NY +EG  GN+I  +NVP++R+ +R ETL  EL  L+   V  E
Sbjct:  271 MVRGVVHVYTRREPDEHCSEV------ELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRH--LEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELA-LITQAVQSE 807          
BLAST of AMP deaminase vs. Ensembl Celegans
Match: ampd-1 (AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9C377])

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 304/509 (59.72%), Postives = 387/509 (76.03%), Query Frame = 1
Query:  406 HVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLL 1932
            +V   EF+ D + +  +I DGP+ SF FRRLS++ +KFQ+HVLLNE  E  EQK V HRDFYN+RKVD HIHAASSMNQKHLLRFIK+ +K  ++  V  N  T V   + E+F  + I  YDL+VD L+VHAD NTFHRFDKFN KYNPVG   LRE+F+KT N   G +FA +L+EV  DLE+SKYQ+ E RLSIYG+S +EWD LAKW   + + S   +W++QIPR+YDV ++   + NF++M+ N+F PLFEVT +P+SHPELH FL  +S +DSVDDESK E  +  ++   P E+T  +NPPY+YY++Y++ N+  LN  R  R L    LRPHCGEAG + HL++GY+ +++I HG+LLRK PVLQYL+YL QIGIAMSPLSNNSLF++Y RNPLP +L KGL VS+STDDPLQFH+TKE LMEE+SIAAQVWKL+S DMCELARNS++ SGF DK+K HWLG NY+EEGV GN+IH +NVP++R++FR E LV EL NL 
Sbjct:  434 NVTKEEFLNDTEKLTAMIVDGPLKSFCFRRLSYLENKFQLHVLLNELRELHEQKGVSHRDFYNIRKVDTHIHAASSMNQKHLLRFIKKKIKTEADTVVLNNNGTKV--TMKEVFKKMGIDAYDLSVDMLDVHADRNTFHRFDKFNTKYNPVGESTLREIFIKTDNYVGGKYFADLLKEVLSDLEDSKYQHAEPRLSIYGRSKNEWDNLAKWALTHDVWSPNARWLVQIPRLYDVYRAKNMVKNFDDMLDNLFTPLFEVTNDPSSHPELHLFLQQISGIDSVDDESKHEFVNFDRSTPCPPEYTDLENPPYNYYLFYMYRNICALNAFRRARGLNTFALRPHCGEAGHVSHLLTGYLTSESIAHGILLRKVPVLQYLYYLTQIGIAMSPLSNNSLFISYQRNPLPEYLQKGLNVSLSTDDPLQFHYTKEALMEEFSIAAQVWKLSSCDMCELARNSVMQSGFEDKVKIHWLGPNYKEEGVLGNDIHRTNVPDIRVSFRHEALVDELYNLF 940          
BLAST of AMP deaminase vs. Ensembl Celegans
Match: ampd-1 (AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9C377])

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 304/508 (59.84%), Postives = 386/508 (75.98%), Query Frame = 1
Query:  409 VKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLL 1932
            V   EF+ D + +  +I DGP+ SF FRRLS++ +KFQ+HVLLNE  E  EQK V HRDFYN+RKVD HIHAASSMNQKHLLRFIK+ +K  ++  V  N  T V +   E+F  + I  YDL+VD L+VHAD NTFHRFDKFN KYNPVG   LRE+F+KT N   G +FA +L+EV  DLE+SKYQ+ E RLSIYG+S +EWD LAKW   + + S   +W++QIPR+YDV ++   + NF++M+ N+F PLFEVT +P+SHPELH FL  +S +DSVDDESK E  +  ++   P E+T  +NPPY+YY++Y++ N+  LN  R  R L    LRPHCGEAG + HL++GY+ +++I HG+LLRK PVLQYL+YL QIGIAMSPLSNNSLF++Y RNPLP +L KGL VS+STDDPLQFH+TKE LMEE+SIAAQVWKL+S DMCELARNS++ SGF DK+K HWLG NY+EEGV GN+IH +NVP++R++FR E LV EL NL 
Sbjct:  334 VTKEEFLNDTEKLTAMIVDGPLKSFCFRRLSYLENKFQLHVLLNELRELHEQKGVSHRDFYNIRKVDTHIHAASSMNQKHLLRFIKKKIKTEADTVVLNNNGTKVTMK--EVFKKMGIDAYDLSVDMLDVHADRNTFHRFDKFNTKYNPVGESTLREIFIKTDNYVGGKYFADLLKEVLSDLEDSKYQHAEPRLSIYGRSKNEWDNLAKWALTHDVWSPNARWLVQIPRLYDVYRAKNMVKNFDDMLDNLFTPLFEVTNDPSSHPELHLFLQQISGIDSVDDESKHEFVNFDRSTPCPPEYTDLENPPYNYYLFYMYRNICALNAFRRARGLNTFALRPHCGEAGHVSHLLTGYLTSESIAHGILLRKVPVLQYLYYLTQIGIAMSPLSNNSLFISYQRNPLPEYLQKGLNVSLSTDDPLQFHYTKEALMEEFSIAAQVWKLSSCDMCELARNSVMQSGFEDKVKIHWLGPNYKEEGVLGNDIHRTNVPDIRVSFRHEALVDELYNLF 839          
BLAST of AMP deaminase vs. Ensembl Celegans
Match: ampd-1 (AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9C377])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 304/508 (59.84%), Postives = 386/508 (75.98%), Query Frame = 1
Query:  409 VKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLL 1932
            V   EF+ D + +  +I DGP+ SF FRRLS++ +KFQ+HVLLNE  E  EQK V HRDFYN+RKVD HIHAASSMNQKHLLRFIK+ +K  ++  V  N  T V   + E+F  + I  YDL+VD L+VHAD NTFHRFDKFN KYNPVG   LRE+F+KT N   G +FA +L+EV  DLE+SKYQ+ E RLSIYG+S +EWD LAKW   + + S   +W++QIPR+YDV ++   + NF++M+ N+F PLFEVT +P+SHPELH FL  +S +DSVDDESK E  +  ++   P E+T  +NPPY+YY++Y++ N+  LN  R  R L    LRPHCGEAG + HL++GY+ +++I HG+LLRK PVLQYL+YL QIGIAMSPLSNNSLF++Y RNPLP +L KGL VS+STDDPLQFH+TKE LMEE+SIAAQVWKL+S DMCELARNS++ SGF DK+K HWLG NY+EEGV GN+IH +NVP++R++FR E LV EL NL 
Sbjct:  309 VTKEEFLNDTEKLTAMIVDGPLKSFCFRRLSYLENKFQLHVLLNELRELHEQKGVSHRDFYNIRKVDTHIHAASSMNQKHLLRFIKKKIKTEADTVVLNNNGTKV--TMKEVFKKMGIDAYDLSVDMLDVHADRNTFHRFDKFNTKYNPVGESTLREIFIKTDNYVGGKYFADLLKEVLSDLEDSKYQHAEPRLSIYGRSKNEWDNLAKWALTHDVWSPNARWLVQIPRLYDVYRAKNMVKNFDDMLDNLFTPLFEVTNDPSSHPELHLFLQQISGIDSVDDESKHEFVNFDRSTPCPPEYTDLENPPYNYYLFYMYRNICALNAFRRARGLNTFALRPHCGEAGHVSHLLTGYLTSESIAHGILLRKVPVLQYLYYLTQIGIAMSPLSNNSLFISYQRNPLPEYLQKGLNVSLSTDDPLQFHYTKEALMEEFSIAAQVWKLSSCDMCELARNSVMQSGFEDKVKIHWLGPNYKEEGVLGNDIHRTNVPDIRVSFRHEALVDELYNLF 814          
BLAST of AMP deaminase vs. Ensembl Celegans
Match: ampd-1 (AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9C377])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 304/508 (59.84%), Postives = 386/508 (75.98%), Query Frame = 1
Query:  409 VKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLL 1932
            V   EF+ D + +  +I DGP+ SF FRRLS++ +KFQ+HVLLNE  E  EQK V HRDFYN+RKVD HIHAASSMNQKHLLRFIK+ +K  ++  V  N  T V +   E+F  + I  YDL+VD L+VHAD NTFHRFDKFN KYNPVG   LRE+F+KT N   G +FA +L+EV  DLE+SKYQ+ E RLSIYG+S +EWD LAKW   + + S   +W++QIPR+YDV ++   + NF++M+ N+F PLFEVT +P+SHPELH FL  +S +DSVDDESK E  +  ++   P E+T  +NPPY+YY++Y++ N+  LN  R  R L    LRPHCGEAG + HL++GY+ +++I HG+LLRK PVLQYL+YL QIGIAMSPLSNNSLF++Y RNPLP +L KGL VS+STDDPLQFH+TKE LMEE+SIAAQVWKL+S DMCELARNS++ SGF DK+K HWLG NY+EEGV GN+IH +NVP++R++FR E LV EL NL 
Sbjct:  271 VTKEEFLNDTEKLTAMIVDGPLKSFCFRRLSYLENKFQLHVLLNELRELHEQKGVSHRDFYNIRKVDTHIHAASSMNQKHLLRFIKKKIKTEADTVVLNNNGTKVTMK--EVFKKMGIDAYDLSVDMLDVHADRNTFHRFDKFNTKYNPVGESTLREIFIKTDNYVGGKYFADLLKEVLSDLEDSKYQHAEPRLSIYGRSKNEWDNLAKWALTHDVWSPNARWLVQIPRLYDVYRAKNMVKNFDDMLDNLFTPLFEVTNDPSSHPELHLFLQQISGIDSVDDESKHEFVNFDRSTPCPPEYTDLENPPYNYYLFYMYRNICALNAFRRARGLNTFALRPHCGEAGHVSHLLTGYLTSESIAHGILLRKVPVLQYLYYLTQIGIAMSPLSNNSLFISYQRNPLPEYLQKGLNVSLSTDDPLQFHYTKEALMEEFSIAAQVWKLSSCDMCELARNSVMQSGFEDKVKIHWLGPNYKEEGVLGNDIHRTNVPDIRVSFRHEALVDELYNLF 776          
BLAST of AMP deaminase vs. Ensembl Fly
Match: AMPdeam (gene:FBgn0052626 transcript:FBtr0340444)

HSP 1 Score: 602.823 bits (1553), Expect = 0.000e+0
Identity = 305/505 (60.40%), Postives = 384/505 (76.04%), Query Frame = 1
Query:  418 SEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLL 1932
            S+F+ D + +  +I DGP+ SF +RRL ++ SK+QMHVLLNE  E   QK VPHRDFYN RKVD HIHAAS MNQKHLLRFIK+++K ++N  V +      ++ L ++F S+ ++ YDL VD L+VHAD NTFHRFDKFN KYNP+G   LREVFLKT N  +G +FAQI++EV  DLEESKYQ  ELRLSIYGKS DEW +LAKW     + S+  +W+IQIPR++D+ KSN  + +F+E++ N+F PLFE T  P+ HPELH FL  V   DSVDDESKPE      ++ +P+EWT  +NPPY YYIYY++ N+  LN  R  R +    LRPHCGEAG + HL+ G+++A+NI+HGLLLRK PVLQYL+YL QIGIAMSPLSNNSLFLNYHRNPLP +L +GL +S+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS++MSGF   +K+ WLG  Y E+G+ GN+I  +NVP +R+A+R ETL+ EL N+ 
Sbjct:  282 SQFVNDMQVMCNMIADGPLKSFCYRRLCYLSSKYQMHVLLNELRELAAQKAVPHRDFYNTRKVDTHIHAASCMNQKHLLRFIKKTLKNNANEVVTVTNGQ--QMTLAQVFQSMNLTTYDLTVDMLDVHADRNTFHRFDKFNSKYNPIGESRLREVFLKTDNYLNGKYFAQIIKEVAFDLEESKYQNAELRLSIYGKSPDEWYKLAKWAIDNDVYSSNIRWLIQIPRLFDIFKSNKMMKSFQEILNNIFLPLFEATARPSKHPELHRFLQYVIGFDSVDDESKPENPLFDNDVPRPEEWTYEENPPYAYYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAGPVQHLVCGFLMAENISHGLLLRKVPVLQYLYYLTQIGIAMSPLSNNSLFLNYHRNPLPEYLARGLIISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVMMSGFPHAIKQQWLGPIYYEDGIMGNDITRTNVPEIRVAYRYETLLDELSNIF 784          
BLAST of AMP deaminase vs. Ensembl Fly
Match: AMPdeam (gene:FBgn0052626 transcript:FBtr0303292)

HSP 1 Score: 602.438 bits (1552), Expect = 0.000e+0
Identity = 305/505 (60.40%), Postives = 384/505 (76.04%), Query Frame = 1
Query:  418 SEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLL 1932
            S+F+ D + +  +I DGP+ SF +RRL ++ SK+QMHVLLNE  E   QK VPHRDFYN RKVD HIHAAS MNQKHLLRFIK+++K ++N  V +      ++ L ++F S+ ++ YDL VD L+VHAD NTFHRFDKFN KYNP+G   LREVFLKT N  +G +FAQI++EV  DLEESKYQ  ELRLSIYGKS DEW +LAKW     + S+  +W+IQIPR++D+ KSN  + +F+E++ N+F PLFE T  P+ HPELH FL  V   DSVDDESKPE      ++ +P+EWT  +NPPY YYIYY++ N+  LN  R  R +    LRPHCGEAG + HL+ G+++A+NI+HGLLLRK PVLQYL+YL QIGIAMSPLSNNSLFLNYHRNPLP +L +GL +S+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS++MSGF   +K+ WLG  Y E+G+ GN+I  +NVP +R+A+R ETL+ EL N+ 
Sbjct:  273 SQFVNDMQVMCNMIADGPLKSFCYRRLCYLSSKYQMHVLLNELRELAAQKAVPHRDFYNTRKVDTHIHAASCMNQKHLLRFIKKTLKNNANEVVTVTNGQ--QMTLAQVFQSMNLTTYDLTVDMLDVHADRNTFHRFDKFNSKYNPIGESRLREVFLKTDNYLNGKYFAQIIKEVAFDLEESKYQNAELRLSIYGKSPDEWYKLAKWAIDNDVYSSNIRWLIQIPRLFDIFKSNKMMKSFQEILNNIFLPLFEATARPSKHPELHRFLQYVIGFDSVDDESKPENPLFDNDVPRPEEWTYEENPPYAYYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAGPVQHLVCGFLMAENISHGLLLRKVPVLQYLYYLTQIGIAMSPLSNNSLFLNYHRNPLPEYLARGLIISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVMMSGFPHAIKQQWLGPIYYEDGIMGNDITRTNVPEIRVAYRYETLLDELSNIF 775          
BLAST of AMP deaminase vs. Ensembl Fly
Match: AMPdeam (gene:FBgn0052626 transcript:FBtr0340445)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 305/505 (60.40%), Postives = 384/505 (76.04%), Query Frame = 1
Query:  418 SEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLL 1932
            S+F+ D + +  +I DGP+ SF +RRL ++ SK+QMHVLLNE  E   QK VPHRDFYN RKVD HIHAAS MNQKHLLRFIK+++K ++N  V +      ++ L ++F S+ ++ YDL VD L+VHAD NTFHRFDKFN KYNP+G   LREVFLKT N  +G +FAQI++EV  DLEESKYQ  ELRLSIYGKS DEW +LAKW     + S+  +W+IQIPR++D+ KSN  + +F+E++ N+F PLFE T  P+ HPELH FL  V   DSVDDESKPE      ++ +P+EWT  +NPPY YYIYY++ N+  LN  R  R +    LRPHCGEAG + HL+ G+++A+NI+HGLLLRK PVLQYL+YL QIGIAMSPLSNNSLFLNYHRNPLP +L +GL +S+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS++MSGF   +K+ WLG  Y E+G+ GN+I  +NVP +R+A+R ETL+ EL N+ 
Sbjct:  270 SQFVNDMQVMCNMIADGPLKSFCYRRLCYLSSKYQMHVLLNELRELAAQKAVPHRDFYNTRKVDTHIHAASCMNQKHLLRFIKKTLKNNANEVVTVTNGQ--QMTLAQVFQSMNLTTYDLTVDMLDVHADRNTFHRFDKFNSKYNPIGESRLREVFLKTDNYLNGKYFAQIIKEVAFDLEESKYQNAELRLSIYGKSPDEWYKLAKWAIDNDVYSSNIRWLIQIPRLFDIFKSNKMMKSFQEILNNIFLPLFEATARPSKHPELHRFLQYVIGFDSVDDESKPENPLFDNDVPRPEEWTYEENPPYAYYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAGPVQHLVCGFLMAENISHGLLLRKVPVLQYLYYLTQIGIAMSPLSNNSLFLNYHRNPLPEYLARGLIISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVMMSGFPHAIKQQWLGPIYYEDGIMGNDITRTNVPEIRVAYRYETLLDELSNIF 772          
BLAST of AMP deaminase vs. Ensembl Fly
Match: AMPdeam (gene:FBgn0052626 transcript:FBtr0301044)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 305/505 (60.40%), Postives = 384/505 (76.04%), Query Frame = 1
Query:  418 SEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLL 1932
            S+F+ D + +  +I DGP+ SF +RRL ++ SK+QMHVLLNE  E   QK VPHRDFYN RKVD HIHAAS MNQKHLLRFIK+++K ++N  V +      ++ L ++F S+ ++ YDL VD L+VHAD NTFHRFDKFN KYNP+G   LREVFLKT N  +G +FAQI++EV  DLEESKYQ  ELRLSIYGKS DEW +LAKW     + S+  +W+IQIPR++D+ KSN  + +F+E++ N+F PLFE T  P+ HPELH FL  V   DSVDDESKPE      ++ +P+EWT  +NPPY YYIYY++ N+  LN  R  R +    LRPHCGEAG + HL+ G+++A+NI+HGLLLRK PVLQYL+YL QIGIAMSPLSNNSLFLNYHRNPLP +L +GL +S+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS++MSGF   +K+ WLG  Y E+G+ GN+I  +NVP +R+A+R ETL+ EL N+ 
Sbjct:  255 SQFVNDMQVMCNMIADGPLKSFCYRRLCYLSSKYQMHVLLNELRELAAQKAVPHRDFYNTRKVDTHIHAASCMNQKHLLRFIKKTLKNNANEVVTVTNGQ--QMTLAQVFQSMNLTTYDLTVDMLDVHADRNTFHRFDKFNSKYNPIGESRLREVFLKTDNYLNGKYFAQIIKEVAFDLEESKYQNAELRLSIYGKSPDEWYKLAKWAIDNDVYSSNIRWLIQIPRLFDIFKSNKMMKSFQEILNNIFLPLFEATARPSKHPELHRFLQYVIGFDSVDDESKPENPLFDNDVPRPEEWTYEENPPYAYYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAGPVQHLVCGFLMAENISHGLLLRKVPVLQYLYYLTQIGIAMSPLSNNSLFLNYHRNPLPEYLARGLIISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVMMSGFPHAIKQQWLGPIYYEDGIMGNDITRTNVPEIRVAYRYETLLDELSNIF 757          
BLAST of AMP deaminase vs. Ensembl Fly
Match: AMPdeam (gene:FBgn0052626 transcript:FBtr0301046)

HSP 1 Score: 601.668 bits (1550), Expect = 0.000e+0
Identity = 305/505 (60.40%), Postives = 384/505 (76.04%), Query Frame = 1
Query:  418 SEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLL 1932
            S+F+ D + +  +I DGP+ SF +RRL ++ SK+QMHVLLNE  E   QK VPHRDFYN RKVD HIHAAS MNQKHLLRFIK+++K ++N  V +      ++ L ++F S+ ++ YDL VD L+VHAD NTFHRFDKFN KYNP+G   LREVFLKT N  +G +FAQI++EV  DLEESKYQ  ELRLSIYGKS DEW +LAKW     + S+  +W+IQIPR++D+ KSN  + +F+E++ N+F PLFE T  P+ HPELH FL  V   DSVDDESKPE      ++ +P+EWT  +NPPY YYIYY++ N+  LN  R  R +    LRPHCGEAG + HL+ G+++A+NI+HGLLLRK PVLQYL+YL QIGIAMSPLSNNSLFLNYHRNPLP +L +GL +S+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS++MSGF   +K+ WLG  Y E+G+ GN+I  +NVP +R+A+R ETL+ EL N+ 
Sbjct:  258 SQFVNDMQVMCNMIADGPLKSFCYRRLCYLSSKYQMHVLLNELRELAAQKAVPHRDFYNTRKVDTHIHAASCMNQKHLLRFIKKTLKNNANEVVTVTNGQ--QMTLAQVFQSMNLTTYDLTVDMLDVHADRNTFHRFDKFNSKYNPIGESRLREVFLKTDNYLNGKYFAQIIKEVAFDLEESKYQNAELRLSIYGKSPDEWYKLAKWAIDNDVYSSNIRWLIQIPRLFDIFKSNKMMKSFQEILNNIFLPLFEATARPSKHPELHRFLQYVIGFDSVDDESKPENPLFDNDVPRPEEWTYEENPPYAYYIYYMYANMTVLNKFRQSRNMNTFVLRPHCGEAGPVQHLVCGFLMAENISHGLLLRKVPVLQYLYYLTQIGIAMSPLSNNSLFLNYHRNPLPEYLARGLIISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVMMSGFPHAIKQQWLGPIYYEDGIMGNDITRTNVPEIRVAYRYETLLDELSNIF 760          
BLAST of AMP deaminase vs. Ensembl Zebrafish
Match: ampd2b (adenosine monophosphate deaminase 2b [Source:ZFIN;Acc:ZDB-GENE-070713-5])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 312/526 (59.32%), Postives = 398/526 (75.67%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKESSIVIKRK 1977
            +P+    E+I D   +  LI +GP+ SF +RRL ++ SKFQMH+LLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++KK+    V + +       L E+F+S+ ++ +DL+VD L++HAD NTFHRFDKFN KYNP+G   LRE+F+KT N  +G +F  I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W   + + S   +W++Q+PR++DV  +   ++NF+EM+ N+F PLFEVT NP+SHPELH FL  V   DSVDDESKPE      +  KP  WT  DNPPY YY+YY++ N+  LNHLR +R +    LRPHCGEAG I HL+SG+ML++NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS+LMSGFS+++K +WLG +Y +EG  GN+I  +NVP++R+A+R ETL  EL NL+   V  E    +K +
Sbjct:  225 LPYPDLQEYIADMNMMMALIINGPVKSFCYRRLQYLSSKFQMHILLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYPGEIVHVEQGRGQ--TLTEVFESMNLTAFDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNHIEGKYFGHIIKEVMADLEESKYQNVELRLSIYGRSRDEWDKLAQWAVTHKVYSDNVRWLVQVPRLFDVYHTKKQLSNFQEMLANIFMPLFEVTVNPSSHPELHLFLQHVVGFDSVDDESKPEHHIFNLDSPKPVNWTDEDNPPYSYYLYYMYANMTVLNHLRRQRNMNSFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFSNQVKSYWLGPHYIKEGQEGNDIRRTNVPDIRVAYRFETLCEEL-NLITQAVRSEELETVKEE 747          
BLAST of AMP deaminase vs. Ensembl Zebrafish
Match: ampd2b (adenosine monophosphate deaminase 2b [Source:ZFIN;Acc:ZDB-GENE-070713-5])

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 312/526 (59.32%), Postives = 398/526 (75.67%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKESSIVIKRK 1977
            +P+    E+I D   +  LI +GP+ SF +RRL ++ SKFQMH+LLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++KK+    V + +       L E+F+S+ ++ +DL+VD L++HAD NTFHRFDKFN KYNP+G   LRE+F+KT N  +G +F  I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W   + + S   +W++Q+PR++DV  +   ++NF+EM+ N+F PLFEVT NP+SHPELH FL  V   DSVDDESKPE      +  KP  WT  DNPPY YY+YY++ N+  LNHLR +R +    LRPHCGEAG I HL+SG+ML++NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS+LMSGFS+++K +WLG +Y +EG  GN+I  +NVP++R+A+R ETL  EL NL+   V  E    +K +
Sbjct:  225 LPYPDLQEYIADMNMMMALIINGPVKSFCYRRLQYLSSKFQMHILLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYPGEIVHVEQGRGQ--TLTEVFESMNLTAFDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNHIEGKYFGHIIKEVMADLEESKYQNVELRLSIYGRSRDEWDKLAQWAVTHKVYSDNVRWLVQVPRLFDVYHTKKQLSNFQEMLANIFMPLFEVTVNPSSHPELHLFLQHVVGFDSVDDESKPEHHIFNLDSPKPVNWTDEDNPPYSYYLYYMYANMTVLNHLRRQRNMNSFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFSNQVKSYWLGPHYIKEGQEGNDIRRTNVPDIRVAYRFETLCEEL-NLITQAVRSEELETVKEE 747          
BLAST of AMP deaminase vs. Ensembl Zebrafish
Match: ampd2a (adenosine monophosphate deaminase 2a [Source:ZFIN;Acc:ZDB-GENE-091204-4])

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 306/515 (59.42%), Postives = 390/515 (75.73%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIV 1944
            +P+    E+I D   +  LI +GP+ SF +RRL ++ SKFQMHVLLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++KK+ +  V I         L ++F+++ ++ YDL+VD L++HAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +F  I++EV  DLEESKYQ  ELRLS+YG+S+DEWD+LAKW   + + S   +W++QIPR++DV ++   ++NF++M+ N+F PLFEVT NP+SHP+LH FL  V   DSVDDESKPE      +   P  W  +DNPPY YY+YY++ N+  LNHLR +R      LRPHCGEAG I HL+SG+ML++NI+HGLLLRK+PVLQYL+YL Q+GIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGFS K K HWLG +Y +EG   N+I  +NVP++R+A+R ET+  EL +L+I  V
Sbjct:  236 LPYPDLQEYIADMNVMMALIINGPVKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYPDEIVHIENGRGQ--TLMDVFENMNLTAYDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNHIHGKYFGHIVKEVMSDLEESKYQNAELRLSVYGRSMDEWDKLAKWAVTHSVYSDNVRWLVQIPRLFDVYRTKKQLSNFQQMLENIFLPLFEVTINPSSHPQLHLFLQHVVGFDSVDDESKPEHHIFNLDSPSPARWCDDDNPPYSYYLYYMYANMTVLNHLRRRRGFHTFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQVGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKSKSHWLGPDYTKEGPISNDIRRTNVPDIRVAYRYETMCEEL-HLIIQAV 747          
BLAST of AMP deaminase vs. Ensembl Zebrafish
Match: ampd2a (adenosine monophosphate deaminase 2a [Source:ZFIN;Acc:ZDB-GENE-091204-4])

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 301/515 (58.45%), Postives = 385/515 (74.76%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIV 1944
            +P+    E+I D   +  LI +GP+ SF +RRL ++ SKFQMHVLLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++KK+ +  V I         L ++F+++ ++ YDL+VD L++HAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +F  I++EV  DLEESKYQ  ELRLS+YG+S+DEWD+LAKW   + + S   +W++QIPR++DV ++   ++NF++M+ N+F PLFEVT NP+SHP+LH FL  V   DSVDDESKPE      +   P  W  +DNPPY YY+YY++ N+  LNHLR +R      LRPHCGEAG I HL+SG+ML++NI+HGLLLRK+PVLQYL+YL Q+GIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTK     EYSIA QVWKL+S DMCELARNS+LMSGFS K K HWLG +Y +EG   N+I  +NVP++R+A+R ET+  EL +L+I  V
Sbjct:  268 LPYPDLQEYIADMNVMMALIINGPVKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYPDEIVHIENGRG--QTLMDVFENMNLTAYDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNHIHGKYFGHIVKEVMSDLEESKYQNAELRLSVYGRSMDEWDKLAKWAVTHSVYSDNVRWLVQIPRLFDVYRTKKQLSNFQQMLENIFLPLFEVTINPSSHPQLHLFLQHVVGFDSVDDESKPEHHIFNLDSPSPARWCDDDNPPYSYYLYYMYANMTVLNHLRRRRGFHTFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQVGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTK-----EYSIATQVWKLSSCDMCELARNSVLMSGFSHKSKSHWLGPDYTKEGPISNDIRRTNVPDIRVAYRYETMCEEL-HLIIQAV 774          
BLAST of AMP deaminase vs. Ensembl Zebrafish
Match: ampd3b (adenosine monophosphate deaminase 3b [Source:ZFIN;Acc:ZDB-GENE-030131-5929])

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 283/525 (53.90%), Postives = 379/525 (72.19%), Query Frame = 1
Query:  382 KDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKES 1956
            +D+  S+P+     F +D   +  +I DGP  ++  RRL+F+ SKFQ+H +LNE  E +E K VPHRDFYNVRKVD HIHAA+ MNQKHLL+FI+ S +  ++ +V + K    +  L ++F++LK+  YDL VD L+VHA   TFHRFDKFN KYNPVG  +LRE++LKT N  +G +FA++++EV  DLEESKYQ+ E RLSIYG++ +EW+ L+KW     + S   +W+IQ+PRIYD+ +S   IANF +M+ N+F PLF+ T NP  H E+H FL  V+  DSVDDESK           KP+EWT  +NPPY YY+++++ N+M LN+LR +R L     RPHCGEAGSI HL+S ++ ADNI+HGL L+KSPVLQYL+YL Q+ IAMSPLSNNSLFL Y +NPL  FL KGL VS+STDDPLQFH+TKE LMEEY+IAAQ+WKL++ D CE+ARNS+L SG S + K+++LGE Y ++G  GN+I  +NV  +R+A+R ETL  EL + L+  V  E+
Sbjct:  252 QDLPRSLPYPDLETFAIDLSHVLAMIADGPTKTYCHRRLNFLTSKFQLHEMLNEMAELKELKCVPHRDFYNVRKVDTHIHAAACMNQKHLLKFIQDSYQTEAD-RVVLEKGGK-KFTLKQVFENLKMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGANELREIYLKTDNYINGEYFARLIKEVAHDLEESKYQHAEPRLSIYGRAPEEWESLSKWFIMQKLHSPNMRWMIQVPRIYDIFRSKKIIANFAKMLENIFLPLFQATVNPQKHKEMHVFLKHVTGFDSVDDESKHSDHIFNYKSPKPEEWTSEENPPYTYYLFHMYANIMVLNNLRKERGLNTFLFRPHCGEAGSITHLVSAFLTADNISHGLNLKKSPVLQYLYYLAQVPIAMSPLSNNSLFLEYSKNPLREFLQKGLCVSLSTDDPLQFHYTKEALMEEYAIAAQLWKLSTCDTCEIARNSVLQSGLSHQEKKYFLGEKYLDDGPEGNDIRKTNVAQIRMAYRHETLCNEL-SFLVEAVKSEA 773          
BLAST of AMP deaminase vs. Ensembl Xenopus
Match: slc5a5 (solute carrier family 5 member 5 [Source:Xenbase;Acc:XB-GENE-486472])

HSP 1 Score: 600.897 bits (1548), Expect = 0.000e+0
Identity = 316/546 (57.88%), Postives = 397/546 (72.71%), Query Frame = 1
Query:  316 MNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            M  GVV +    +VT+     M   +D +P+   SEF+ D   +  LI +GPI SF +RRL ++ S+FQMHVLLNE  E   QK VPHRDFYN+RKVD HIHAAS MNQKHLLRFIKR++KK  N +  ++ +   E  L ++F+++ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S  EWD LA W   + + S   +W++Q+PR++DV +S   I++F+EM+ N+F PLFEVT NP SHPELH FL  V   DSVDDESK E      +   P+ WT  DNPPY YY+YY++ N+  LNH+R +R      LRPHCGEAG I HL+S YML+ NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP FL +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGF  K+K +WLG  Y ++G   N+I  +NVP++R+ FR ETL  EL  +  ++  +E
Sbjct:  259 MMNGVVHVYTKRDVTD-----MNTELD-LPYPDLSEFVADMNVLMALIINGPIKSFCYRRLQYLSSRFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHAASCMNQKHLLRFIKRAMKK--NCEEIVHVEGGKEQTLRQVFENMNLTAYDLSVDTLDVHADRNTFHRFDKFNSKYNPIGESVLREIFIKTDNRVSGTYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRGEWDSLACWAVNHKVHSNNVRWLVQVPRLFDVYRSKKQISHFQEMLENIFLPLFEVTVNPASHPELHLFLEHVDGFDSVDDESKSEHHMFNMDSPLPENWTGEDNPPYSYYLYYMYANMTVLNHMRRRRGFHTFVLRPHCGEAGPIHHLVSAYMLSQNISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPDFLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFPHKVKSYWLGPKYSQDGPESNDIRRTNVPDIRVGFRYETLCEELTLITQALQSEE 796          
BLAST of AMP deaminase vs. Ensembl Xenopus
Match: slc5a5 (solute carrier family 5 member 5 [Source:Xenbase;Acc:XB-GENE-486472])

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 316/546 (57.88%), Postives = 397/546 (72.71%), Query Frame = 1
Query:  316 MNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            M  GVV +    +VT+     M   +D +P+   SEF+ D   +  LI +GPI SF +RRL ++ S+FQMHVLLNE  E   QK VPHRDFYN+RKVD HIHAAS MNQKHLLRFIKR++KK  N +  ++ +   E  L ++F+++ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S  EWD LA W   + + S   +W++Q+PR++DV +S   I++F+EM+ N+F PLFEVT NP SHPELH FL  V   DSVDDESK E      +   P+ WT  DNPPY YY+YY++ N+  LNH+R +R      LRPHCGEAG I HL+S YML+ NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP FL +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGF  K+K +WLG  Y ++G   N+I  +NVP++R+ FR ETL  EL  +  ++  +E
Sbjct:  243 MMNGVVHVYTKRDVTD-----MNTELD-LPYPDLSEFVADMNVLMALIINGPIKSFCYRRLQYLSSRFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHAASCMNQKHLLRFIKRAMKK--NCEEIVHVEGGKEQTLRQVFENMNLTAYDLSVDTLDVHADRNTFHRFDKFNSKYNPIGESVLREIFIKTDNRVSGTYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRGEWDSLACWAVNHKVHSNNVRWLVQVPRLFDVYRSKKQISHFQEMLENIFLPLFEVTVNPASHPELHLFLEHVDGFDSVDDESKSEHHMFNMDSPLPENWTGEDNPPYSYYLYYMYANMTVLNHMRRRRGFHTFVLRPHCGEAGPIHHLVSAYMLSQNISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPDFLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFPHKVKSYWLGPKYSQDGPESNDIRRTNVPDIRVGFRYETLCEELTLITQALQSEE 780          
BLAST of AMP deaminase vs. Ensembl Xenopus
Match: slc5a5 (solute carrier family 5 member 5 [Source:Xenbase;Acc:XB-GENE-486472])

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 315/536 (58.77%), Postives = 392/536 (73.13%), Query Frame = 1
Query:  316 MNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELV 1923
            M  GVV +    +VT+     M   +D +P+   SEF+ D   +  LI +GPI SF +RRL ++ S+FQMHVLLNE  E   QK VPHRDFYN+RKVD HIHAAS MNQKHLLRFIKR++KK  N +  ++ +   E  L ++F+++ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S  EWD LA W   + + S   +W++Q+PR++DV +S   I++F+EM+ N+F PLFEVT NP SHPELH FL  V   DSVDDESK E      +   P+ WT  DNPPY YY+YY++ N+  LNH+R +R      LRPHCGEAG I HL+S YML+ NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP FL +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGF  K+K +WLG  Y ++G   N+I  +NVP++R+ FR ETL  EL 
Sbjct:  243 MMNGVVHVYTKRDVTD-----MNTELD-LPYPDLSEFVADMNVLMALIINGPIKSFCYRRLQYLSSRFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHAASCMNQKHLLRFIKRAMKK--NCEEIVHVEGGKEQTLRQVFENMNLTAYDLSVDTLDVHADRNTFHRFDKFNSKYNPIGESVLREIFIKTDNRVSGTYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRGEWDSLACWAVNHKVHSNNVRWLVQVPRLFDVYRSKKQISHFQEMLENIFLPLFEVTVNPASHPELHLFLEHVDGFDSVDDESKSEHHMFNMDSPLPENWTGEDNPPYSYYLYYMYANMTVLNHMRRRRGFHTFVLRPHCGEAGPIHHLVSAYMLSQNISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPDFLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFPHKVKSYWLGPKYSQDGPESNDIRRTNVPDIRVGFRYETLCEELT 770          
BLAST of AMP deaminase vs. Ensembl Xenopus
Match: slc5a5 (solute carrier family 5 member 5 [Source:Xenbase;Acc:XB-GENE-486472])

HSP 1 Score: 598.586 bits (1542), Expect = 0.000e+0
Identity = 308/518 (59.46%), Postives = 385/518 (74.32%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            +P+   SEF+ D   +  LI +GPI SF +RRL ++ S+FQMHVLLNE  E   QK VPHRDFYN+RKVD HIHAAS MNQKHLLRFIKR++KK  N +  ++ +   E  L ++F+++ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S  EWD LA W   + + S   +W++Q+PR++DV +S   I++F+EM+ N+F PLFEVT NP SHPELH FL  V   DSVDDESK E      +   P+ WT  DNPPY YY+YY++ N+  LNH+R +R      LRPHCGEAG I HL+S YML+ NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP FL +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGF  K+K +WLG  Y ++G   N+I  +NVP++R+ FR ETL  EL  +  ++  +E
Sbjct:  254 LPYPDLSEFVADMNVLMALIINGPIKSFCYRRLQYLSSRFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHAASCMNQKHLLRFIKRAMKK--NCEEIVHVEGGKEQTLRQVFENMNLTAYDLSVDTLDVHADRNTFHRFDKFNSKYNPIGESVLREIFIKTDNRVSGTYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRGEWDSLACWAVNHKVHSNNVRWLVQVPRLFDVYRSKKQISHFQEMLENIFLPLFEVTVNPASHPELHLFLEHVDGFDSVDDESKSEHHMFNMDSPLPENWTGEDNPPYSYYLYYMYANMTVLNHMRRRRGFHTFVLRPHCGEAGPIHHLVSAYMLSQNISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPDFLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFPHKVKSYWLGPKYSQDGPESNDIRRTNVPDIRVGFRYETLCEELTLITQALQSEE 769          
BLAST of AMP deaminase vs. Ensembl Xenopus
Match: slc5a5 (solute carrier family 5 member 5 [Source:Xenbase;Acc:XB-GENE-486472])

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 313/539 (58.07%), Postives = 393/539 (72.91%), Query Frame = 1
Query:  337 MDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            + +MN V     K+  D+    P+   SEF+ D   +  LI +GPI SF +RRL ++ S+FQMHVLLNE  E   QK VPHRDFYN+RKVD HIHAAS MNQKHLLRFIKR++KK  N +  ++ +   E  L ++F+++ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S  EWD LA W   + + S   +W++Q+PR++DV +S   I++F+EM+ N+F PLFEVT NP SHPELH FL  V   DSVDDESK E      +   P+ WT  DNPPY YY+YY++ N+  LNH+R +R      LRPHCGEAG I HL+S YML+ NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP FL +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGF  K+K +WLG  Y ++G   N+I  +NVP++R+ FR ETL  EL  +  ++  +E
Sbjct:  240 LKMMNGVVHVYTKRDLDL----PYPDLSEFVADMNVLMALIINGPIKSFCYRRLQYLSSRFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHAASCMNQKHLLRFIKRAMKK--NCEEIVHVEGGKEQTLRQVFENMNLTAYDLSVDTLDVHADRNTFHRFDKFNSKYNPIGESVLREIFIKTDNRVSGTYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRGEWDSLACWAVNHKVHSNNVRWLVQVPRLFDVYRSKKQISHFQEMLENIFLPLFEVTVNPASHPELHLFLEHVDGFDSVDDESKSEHHMFNMDSPLPENWTGEDNPPYSYYLYYMYANMTVLNHMRRRRGFHTFVLRPHCGEAGPIHHLVSAYMLSQNISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPDFLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFPHKVKSYWLGPKYSQDGPESNDIRRTNVPDIRVGFRYETLCEELTLITQALQSEE 772          
BLAST of AMP deaminase vs. Ensembl Mouse
Match: Ampd2 (adenosine monophosphate deaminase 2 [Source:MGI Symbol;Acc:MGI:88016])

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 316/518 (61.00%), Postives = 390/518 (75.29%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            +P+    EF+ D   +  LI +GPI SF +RRL ++ SKFQMHVLLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++K+H  L+  ++ +   E  L E+F+S+ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W   + + S   +W++Q+PR++DV ++ G +ANF+EM+ N+F PLFE T +P SHPELH FL  V   DSVDDESKPE          P+ W + DNPPY YY+YY F N+  LNHLR +R      LRPHCGEAG I HL+S +MLA+NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGFS K+K HWLG NY +EG  GN+I  +NVP++R+ +R ETL  EL  L+   V  E
Sbjct:  293 LPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRH--LEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNKISGKYFAHIIKEVMADLEESKYQNAELRLSIYGRSRDEWDKLARWAVNHKVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELA-LITQAVQSE 807          
BLAST of AMP deaminase vs. Ensembl Mouse
Match: Ampd2 (adenosine monophosphate deaminase 2 [Source:MGI Symbol;Acc:MGI:88016])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 316/518 (61.00%), Postives = 390/518 (75.29%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            +P+    EF+ D   +  LI +GPI SF +RRL ++ SKFQMHVLLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++K+H  L+  ++ +   E  L E+F+S+ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W   + + S   +W++Q+PR++DV ++ G +ANF+EM+ N+F PLFE T +P SHPELH FL  V   DSVDDESKPE          P+ W + DNPPY YY+YY F N+  LNHLR +R      LRPHCGEAG I HL+S +MLA+NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGFS K+K HWLG NY +EG  GN+I  +NVP++R+ +R ETL  EL  L+   V  E
Sbjct:  267 LPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRH--LEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNKISGKYFAHIIKEVMADLEESKYQNAELRLSIYGRSRDEWDKLARWAVNHKVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELA-LITQAVQSE 781          
BLAST of AMP deaminase vs. Ensembl Mouse
Match: Ampd2 (adenosine monophosphate deaminase 2 [Source:MGI Symbol;Acc:MGI:88016])

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 316/518 (61.00%), Postives = 390/518 (75.29%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            +P+    EF+ D   +  LI +GPI SF +RRL ++ SKFQMHVLLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++K+H  L+  ++ +   E  L E+F+S+ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W   + + S   +W++Q+PR++DV ++ G +ANF+EM+ N+F PLFE T +P SHPELH FL  V   DSVDDESKPE          P+ W + DNPPY YY+YY F N+  LNHLR +R      LRPHCGEAG I HL+S +MLA+NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGFS K+K HWLG NY +EG  GN+I  +NVP++R+ +R ETL  EL  L+   V  E
Sbjct:  267 LPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRH--LEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNKISGKYFAHIIKEVMADLEESKYQNAELRLSIYGRSRDEWDKLARWAVNHKVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELA-LITQAVQSE 781          
BLAST of AMP deaminase vs. Ensembl Mouse
Match: Ampd3 (adenosine monophosphate deaminase 3 [Source:MGI Symbol;Acc:MGI:1096344])

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 288/525 (54.86%), Postives = 375/525 (71.43%), Query Frame = 1
Query:  397 SIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKESSIVIK 1971
            S+P+     +I+D   I  LITDGP  ++  RRL+F+ SKF +H +LNE  E +E K+ PHRDFYNVRKVD HIHAA+ MNQKHLLRFIK + +   +  V   +    ++ L ++FDSL +  YDL VD L+VHA   TFHRFDKFN KYNPVG  +LR+++LKT N   G +FA++++EV ++LE+SKYQY+E RLSIYG+S  EW  LA+W  ++ + S   +WIIQ+PRIYD+ +S   + NF +M+ N+F PLF+ T NP  H ELH FL  V+  DSVDDESK            PD WT   NPPY YY+YY++ N+M LN+LR +R L     RPHCGEAGSI HL+S ++ ADNI+HGLLL+KSPVLQYL+YL QI IAMSPLSNNSLFL Y +NPL  FL KGL VS+STDDP+QFH+TKE LMEEY+IAAQVWKL++ D+CE+ARNS+L SG S + K+ +LG+NY +EG  GN+I  +NV  +R+AFR ETL  EL  L  ++  +E + + K
Sbjct:  253 SLPYPDLETYIVDMSHILALITDGPTKTYCHRRLNFLESKFSLHEMLNEMSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTEPDRTV--AEKLGRKITLRQVFDSLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENYLGGEYFARMVKEVARELEDSKYQYSEPRLSIYGRSPKEWSSLARWFIQHKVYSPNMRWIIQVPRIYDIFRSKKLLPNFGKMLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPSPDLWTSEQNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAFLTADNISHGLLLKKSPVLQYLYYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLSTDDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNSVLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETLCNELSFLSDAMKSEEITALTK 775          
BLAST of AMP deaminase vs. Ensembl Mouse
Match: Ampd3 (adenosine monophosphate deaminase 3 [Source:MGI Symbol;Acc:MGI:1096344])

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 288/525 (54.86%), Postives = 375/525 (71.43%), Query Frame = 1
Query:  397 SIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKESSIVIK 1971
            S+P+     +I+D   I  LITDGP  ++  RRL+F+ SKF +H +LNE  E +E K+ PHRDFYNVRKVD HIHAA+ MNQKHLLRFIK + +   +  V   +    ++ L ++FDSL +  YDL VD L+VHA   TFHRFDKFN KYNPVG  +LR+++LKT N   G +FA++++EV ++LE+SKYQY+E RLSIYG+S  EW  LA+W  ++ + S   +WIIQ+PRIYD+ +S   + NF +M+ N+F PLF+ T NP  H ELH FL  V+  DSVDDESK            PD WT   NPPY YY+YY++ N+M LN+LR +R L     RPHCGEAGSI HL+S ++ ADNI+HGLLL+KSPVLQYL+YL QI IAMSPLSNNSLFL Y +NPL  FL KGL VS+STDDP+QFH+TKE LMEEY+IAAQVWKL++ D+CE+ARNS+L SG S + K+ +LG+NY +EG  GN+I  +NV  +R+AFR ETL  EL  L  ++  +E + + K
Sbjct:  244 SLPYPDLETYIVDMSHILALITDGPTKTYCHRRLNFLESKFSLHEMLNEMSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTEPDRTV--AEKLGRKITLRQVFDSLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENYLGGEYFARMVKEVARELEDSKYQYSEPRLSIYGRSPKEWSSLARWFIQHKVYSPNMRWIIQVPRIYDIFRSKKLLPNFGKMLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPSPDLWTSEQNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAFLTADNISHGLLLKKSPVLQYLYYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLSTDDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNSVLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETLCNELSFLSDAMKSEEITALTK 766          
BLAST of AMP deaminase vs. UniProt/SwissProt
Match: sp|Q02356|AMPD2_RAT (AMP deaminase 2 OS=Rattus norvegicus OX=10116 GN=Ampd2 PE=1 SV=2)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 316/518 (61.00%), Postives = 390/518 (75.29%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            +P+    EF+ D   +  LI +GPI SF +RRL ++ SKFQMHVLLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++K+H  L+  ++ +   E  L E+F+S+ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W   + + S   +W++Q+PR++DV ++ G +ANF+EM+ N+F PLFE T +P SHPELH FL  V   DSVDDESKPE          P+ W + DNPPY YY+YY F N+  LNHLR +R      LRPHCGEAG I HL+S +MLA+NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGFS K+K HWLG NY +EG  GN+I  +NVP++R+ +R ETL  EL  L+   V  E
Sbjct:  293 LPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRH--LEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNKISGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVNHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELA-LITQAVQSE 807          
BLAST of AMP deaminase vs. UniProt/SwissProt
Match: sp|Q01433|AMPD2_HUMAN (AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 PE=1 SV=2)

HSP 1 Score: 617.846 bits (1592), Expect = 0.000e+0
Identity = 322/546 (58.97%), Postives = 399/546 (73.08%), Query Frame = 1
Query:  316 MNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            M +GVV +    E  E   +        +P+    EF+ D   +  LI +GPI SF +RRL ++ SKFQMHVLLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++K+H  L+  ++ +   E  L E+F+S+ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W   + + S   +W++Q+PR++DV ++ G +ANF+EM+ N+F PLFE T +P SHPELH FL  V   DSVDDESKPE          P+ W + DNPPY YY+YY F N+  LNHLR +R      LRPHCGEAG I HL+S +MLA+NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGFS K+K HWLG NY +EG  GN+I  +NVP++R+ +R ETL  EL  L+   V  E
Sbjct:  325 MVRGVVHVYTRREPDEHCSEV------ELPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRH--LEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNRVSGKYFAHIIKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLARWAVMHRVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELA-LITQAVQSE 861          
BLAST of AMP deaminase vs. UniProt/SwissProt
Match: sp|Q9DBT5|AMPD2_MOUSE (AMP deaminase 2 OS=Mus musculus OX=10090 GN=Ampd2 PE=1 SV=1)

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 316/518 (61.00%), Postives = 390/518 (75.29%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            +P+    EF+ D   +  LI +GPI SF +RRL ++ SKFQMHVLLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++K+H  L+  ++ +   E  L E+F+S+ ++ YDL+VD L+VHAD NTFHRFDKFN KYNP+G   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W   + + S   +W++Q+PR++DV ++ G +ANF+EM+ N+F PLFE T +P SHPELH FL  V   DSVDDESKPE          P+ W + DNPPY YY+YY F N+  LNHLR +R      LRPHCGEAG I HL+S +MLA+NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIA QVWKL+S DMCELARNS+LMSGFS K+K HWLG NY +EG  GN+I  +NVP++R+ +R ETL  EL  L+   V  E
Sbjct:  267 LPYPDLQEFVADVNVLMALIINGPIKSFCYRRLQYLSSKFQMHVLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKRH--LEEIVHVEQGREQTLREVFESMNLTAYDLSVDTLDVHADRNTFHRFDKFNAKYNPIGESVLREIFIKTDNKISGKYFAHIIKEVMADLEESKYQNAELRLSIYGRSRDEWDKLARWAVNHKVHSPNVRWLVQVPRLFDVYRTKGQLANFQEMLENIFLPLFEATVHPASHPELHLFLEHVDGFDSVDDESKPENHVFNLESPLPEAWVEEDNPPYAYYLYYTFANMAMLNHLRRQRGFHTFVLRPHCGEAGPIHHLVSAFMLAENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIATQVWKLSSCDMCELARNSVLMSGFSHKVKSHWLGPNYTKEGPEGNDIRRTNVPDIRVGYRYETLCQELA-LITQAVQSE 781          
BLAST of AMP deaminase vs. UniProt/SwissProt
Match: sp|O08739|AMPD3_MOUSE (AMP deaminase 3 OS=Mus musculus OX=10090 GN=Ampd3 PE=1 SV=2)

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 288/525 (54.86%), Postives = 375/525 (71.43%), Query Frame = 1
Query:  397 SIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKESSIVIK 1971
            S+P+     +I+D   I  LITDGP  ++  RRL+F+ SKF +H +LNE  E +E K+ PHRDFYNVRKVD HIHAA+ MNQKHLLRFIK + +   +  V   +    ++ L ++FDSL +  YDL VD L+VHA   TFHRFDKFN KYNPVG  +LR+++LKT N   G +FA++++EV ++LE+SKYQY+E RLSIYG+S  EW  LA+W  ++ + S   +WIIQ+PRIYD+ +S   + NF +M+ N+F PLF+ T NP  H ELH FL  V+  DSVDDESK            PD WT   NPPY YY+YY++ N+M LN+LR +R L     RPHCGEAGSI HL+S ++ ADNI+HGLLL+KSPVLQYL+YL QI IAMSPLSNNSLFL Y +NPL  FL KGL VS+STDDP+QFH+TKE LMEEY+IAAQVWKL++ D+CE+ARNS+L SG S + K+ +LG+NY +EG  GN+I  +NV  +R+AFR ETL  EL  L  ++  +E + + K
Sbjct:  244 SLPYPDLETYIVDMSHILALITDGPTKTYCHRRLNFLESKFSLHEMLNEMSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTEPDRTV--AEKLGRKITLRQVFDSLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENYLGGEYFARMVKEVARELEDSKYQYSEPRLSIYGRSPKEWSSLARWFIQHKVYSPNMRWIIQVPRIYDIFRSKKLLPNFGKMLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPSPDLWTSEQNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAFLTADNISHGLLLKKSPVLQYLYYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLSTDDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNSVLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETLCNELSFLSDAMKSEEITALTK 766          
BLAST of AMP deaminase vs. UniProt/SwissProt
Match: sp|Q01432|AMPD3_HUMAN (AMP deaminase 3 OS=Homo sapiens OX=9606 GN=AMPD3 PE=1 SV=1)

HSP 1 Score: 539.265 bits (1388), Expect = 0.000e+0
Identity = 286/519 (55.11%), Postives = 369/519 (71.10%), Query Frame = 1
Query:  397 SIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            S+P+     + +D   I  LITDGP  ++  RRL+F+ SKF +H +LNE  E +E K+ PHRDFYNVRKVD HIHAA+ MNQKHLLRFIK + +   +  V   +   +   L ++FD L +  YDL VD L+VHA   TFHRFDKFN KYNPVG  +LR+++LKT N   G +FA++++EV ++LEESKYQY+E RLSIYG+S +EW  LA W  ++ + S   +WIIQ+PRIYD+ +S   + NF +M+ N+F PLF+ T NP  H ELH FL  V+  DSVDDESK            PD WT   NPPY YY+YY++ N+M LN+LR +R L     RPHCGEAGSI HL+S ++ ADNI+HGLLL+KSPVLQYL+YL QI IAMSPLSNNSLFL Y +NPL  FL KGL VS+STDDP+QFH+TKE LMEEY+IAAQVWKL++ D+CE+ARNS+L SG S + K+ +LG+NY +EG  GN+I  +NV  +R+AFR ETL  EL  L  ++  +E
Sbjct:  245 SLPYPDLETYTVDMSHILALITDGPTKTYCHRRLNFLESKFSLHEMLNEMSEFKELKSNPHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHTYQTEPDRTVAEKRGRKI--TLRQVFDGLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYLKTENYLGGEYFARMVKEVARELEESKYQYSEPRLSIYGRSPEEWPNLAYWFIQHKVYSPNMRWIIQVPRIYDIFRSKKLLPNFGKMLENIFLPLFKATINPQDHRELHLFLKYVTGFDSVDDESKHSDHMFSDKSPNPDVWTSEQNPPYSYYLYYMYANIMVLNNLRRERGLSTFLFRPHCGEAGSITHLVSAFLTADNISHGLLLKKSPVLQYLYYLAQIPIAMSPLSNNSLFLEYSKNPLREFLHKGLHVSLSTDDPMQFHYTKEALMEEYAIAAQVWKLSTCDLCEIARNSVLQSGLSHQEKQKFLGQNYYKEGPEGNDIRKTNVAQIRMAFRYETLCNELSFLSDAMKSEE 761          
BLAST of AMP deaminase vs. TrEMBL
Match: T1HRS2 (A_deaminase domain-containing protein (Fragment) OS=Rhodnius prolixus OX=13249 PE=4 SV=1)

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 324/510 (63.53%), Postives = 394/510 (77.25%), Query Frame = 1
Query:  403 PHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLL 1932
            P+   + FI D   +  +I DGP+ SF +RRLS++ SKFQ+HVLLNE  E   QK VPHRDFYN+RKVD HIHAAS MNQKHLLRFIK+++K H +  V   K+   ++ L E+F S+ ++ YDL VD L+VHAD NTFHRFDKFN KYNP+G   LREVFLKT N  +G +FA+I++EV  DLEESKYQ +ELRLSIYGK+LDEWD+LA W   YG+ S   +W+IQIPR++D+ KSN  + NF+E I N+F PLFEVT +P+SHP LH FL  V   DSVDDESKPE     K++  PD W+  +NPPY YY YY+F NL  LNH R+ + L    LRPHCGEAG I HL+ GYM+A+NI+HGLLLRK PVLQYL+YL QIGIAMSPLSNNSLFLNYHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS+LMSGF  +LK++WLG NY +EGV GN+I  +NVP++R+AFR ETL+ EL N+ 
Sbjct:  245 PYPDLATFIADMNKLCYMIADGPLKSFCYRRLSYLSSKFQLHVLLNELRELASQKAVPHRDFYNIRKVDTHIHAASCMNQKHLLRFIKKTLKNHRDEVVTETKEG--KMTLKEVFQSMNLTSYDLTVDMLDVHADRNTFHRFDKFNAKYNPIGESRLREVFLKTDNYLNGKYFARIIKEVSSDLEESKYQNSELRLSIYGKNLDEWDKLATWAITYGVYSDNVRWLIQIPRLFDIFKSNKLMTNFQEFINNIFLPLFEVTKDPHSHPNLHRFLQYVIGFDSVDDESKPENPLFDKDVPTPDRWSDEENPPYAYYQYYMFANLTILNHFRSDKGLNTFVLRPHCGEAGPIQHLVCGYMMAENISHGLLLRKVPVLQYLYYLTQIGIAMSPLSNNSLFLNYHRNPLPEYLARGLCVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFPHRLKQYWLGPNYTKEGVAGNDITRTNVPDIRVAFRTETLIDELSNIF 752          
BLAST of AMP deaminase vs. TrEMBL
Match: A0A0X3P7Y6 (AMP deaminase 2 OS=Schistocephalus solidus OX=70667 GN=AMPD2 PE=4 SV=1)

HSP 1 Score: 637.106 bits (1642), Expect = 0.000e+0
Identity = 323/548 (58.94%), Postives = 403/548 (73.54%), Query Frame = 1
Query:  301 PVTFTMNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIV 1944
            P   +  +G+  ++L  +   +     + ++ + P V   EFI D   +R  +  GP+ SF +RRLSF+ SKF +HVLLNE  ES EQK VPHRDFYN+RKVD H+HAAS MNQKHLLRFIK+  +  SN  V  +K T   + L +L D LK++ YDLN+D L+VHAD NTFHRFDKFN KYNP+G   LREVFLKT N  +G FFA +L+EVF DLEESKYQ  E RLSIYG+S+ EWD+L+ W   + + S   +W+IQIPR+YD+  S   I +F++MI N+F PLFEVT NP SHP+L+ FL  V   DSVDDESKP+   M  NI  P+ WTK +NPPY YYI+YL+ N+ +LN LR  R +    LRPHCGEAGS  HLI+ ++LA +INHGLLLRK+PVLQYL+YLCQIGIAMSPLSNNSLFL YHRNPL  +L +GL V +STDDPLQFHFTKEPLMEEYSIAAQVWKL++TDMCELARNS+L+SGF D +K HWLG N+ EEGV GN+I  +N+PN+R+A+R ETL  EL  L+ + +
Sbjct:  313 PARLSFVQGIAHLELAEDSHSNGPTGDRPLLPNFPTVSLQEFIQDDCLMRSFVGSGPLKSFCYRRLSFLSSKFSLHVLLNESRESLEQKQVPHRDFYNIRKVDTHVHAASCMNQKHLLRFIKKCFRTRSNELVCQDKKTGKPMTLKQLMDHLKLTVYDLNIDNLDVHADRNTFHRFDKFNAKYNPIGQSQLREVFLKTDNYNNGAFFAHVLKEVFSDLEESKYQNAEPRLSIYGRSIQEWDDLSTWAIDFKVYSPNIRWVIQIPRLYDIYHSKAAIISFQDMITNIFQPLFEVTLNPRSHPKLYAFLEYVIGFDSVDDESKPDTTHMDMNIPTPENWTKKENPPYSYYIFYLYANIARLNQLRAHRGMHTFALRPHCGEAGSASHLITAFLLASSINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLEYHRNPLNNYLARGLNVCLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSATDMCELARNSVLISGFPDFVKSHWLGLNFWEEGVRGNDIARTNLPNIRVAYRHETLTEELRLLVTAAL 860          
BLAST of AMP deaminase vs. TrEMBL
Match: A0A224XKR1 (AMP deaminase OS=Panstrongylus lignarius OX=156445 PE=3 SV=1)

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 324/510 (63.53%), Postives = 391/510 (76.67%), Query Frame = 1
Query:  403 PHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLL 1932
            P+   + FI D   +  +I DGP+ SF +RRLS++ SKFQ+HVLLNE  E   QK VPHRDFYN+RKVD HIHAAS MNQKHLLRFIK+++K H +  V   KD   ++ L E+F S+ ++ YDL VD L+VHAD NTFHRFDKFN KYNP+G   LREVFLKT N  +G +FA+I++EV  DLEESKYQ  ELRLSIYGK+LDEWD+LA W   Y + S   +W+IQIPR+YD+ K+N  + NF+E I N+F PLFEVT +P SHP LH FL  V   DSVDDESKPE     K++  PD+W+  +NPPY YY YY+F NL  LNH R  + L    LRPHCGEAG I HL+ GYM+A+NI+HGLLLRK PVLQYL+YL QIGIAMSPLSNNSLFLNYHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS+LMSGF  K+K++WLG NY +EGV GN+I  +NVP++R+AFR ETL+ EL N+ 
Sbjct:  157 PYPDLATFIADMNKLCCMIADGPLKSFCYRRLSYLSSKFQLHVLLNELRELASQKAVPHRDFYNIRKVDTHIHAASCMNQKHLLRFIKKTLKNHWDEVVTETKDG--KMTLKEVFQSMNLTSYDLTVDMLDVHADRNTFHRFDKFNAKYNPIGESRLREVFLKTDNYLNGKYFARIIKEVSSDLEESKYQNAELRLSIYGKNLDEWDKLATWAITYSVYSDNVRWLIQIPRLYDIFKNNKLMTNFQEFISNIFLPLFEVTKDPQSHPNLHRFLQYVIGFDSVDDESKPENPLFDKDVSTPDQWSDEENPPYAYYQYYMFANLTILNHFRRDKGLNTFVLRPHCGEAGPIQHLVCGYMMAENISHGLLLRKVPVLQYLYYLAQIGIAMSPLSNNSLFLNYHRNPLPEYLARGLCVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFPHKMKQYWLGPNYTKEGVAGNDITRTNVPDIRVAFRTETLIDELSNIF 664          
BLAST of AMP deaminase vs. TrEMBL
Match: A0A0V0G7X8 (AMP deaminase OS=Triatoma dimidiata OX=72491 PE=3 SV=1)

HSP 1 Score: 634.41 bits (1635), Expect = 0.000e+0
Identity = 323/510 (63.33%), Postives = 390/510 (76.47%), Query Frame = 1
Query:  403 PHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLL 1932
            P+   + FI D   +  +I DGP+ SF +RRLS++ SKFQ+HVLLNE  E   QK VPHRDFYN+RKVD HIHAAS MNQKHLLRFIK+++K H    V   KD   ++ L E+F S+ ++ YDL VD L+VHAD NTFHRFDKFN KYNP+G   LREVFLKT N  +G +FA+I++EV  DLEESKYQ  ELRLSIYGK++DEWD+LA W   YG+ S   +W+IQIPR++D+ K+N  + NF+E I N+F PLFEVT +P SHP LH FL  V   DSVDDESKPE      N+  PD+W+  +NPPY YY YY+F NL  LNH R  + L    LRPHCGEAG I HL+ GYM+A+NI+HGLLLRK PVLQYL+YL QIGIAMSPLSNNSLFLNYHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS+LMSGF  K+K++WLG NY +EGV GN+I  +NVP++R+AFR ETL+ EL N+ 
Sbjct:  157 PYPDLTTFIADMNKLCCMIADGPLKSFCYRRLSYLSSKFQLHVLLNELRELASQKAVPHRDFYNIRKVDTHIHAASCMNQKHLLRFIKKTLKNHRGEVVTETKDG--KMTLKEVFQSMNLTSYDLTVDMLDVHADRNTFHRFDKFNAKYNPIGESRLREVFLKTDNYLNGKYFARIIKEVSSDLEESKYQNAELRLSIYGKNMDEWDKLATWAITYGVYSDNVRWLIQIPRLFDIFKNNKLMTNFQEFISNIFLPLFEVTKDPKSHPNLHRFLQYVIGFDSVDDESKPENPLFDNNVSTPDQWSDEENPPYAYYQYYMFANLTILNHFRRDKGLNTFVLRPHCGEAGPIQHLVCGYMMAENISHGLLLRKVPVLQYLYYLAQIGIAMSPLSNNSLFLNYHRNPLPEYLARGLCVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFPHKMKQYWLGPNYTKEGVAGNDITRTNVPDIRVAFRTETLIDELSNIF 664          
BLAST of AMP deaminase vs. TrEMBL
Match: A0A1E1XD26 (Putative adenosine monophosphate deaminase (Fragment) OS=Amblyomma aureolatum OX=187763 PE=2 SV=1)

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 329/542 (60.70%), Postives = 407/542 (75.09%), Query Frame = 1
Query:  316 MNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISI 1941
            M+ GVV +    E  E+ R          P+V   +FI D   +  +I DGP+ SF +RRLS++ SKFQ+HVLLNE  E   QK VPHRDFYN+RKVD H+HAAS MNQKHLLRFIK+ +K HS   VF  K  +  + L E+F ++ ++ YDL+VD L+VHAD NTFHRFDKFN KYNPVG   LRE+FLKT N   G +FA+IL+EV  DLEESKYQ  ELRLSIYG+S +EWD+LAKW  +  M S   +W++Q+PR+YDV KSN  + NFEE++ N+F PLFE T NP+SHPELH+FL  +   DSVDDESKPE   + K++  P E+T  +NP Y+YY+YY++ N+  LNH R KR L I  LRPHCGEAG + HL+ GY+L++NINHGLLLRK PVLQYL+YL QIGIAMSPLSNNSLFLNYHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNSI+MSGF  K+K++WLG NYQ EG  GN+I  +NVP++R+A+R ETLV EL  +  ++
Sbjct:  230 MHNGVVHVYKAPEDVEAERPL------DFPYVNLPQFINDLNLMCAMIADGPLKSFCYRRLSYLSSKFQLHVLLNELRELAAQKAVPHRDFYNIRKVDTHVHAASCMNQKHLLRFIKKMMKMHSEDHVF--KQGDKLMTLEEVFSAMNVTAYDLSVDMLDVHADRNTFHRFDKFNTKYNPVGESRLREIFLKTDNYIGGQYFAEILKEVMSDLEESKYQNAELRLSIYGRSRNEWDKLAKWAVRNTMYSDNVRWLVQVPRLYDVFKSNKIVNNFEEILENIFLPLFEATNNPSSHPELHQFLQYIVGFDSVDDESKPEYPMIDKDVPLPREYTDTENPAYNYYLYYMYANMCVLNHFRKKRGLNIFVLRPHCGEAGPVQHLVGGYLLSENINHGLLLRKVPVLQYLYYLAQIGIAMSPLSNNSLFLNYHRNPLPEYLSRGLCVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSIVMSGFPHKVKQYWLGPNYQREGPAGNDITRTNVPDIRVAYRYETLVDELSTIFRTM 763          
BLAST of AMP deaminase vs. Ensembl Cavefish
Match: ampd2a (adenosine monophosphate deaminase 2a [Source:ZFIN;Acc:ZDB-GENE-091204-4])

HSP 1 Score: 578.556 bits (1490), Expect = 0.000e+0
Identity = 301/507 (59.37%), Postives = 377/507 (74.36%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGEL 1920
            +P+    ++I D   +  LI +GP+ SF +RRL ++ SKFQMH LLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIK ++KK+   +  +  +      L ++F+++ ++ YDL+VD L++    NTFHRFDKFN KYNP+G   LRE+F+KT N   G +F  I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA W   + + S    W++QIPR++DV +S   + NF++M+ N+F PLFEVT NP SHP+LH FL  V   DSVDDESKPE      +   P+ WT+ DNPPY YY+YY + N+  LNHLR +R      LRPHCGEAG I HL+SG+ML+ NI+HGLLLRK+PVLQYL+YL Q+GIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCEL+RNS+LMSGFS K KR+WLG +Y  EG  GN+I  SNVP++R+AFR ETL  EL
Sbjct:  232 LPYPNLQDYIADMNVMMALIINGPVKSFCYRRLQYLSSKFQMHSLLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKSAMKKYP--EEIVRMEGGRGQTLMDVFENMNLTAYDLSVDTLDM--TGNTFHRFDKFNSKYNPIGESILREIFIKTDNHIHGKYFGHIVKEVMSDLEESKYQNAELRLSIYGRSRDEWDKLALWATTHSVYSPNVCWLVQIPRLFDVYRSKRQLGNFQQMLENIFLPLFEVTVNPQSHPDLHLFLQHVVGFDSVDDESKPEHHVFNLDSPLPENWTEEDNPPYSYYLYYTYANMTVLNHLRRRRGFHTFVLRPHCGEAGPIHHLVSGFMLSANISHGLLLRKAPVLQYLYYLAQVGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELSRNSVLMSGFSHKTKRYWLGPDYSREGPEGNDIRRSNVPDIRVAFRHETLCEEL 734          
BLAST of AMP deaminase vs. Ensembl Cavefish
Match: ampd3b (AMP deaminase 3 [Source:NCBI gene;Acc:103023811])

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 285/518 (55.02%), Postives = 372/518 (71.81%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            +P+     F +D   +  +I DGP  ++  RRL+F+ SKF +H +LNE  E +E K VPHRDFYNVRKVD HIHAA+ MNQKHLLRFI+ +     + +V + K    ++ L ++F +L +  YDL VD L+VHA   TFHRFDKFN KYNPVG  +LRE++LKT N  +G +FA++++EV  DLEESKYQY E RLSIYG+S +EW+ LAKW  +  + S   +WIIQ+PRIYD+ +    I NF +M+ N+F PLFE T NP  H E+H FL  V+  DSVDDESK           KP+EWT  +NPPY YY+Y+++ N+M LN+LR +R L   + RPHCGEAGSI HL+S ++ ADNI+HGL L+KSPVLQYLFYL Q+ IAMSPLSNNSLFL Y +NPL  FL KGL VS+STDDP+QFH+TKE LMEEY+IAAQ+WKL++ D+CE+ARNS+L SG S + K+H+LGENY ++G  GN+I  +NV  +R+A+R ETL  EL + L+  V  E
Sbjct:  265 LPYPDMETFAIDMTHVLAMIADGPTKTYCHRRLNFLMSKFYLHEMLNEMAELKELKCVPHRDFYNVRKVDTHIHAAACMNQKHLLRFIQNTCDVEGD-RVVMEKGGK-KITLKQVFQNLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELREIYLKTDNYINGEYFARLIKEVAHDLEESKYQYAEPRLSIYGRSPEEWENLAKWFIQQKVYSPNMRWIIQVPRIYDIFRLKKIIPNFAKMLENIFLPLFEATVNPQKHKEMHVFLKYVTGFDSVDDESKHSDHMFSYKSPKPEEWTAEENPPYSYYLYHMYANIMVLNNLRKERGLSTFQFRPHCGEAGSITHLVSAFLTADNISHGLNLKKSPVLQYLFYLAQVPIAMSPLSNNSLFLEYSKNPLREFLHKGLCVSLSTDDPMQFHYTKEALMEEYAIAAQLWKLSTCDVCEIARNSVLQSGISHQEKKHFLGENYLQDGPDGNDIRRTNVAQIRMAYRHETLCNEL-SFLVDAVKSE 779          
BLAST of AMP deaminase vs. Ensembl Cavefish
Match: ampd3b (AMP deaminase 3 [Source:NCBI gene;Acc:103023811])

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 285/518 (55.02%), Postives = 372/518 (71.81%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            +P+     F +D   +  +I DGP  ++  RRL+F+ SKF +H +LNE  E +E K VPHRDFYNVRKVD HIHAA+ MNQKHLLRFI+ +     + +V + K    ++ L ++F +L +  YDL VD L+VHA   TFHRFDKFN KYNPVG  +LRE++LKT N  +G +FA++++EV  DLEESKYQY E RLSIYG+S +EW+ LAKW  +  + S   +WIIQ+PRIYD+ +    I NF +M+ N+F PLFE T NP  H E+H FL  V+  DSVDDESK           KP+EWT  +NPPY YY+Y+++ N+M LN+LR +R L   + RPHCGEAGSI HL+S ++ ADNI+HGL L+KSPVLQYLFYL Q+ IAMSPLSNNSLFL Y +NPL  FL KGL VS+STDDP+QFH+TKE LMEEY+IAAQ+WKL++ D+CE+ARNS+L SG S + K+H+LGENY ++G  GN+I  +NV  +R+A+R ETL  EL + L+  V  E
Sbjct:  265 LPYPDMETFAIDMTHVLAMIADGPTKTYCHRRLNFLMSKFYLHEMLNEMAELKELKCVPHRDFYNVRKVDTHIHAAACMNQKHLLRFIQNTCDVEGD-RVVMEKGGK-KITLKQVFQNLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELREIYLKTDNYINGEYFARLIKEVAHDLEESKYQYAEPRLSIYGRSPEEWENLAKWFIQQKVYSPNMRWIIQVPRIYDIFRLKKIIPNFAKMLENIFLPLFEATVNPQKHKEMHVFLKYVTGFDSVDDESKHSDHMFSYKSPKPEEWTAEENPPYSYYLYHMYANIMVLNNLRKERGLSTFQFRPHCGEAGSITHLVSAFLTADNISHGLNLKKSPVLQYLFYLAQVPIAMSPLSNNSLFLEYSKNPLREFLHKGLCVSLSTDDPMQFHYTKEALMEEYAIAAQLWKLSTCDVCEIARNSVLQSGISHQEKKHFLGENYLQDGPDGNDIRRTNVAQIRMAYRHETLCNEL-SFLVDAVKSE 779          
BLAST of AMP deaminase vs. Ensembl Cavefish
Match: ampd3b (AMP deaminase 3 [Source:NCBI gene;Acc:103023811])

HSP 1 Score: 546.199 bits (1406), Expect = 0.000e+0
Identity = 285/518 (55.02%), Postives = 372/518 (71.81%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
            +P+     F +D   +  +I DGP  ++  RRL+F+ SKF +H +LNE  E +E K VPHRDFYNVRKVD HIHAA+ MNQKHLLRFI+ +     + +V + K    ++ L ++F +L +  YDL VD L+VHA   TFHRFDKFN KYNPVG  +LRE++LKT N  +G +FA++++EV  DLEESKYQY E RLSIYG+S +EW+ LAKW  +  + S   +WIIQ+PRIYD+ +    I NF +M+ N+F PLFE T NP  H E+H FL  V+  DSVDDESK           KP+EWT  +NPPY YY+Y+++ N+M LN+LR +R L   + RPHCGEAGSI HL+S ++ ADNI+HGL L+KSPVLQYLFYL Q+ IAMSPLSNNSLFL Y +NPL  FL KGL VS+STDDP+QFH+TKE LMEEY+IAAQ+WKL++ D+CE+ARNS+L SG S + K+H+LGENY ++G  GN+I  +NV  +R+A+R ETL  EL + L+  V  E
Sbjct:  244 LPYPDMETFAIDMTHVLAMIADGPTKTYCHRRLNFLMSKFYLHEMLNEMAELKELKCVPHRDFYNVRKVDTHIHAAACMNQKHLLRFIQNTCDVEGD-RVVMEKGGK-KITLKQVFQNLHMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELREIYLKTDNYINGEYFARLIKEVAHDLEESKYQYAEPRLSIYGRSPEEWENLAKWFIQQKVYSPNMRWIIQVPRIYDIFRLKKIIPNFAKMLENIFLPLFEATVNPQKHKEMHVFLKYVTGFDSVDDESKHSDHMFSYKSPKPEEWTAEENPPYSYYLYHMYANIMVLNNLRKERGLSTFQFRPHCGEAGSITHLVSAFLTADNISHGLNLKKSPVLQYLFYLAQVPIAMSPLSNNSLFLEYSKNPLREFLHKGLCVSLSTDDPMQFHYTKEALMEEYAIAAQLWKLSTCDVCEIARNSVLQSGISHQEKKHFLGENYLQDGPDGNDIRRTNVAQIRMAYRHETLCNEL-SFLVDAVKSE 758          
BLAST of AMP deaminase vs. Ensembl Cavefish
Match: ampd3a (AMP deaminase 3-like [Source:NCBI gene;Acc:103043749])

HSP 1 Score: 540.036 bits (1390), Expect = 0.000e+0
Identity = 280/519 (53.95%), Postives = 373/519 (71.87%), Query Frame = 1
Query:  397 SIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKE 1953
             +P+     F +D   +  +I DGP  ++  RRL+F+ SKF +H +LNE  E +E K VPHRDFYNVRKVD HIHAA+ MNQKHLL FI+ + K  +  +V + K T   L L ++F++L +  YDL VD L+VHA   TFHRFDKFN KYNPVG  +LRE++LKT N   G +FA++++EV  DLEESKYQ+ E RLSIYG+  +EW+ L++W  ++ + S   +W+IQ+PRIYD+ KS   + NF +M+ N+F PLFE T NP  H ELH FL  V+  DSVDDESK           KP++WT +DNPPY YY+++++ N+M LN+LR +R L   + RPHCGEAGSI HL+S ++ ADNI+HGL L+KSPVLQYL+YL Q+ IAMSPLSNNSLFL Y +NPL  FL KGL VS+STDDP+QFH+TKE LMEEY+IAAQ+WKL++ D+CE+ARNS+L SG S + K+H++G NY ++G  GN+I  +NV  +R+A+R ETL  EL + L+  V  E
Sbjct:  257 CLPYPDLETFALDMSHVLAMIADGPTKTYCHRRLNFLGSKFYLHEMLNEMAELKELKGVPHRDFYNVRKVDTHIHAAACMNQKHLLNFIQTTYKTDAE-RVVLEK-TGQRLTLKQVFNNLSMDPYDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELREIYLKTDNHIKGEYFARLIKEVAHDLEESKYQHAEPRLSIYGRCPEEWESLSQWFIQHKVHSPNMRWVIQVPRIYDIFKSRKLVPNFAKMLENIFLPLFEATVNPQKHKELHIFLKYVTGFDSVDDESKHSDHMFSYKSPKPEQWTTDDNPPYSYYLFHMYANIMVLNNLRKERGLSTFQFRPHCGEAGSITHLVSAFLTADNISHGLNLKKSPVLQYLYYLAQVPIAMSPLSNNSLFLEYSKNPLREFLHKGLCVSLSTDDPMQFHYTKEALMEEYAIAAQLWKLSTCDLCEIARNSVLQSGLSHQEKKHFVGANYLKDGPEGNDIRRTNVAQIRMAYRHETLCNEL-SFLVDAVKSE 772          
BLAST of AMP deaminase vs. Ensembl Sea Lamprey
Match: ampd1 (adenosine monophosphate deaminase 1 (isoform M) [Source:ZFIN;Acc:ZDB-GENE-040426-1906])

HSP 1 Score: 523.087 bits (1346), Expect = 1.904e-178
Identity = 287/527 (54.46%), Postives = 373/527 (70.78%), Query Frame = 1
Query:  385 DIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIE-KPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKESSI 1962
            + + S+P++    FI D  F+  LI DGP  +F  RRL+F+ SKF +H +LNE  E +E K V HRDFYNVRKVD HIHAA+ MNQKHLLRFIK S        V + KD  V + L +LF+SLK+   DL VD L+VHA   TFHRFDKFN KYNPVG  +LR++++KT N   G +FA I++EV  DLEES+YQ+ E RLS+YG   DEW +LA W  ++ + S   KW+IQ+PRIYD+ ++   + NF  M+ N+F PLFE T NPN H  LH FL  V+  DSVDDESK   G M+ +   KP EW    NP Y YY+YY++ N+M LN+LR +R +     RPHCGEAG++ HL++ +MLADNI+HGL L+KSPVLQYL+YL Q+ IAMSPLSNNSLFL Y +NPL  FL KGL +S+STDDP+QFHFTKEPLMEEY+IAAQV+KL++ DMCE+ARNS+L S +S + K+H+LG NY ++G  GN I  +NV ++R+A+R ET   EL +L++  +   S I
Sbjct:  147 EALHSLPYLDIDTFIDDMNFLLTLIADGPTKTFCHRRLNFLGSKFNLHEMLNEMAEMKELKEVAHRDFYNVRKVDTHIHAAACMNQKHLLRFIKHSYLVDPERVVRV-KD-GVPVTLRQLFESLKLHPNDLTVDSLDVHAGRQTFHRFDKFNSKYNPVGASELRDLYIKTDNHIKGEYFATIIKEVASDLEESRYQHAEPRLSVYGSKRDEWHKLADWFIQHRVYSPNLKWMIQMPRIYDIFRAKNLVLNFGTMLDNIFLPLFEATINPNQHKHLHVFLKHVTGFDSVDDESK-HSGHMFSSKSPKPQEWDVQKNPSYTYYMYYMYANVMVLNNLRRERGMNTFLFRPHCGEAGAVTHLLAAFMLADNISHGLNLKKSPVLQYLYYLAQLPIAMSPLSNNSLFLEYAKNPLLEFLQKGLCISLSTDDPMQFHFTKEPLMEEYAIAAQVFKLSTCDMCEIARNSVLQSAYSHEEKKHFLGNNYLQDGPAGNNILKTNVAHIRLAYRYETWCYEL-DLIMDAMKATSEI 669          
BLAST of AMP deaminase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010379.1 (pep scaffold:Pmarinus_7.0:GL480085:7718:22400:1 gene:ENSPMAG00000009393.1 transcript:ENSPMAT00000010379.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 449.899 bits (1156), Expect = 9.401e-150
Identity = 245/501 (48.90%), Postives = 332/501 (66.27%), Query Frame = 1
Query:  418 SEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGEL 1920
            S  + D   +  L+ DGP+ +F  RRL  + +KFQ+H + NE  E  + K    RDF NV KVD HIHAA+ M  + LL+ ++ +  +   + V    D   EL L ELF  L +    +++D L+VH D +TF RFD+FN KYNP+G  +LR VFLKT+N   G +FA +++ V + LE S+YQY E R+S+YG+S  +W++LA W +++ + S   +W+IQ+PRIY + ++   I +F  M+ N+F PLFEVT NP+S+P LH FL  V+  DSV DES  E G    +   P+EWT  +NPPY YY+YY+F N+  LN LR +  +     RPHCGEAGS+ HL   ++ +DNI+HG+ L KSPVLQYL+YLCQI IAMSP+SNNSLFL Y RNP   F  KGL VS+S+DDPLQFHFT+E L+EEY+ AA  WKL++ D+CE+A NS+  SG S   KR +LG+ Y EEG  GN+   SNV  +R+AFR ETL  EL
Sbjct:  172 SSHLSDLGVLLGLVQDGPLKTFCQRRLKLLAAKFQVHQMTNELAEMIQLKVDGCRDFENVVKVDTHIHAAACMTARELLQMMRSA--REEGVPVSRGPDGR-ELTLAELFAQLHLRSDSIDLDNLDVHVDRDTFQRFDRFNDKYNPLGSSELRNVFLKTNNHMSGKYFAMLVKNVGRRLEASRYQYAEPRMSVYGRSRGDWEKLAGWFEQHQVYSPHLRWVIQVPRIYHIFRTRNIIPSFGVMLENIFLPLFEVTLNPDSNPTLHNFLQHVTGFDSVSDESLAE-GLFLPDSPAPEEWTSAENPPYAYYVYYMFANVAVLNQLRRQCNMNTFVFRPHCGEAGSVAHLADSFLTSDNISHGINLSKSPVLQYLYYLCQIPIAMSPISNNSLFLEYSRNPFLDFYHKGLTVSLSSDDPLQFHFTQEALVEEYATAAHFWKLSTCDLCEIASNSVRQSGLSHMEKREFLGDKYLEEGPEGNDATKSNVAPIRVAFRHETLCQEL 668          
BLAST of AMP deaminase vs. Ensembl Sea Lamprey
Match: ampd2a (adenosine monophosphate deaminase 2a [Source:ZFIN;Acc:ZDB-GENE-091204-4])

HSP 1 Score: 270.781 bits (691), Expect = 1.487e-83
Identity = 131/244 (53.69%), Postives = 171/244 (70.08%), Query Frame = 1
Query:  367 SRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRI 1098
            S  Q +D +  +P+   + FI D   +  +  +GP+ SF +RRL F+ +KFQMH LLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR+VK+ S+    +++D   E  L ++F+ L ++ +DL+VD L+VHAD NTFHRFDKFN KYNPVG   LRE+F+KT N   G +FA I++EV  DLEESKYQ  ELRLSIYG+   EW+ LAKW   + + S   +W+IQIPR+
Sbjct:  231 SPGQHRDELVDLPYGDLAAFIADMNILMAMSINGPLKSFCYRRLQFLSAKFQMHALLNEMKELSAQKRVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAVKRESD--EVVHRDQGKEQTLKQVFEDLNLTAFDLSVDMLDVHADRNTFHRFDKFNAKYNPVGESILREIFIKTDNCIGGRYFAHIIKEVMSDLEESKYQNAELRLSIYGRERGEWEGLAKWAVTHRVYSHNVRWLIQIPRL 472          
BLAST of AMP deaminase vs. Ensembl Yeast
Match: AMD1 (AMP deaminase; tetrameric enzyme that catalyzes the deamination of AMP to form IMP and ammonia; thought to be involved in regulation of intracellular purine (adenine, guanine, and inosine) nucleotide pools [Source:SGD;Acc:S000004498])

HSP 1 Score: 512.686 bits (1319), Expect = 1.035e-172
Identity = 266/515 (51.65%), Postives = 372/515 (72.23%), Query Frame = 1
Query:  376 QMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGEL 1920
            +  ++I  IP ++  ++ +D + +  + +DGP  SF++RRL ++ +++ ++ LLNE  E+   K  PHRDFYNVRKVD H+H ++ MNQKHLLRFIK  ++ HS  +  I +D  + L L E+F SL ++ YDL++D L++HA  +TFHRFDKFNLKYNP+G   LRE+FLKT+N   G + A I ++V  DLE SKYQ  E R+S+YG+SLDEWD+LA WV    + S   +W++QIPR+YD+ K  G + +F+++ +N+F PLFEVT NP SHP+LH FL  V   DSVDDESK +    ++   KP  W    NPPY YY+YYL++N+  LN  R KR    L LRPHCGEAG   HL+S Y+LA  I+HG+LLRK P +QYL+YL Q+GIAMSPLSNN+LFL Y +NP P +  +GL VS+STDDPLQF +T+EPL+EEYS+AAQ++KL++ DMCELARNS+L SG+  ++K+HW+G+++ + GV GN++  +NVP++RI +R +TL  EL
Sbjct:  285 KTDELIAQIPTLR--DYYLDLEKMISISSDGPAKSFAYRRLQYLEARWNLYYLLNEYQETSVSKRNPHRDFYNVRKVDTHVHHSACMNQKHLLRFIKHKLR-HSKDEKVIFRDGKL-LTLDEVFRSLHLTGYDLSIDTLDMHAHKDTFHRFDKFNLKYNPIGESRLREIFLKTNNYIKGTYLADITKQVIFDLENSKYQNCEYRISVYGRSLDEWDKLASWVIDNKVISHNVRWLVQIPRLYDIYKKTGIVQSFQDICKNLFQPLFEVTKNPQSHPKLHVFLQRVIGFDSVDDESKVD-RRFHRKYPKPSLWEAPQNPPYSYYLYYLYSNVASLNQWRAKRGFNTLVLRPHCGEAGDPEHLVSAYLLAHGISHGILLRKVPFVQYLYYLDQVGIAMSPLSNNALFLTYDKNPFPRYFKRGLNVSLSTDDPLQFSYTREPLIEEYSVAAQIYKLSNVDMCELARNSVLQSGWEAQIKKHWIGKDFDKSGVEGNDVVRTNVPDIRINYRYDTLSTEL 794          
BLAST of AMP deaminase vs. Ensembl Yeast
Match: YBR284W_mRNA (Putative metallo-dependent hydrolase superfamily protein; similar to AMP deaminases but lacks key catalytic residues and does not rescue purine nucleotide metabolic defect of quadruple aah1 ade8 amd1 his1 mutant; null mutant exhibits longer telomeres, altered Ty mobility, decreased resistance to rapamycin and wortmannin; induced in response to hydrostatic pressure; not an essential gene; YBR284W has a paralog, YJL070C, that arose from the whole genome duplication [Source:SGD;Acc:S000000488])

HSP 1 Score: 176.022 bits (445), Expect = 8.051e-47
Identity = 179/605 (29.59%), Postives = 274/605 (45.29%), Query Frame = 1
Query:  397 SIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGL-----------GELFDSLKI--------------SCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQE-VFQDLEESKYQYTELRLSI-----YGKS-LDEWDEL-AKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEX-----XXXXXXXXXXXXXXKPEIGSMYKNIEK----PDEWTK-XXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAG----------------------SILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSN--------------NSLFLN----YHRNPLPIFLGKGLKVSISTDDPLQFH-FTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLG-----ENYQEEG---------VHGNEIHLSNVPNVRIAFRLETLVGE 1917
            +IP  K  EF  DF++  ++I D  +  FS +RL ++ +KF +   L+   E R+ K VPH+DFYN RK+D ++  +   +Q  L  FI   ++K  + +V         + L           G+ F+ LKI              + Y L  D++ +H  S+         L+Y  +      + FL+  N  +G + A++L+  + +  EESKYQ  +L +       Y  S +D W  + A W+  Y + S   +W I+I RIY  L   G + NF+E +  +F PLF      N+   LH+      L  +S + S+D   +     ++KN       P +WT   DNP    Y+YY++ NL KLNH+R         LR  C                          + L    G++ A+N     L    P L YLFYL QI + ++PL++                L L     Y +NP   F   G K+S+S++  L  + +TKEP++EEYS+AA +++L S D+CEL RNS++ SGFS  LK  WLG      +Y  E             N     NVP +R  +R  TL GE
Sbjct:  212 NIPTFK--EFREDFEWCLKIIRDRSLSRFSEKRLQYLVNKFPVFQHLHSKEEMRQSKKVPHKDFYNCRKIDLNLLLSGCFSQWQLTEFIWTKLRKEPD-RVIHQAFNGSHITLSQLFKVNFEETGQFFNGLKIIDDSFLEWYKVIYLAKYHLVNDEMEIHTGSHGKQ------LRYYLIA-----KTFLEFDNYINGEYLAELLKTFLIKPQEESKYQLCQLSVDFQFYLHYDNSDVDNWWMVFANWLNHYNIFSNNIRWNIRISRIYPELYHTGKVKNFQEYLNLIFKPLF------NAENYLHKSLGPILLKFLSQVSSIDLCIQDTDNYIWKNFTAVSCLPKDWTSGGDNPTISQYMYYVYVNLTKLNHIRQALHQNTFTLRSSCSPTSMNRTSQFSNTLNFTEHTEAILNNFLLACGGFLNAEN-----LWNAPPSLVYLFYLSQIPMVVAPLNSIVDSKPTMLQEQAPTGLVLEPSKPYKKNPFMKFFEMGFKISLSSESILYNNSYTKEPIIEEYSVAASIYRLHSADLCELLRNSVITSGFSSTLKNKWLGVSLASHDYFVENTGFVDKWYDCKPNTSLEHNVPIIRRQYRSSTLAGE 791          
BLAST of AMP deaminase vs. Ensembl Yeast
Match: YJL070C_mRNA (Putative metallo-dependent hydrolase superfamily protein; similar to AMP deaminases but lacks key catalytic residues and does not rescue purine nucleotide metabolic defect of quadruple aah1 ade8 amd1 his1 mutant; may regulate purine nucleotide homeostasis as overexpression in an AMD1 strain grown in adenine results in greatly reduced GDP and GTP intracellular levels; not an essential gene; YJL070C has a paralog, YBR284W, that arose from the whole genome duplication [Source:SGD;Acc:S000003606])

HSP 1 Score: 161.384 bits (407), Expect = 9.557e-42
Identity = 169/596 (28.36%), Postives = 273/596 (45.81%), Query Frame = 1
Query:  421 EFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDK------FNLKYNPVG--VGD------LREVFLKTSNLCDGIFFAQI-LQEVFQDLEESKYQYTELRLSI--YGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLF-----EVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIE----KPDEWT-KXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGS-ILHLISGYMLADNINHGL---------------LLRKSPVLQYLFYLCQIGIAMSPLSNNSL-------FL--------------------------------NYHRNPLPIFLGKGLKVSISTDDPL-QFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLG-----ENYQEEGVHGNEIHLS---------NVPNVRIAFRLETLVGE 1917
            EF  DF +I +LI        S +RLS++  KF++   LN   E    KNVP+RDFYN RKVD  +  +  ++Q+ L  +I   +       V+ + +T+ +L L ++F     S  D  +  + +    + F  + +      ++L  N V   VG       L +VFL+  N  +G + A+I ++ V   LE+SKYQ  ++ ++   Y    D + + ++W+ ++ + S   +W IQI RI+  L     ++NF+E +  +F PLF     ++  + + + ++    F +S++ S+D   K      +K       KP  WT + DNP   +Y+YY++ +L K+N LR++     + LR +C    S            D +   +               L   + ++QYLFYL QI I  +PLS+ SL       FL                                +Y  NP       GLK+S+S+   L    +T EPL+EEYS+AA ++ L  TD+CEL+R S+L SG+    K HW+G       Y EE V G +             NVP +R  +R ETL  E
Sbjct:  280 EFRDDFAYIIELIQSHKFNEVSRKRLSYLLDKFELFQYLNSKKEILANKNVPYRDFYNSRKVDRDLSLSGCISQRQLSEYIWEKINLEPERIVYQDPETSRKLSLRDIF-QFGCSSNDQPI-AIGLKLIDDEFLDWYRNIYLIDYHLTPNKVAKLVGKEMRFYLLAKVFLEFDNFIEGEYLAEIFIKYVIHILEKSKYQLAQVSVNFQFYSSGEDWYKKFSQWLLRWKLVSYNIRWNIQIARIFPKLFKENVVSNFQEFLDLIFNPLFTLEKEQLPIDSSVNTDIIGLQFFLSNVCSMDLVIKESDEYYWKEFTDMNCKPKFWTAQGDNPTVAHYMYYIYKSLAKVNFLRSQNLQNTITLRNYCSPLSSRTSQFGVDLYFTDQVESLVCNLLLCNGGLLQVEPLWDTATMIQYLFYLFQIPILAAPLSSVSLLNSQKSTFLKNKNVLLEHDYLKDQETAKINPSRDITVGEQRSYETNPFMKMFKMGLKISLSSKSILYNSSYTLEPLIEEYSVAASIYLLNPTDLCELSRTSVLSSGYEGWYKAHWIGVGVKKAPYFEENVGGIDNWYDTAKDTSIKHNVPMIRRRYRKETLDQE 873          
BLAST of AMP deaminase vs. Ensembl Nematostella
Match: EDO38389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD62])

HSP 1 Score: 527.324 bits (1357), Expect = 0.000e+0
Identity = 286/500 (57.20%), Postives = 355/500 (71.00%), Query Frame = 1
Query:  421 EFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGEL 1920
            EF  D   +  L T GPI SF++RRL ++ S++ +H LLNE  E    K VPHRDFYNVRKVD H+HAAS MNQKHLLRFIK+ VK   +  V ++     E  L E+F  L ++ YDL+VD L+VHAD NTFHRFDKFN KYNPVG   LRE+FLKT N  DG +FAQ+++EV  DLEESKYQ  E R+SIYG+S++EWD LAKW   + + S   +W+IQIPR++DV ++ G + NF+EM+ N+F PLFE T NP SHPELH+FL  V   DSVDDESK E     +    P  WT  DNPPY YY+YY+++N++ LNHLR +R    L+LRPHCGEAG   HL++ +MLA+NI+HGLLLRK P LQYL+YL QIGIAMSPLSNNSLFLNY RNPLP              D    H+  EPLMEEYSIAAQVWKL+  DM ELARNS+LMSGF +++KR W+G + + EG   N+I  +NVPN+R+ FR ETL+ EL
Sbjct:   96 EFFEDQNILLALSTHGPIKSFAYRRLKYLESRYSLHTLLNEMKELAAMKEVPHRDFYNVRKVDTHVHAASCMNQKHLLRFIKKKVKCEGDEPVIMHDGK--EATLREVFAMLNLTPYDLSVDTLDVHADRNTFHRFDKFNSKYNPVGESRLREIFLKTDNYIDGRYFAQLMKEVMVDLEESKYQNAEPRISIYGRSINEWDALAKWAVNHDVFSENVRWVIQIPRLFDVYRAKGLVKNFQEMLENLFMPLFEATINPQSHPELHKFLTQVIGFDSVDDESKTEKSLFTETSPLPANWTSQDNPPYAYYLYYMYSNMVVLNHLRRERGFNTLRLRPHCGEAGPAHHLVTAFMLAENISHGLLLRKVPALQYLYYLAQIGIAMSPLSNNSLFLNYQRNPLP--------------DGQSRHYPHEPLMEEYSIAAQVWKLSPCDMAELARNSVLMSGFEEEVKRQWIGCD-KLEG--SNDITKTNVPNIRVCFRQETLLQEL 576          
BLAST of AMP deaminase vs. Ensembl Medaka
Match: ampd2b (AMP deaminase 2 [Source:NCBI gene;Acc:101164309])

HSP 1 Score: 605.905 bits (1561), Expect = 0.000e+0
Identity = 314/515 (60.97%), Postives = 394/515 (76.50%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIV 1944
            +P+    E+I D   +  LI +GP+ SF +RRL ++ SKFQMH+LLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++KK+    V + K       L E+F+S+ ++ +DL+VD L++HAD NTFHRFDKFN KYNP+G   LRE+F+KT N  +G +F  I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W  K+G+ S   +W++Q+PR++DV  +   ++NF+EM+ N+F PLFEVT NP+SHPELH FL  V  LDSVDDESKPE      +   P  WT+ DNPPY YY+YY++ N+  LNHLR +R    L LRPHCGEAG I HL+SG+ML++NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS+LMSGFS K K +WLG NY +EG   N+I  +NVP++R+A+R ETL  EL NL+   +
Sbjct:  258 LPYPDLQEYIGDMNVMMALIINGPVKSFCYRRLQYLSSKFQMHILLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYPKDIVHMEKGKGQ--TLMEVFESMNLTAFDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNCIEGKYFGHIVKEVMADLEESKYQNVELRLSIYGRSGDEWDKLAEWAVKHGVYSDNVRWLVQVPRLFDVYHTKKQLSNFQEMLENIFKPLFEVTVNPSSHPELHLFLQHVVGLDSVDDESKPEQHIFNLDSPLPANWTEEDNPPYSYYLYYMYANMTVLNHLRRQRGFHTLALRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLIVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFSHKAKSYWLGPNYFKEGQESNDIRRTNVPDIRVAYRYETLCEEL-NLITQAI 769          
BLAST of AMP deaminase vs. Ensembl Medaka
Match: ampd2b (AMP deaminase 2 [Source:NCBI gene;Acc:101164309])

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 314/515 (60.97%), Postives = 394/515 (76.50%), Query Frame = 1
Query:  400 IPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIV 1944
            +P+    E+I D   +  LI +GP+ SF +RRL ++ SKFQMH+LLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++KK+    V + K       L E+F+S+ ++ +DL+VD L++HAD NTFHRFDKFN KYNP+G   LRE+F+KT N  +G +F  I++EV  DLEESKYQ  ELRLSIYG+S DEWD+LA+W  K+G+ S   +W++Q+PR++DV  +   ++NF+EM+ N+F PLFEVT NP+SHPELH FL  V  LDSVDDESKPE      +   P  WT+ DNPPY YY+YY++ N+  LNHLR +R    L LRPHCGEAG I HL+SG+ML++NI+HGLLLRK+PVLQYL+YL QIGIAMSPLSNNSLFL+YHRNPLP +L +GL VS+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS+LMSGFS K K +WLG NY +EG   N+I  +NVP++R+A+R ETL  EL NL+   +
Sbjct:  290 LPYPDLQEYIGDMNVMMALIINGPVKSFCYRRLQYLSSKFQMHILLNEMKELAAQKKVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYPKDIVHMEKGKGQ--TLMEVFESMNLTAFDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNCIEGKYFGHIVKEVMADLEESKYQNVELRLSIYGRSGDEWDKLAEWAVKHGVYSDNVRWLVQVPRLFDVYHTKKQLSNFQEMLENIFKPLFEVTVNPSSHPELHLFLQHVVGLDSVDDESKPEQHIFNLDSPLPANWTEEDNPPYSYYLYYMYANMTVLNHLRRQRGFHTLALRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQIGIAMSPLSNNSLFLSYHRNPLPEYLSRGLIVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFSHKAKSYWLGPNYFKEGQESNDIRRTNVPDIRVAYRYETLCEEL-NLITQAI 801          
BLAST of AMP deaminase vs. Ensembl Medaka
Match: ampd2a (AMP deaminase 2 [Source:NCBI gene;Acc:101167198])

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 306/500 (61.20%), Postives = 383/500 (76.60%), Query Frame = 1
Query:  421 EFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGEL 1920
            E+I D   +  LI +GP+ SF +RRL ++ SKFQMH+LLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++KK+    V +  +   E  L ++F+S+ ++ YDL+VD L++HAD NTFHRFDKFN KYNP+G   LRE+F+KT N  +G +FA I++EV  DLEESKYQ +ELRLSIYG+S DEWD LA+W   + + S   +W+IQ+PR++DV ++   +ANF+EM+ N+F PLFE T NP SHPELH FL  V   DSVDDESKPE      +   P +WT  DNPPY YY+YY + N+  LN LR +R L    LRPHCGEAG I HL+SG+ML++NI+HGLLLRK+PVLQYL+YL Q+GIAMSPLSNNSLFL+YHRNPLP +L +GL +S+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS+LMSGFS + K +WLG NY +EG   N+I  +NVP++R+A+R ETL  EL
Sbjct:  236 EYIADMNVMMSLIINGPVKSFCYRRLQYLSSKFQMHILLNEMKELAAQKRVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYQGEIVHV--ECGREQTLKDVFESMNLTAYDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNYIEGKYFAHIVKEVMSDLEESKYQNSELRLSIYGRSRDEWDRLAQWAVTHRVYSDNVRWLIQVPRLFDVYQTKKQLANFQEMLENIFMPLFEATINPCSHPELHLFLEHVVGFDSVDDESKPEHHIFNLDSPLPADWTTEDNPPYSYYLYYTYANMTVLNQLRRQRGLHTFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQVGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFSHRAKSYWLGPNYYKEGPLSNDIRRTNVPDIRVAYRSETLTEEL 733          
BLAST of AMP deaminase vs. Ensembl Medaka
Match: ampd2a (AMP deaminase 2 [Source:NCBI gene;Acc:101167198])

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 306/500 (61.20%), Postives = 383/500 (76.60%), Query Frame = 1
Query:  421 EFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGEL 1920
            E+I D   +  LI +GP+ SF +RRL ++ SKFQMH+LLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++KK+    V +  +   E  L ++F+S+ ++ YDL+VD L++HAD NTFHRFDKFN KYNP+G   LRE+F+KT N  +G +FA I++EV  DLEESKYQ +ELRLSIYG+S DEWD LA+W   + + S   +W+IQ+PR++DV ++   +ANF+EM+ N+F PLFE T NP SHPELH FL  V   DSVDDESKPE      +   P +WT  DNPPY YY+YY + N+  LN LR +R L    LRPHCGEAG I HL+SG+ML++NI+HGLLLRK+PVLQYL+YL Q+GIAMSPLSNNSLFL+YHRNPLP +L +GL +S+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS+LMSGFS + K +WLG NY +EG   N+I  +NVP++R+A+R ETL  EL
Sbjct:  273 EYIADMNVMMSLIINGPVKSFCYRRLQYLSSKFQMHILLNEMKELAAQKRVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYQGEIVHV--ECGREQTLKDVFESMNLTAYDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNYIEGKYFAHIVKEVMSDLEESKYQNSELRLSIYGRSRDEWDRLAQWAVTHRVYSDNVRWLIQVPRLFDVYQTKKQLANFQEMLENIFMPLFEATINPCSHPELHLFLEHVVGFDSVDDESKPEHHIFNLDSPLPADWTTEDNPPYSYYLYYTYANMTVLNQLRRQRGLHTFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQVGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFSHRAKSYWLGPNYYKEGPLSNDIRRTNVPDIRVAYRSETLTEEL 770          
BLAST of AMP deaminase vs. Ensembl Medaka
Match: ampd2a (AMP deaminase 2 [Source:NCBI gene;Acc:101167198])

HSP 1 Score: 598.971 bits (1543), Expect = 0.000e+0
Identity = 306/500 (61.20%), Postives = 383/500 (76.60%), Query Frame = 1
Query:  421 EFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGEL 1920
            E+I D   +  LI +GP+ SF +RRL ++ SKFQMH+LLNE  E   QK VPHRDFYN+RKVD HIHA+S MNQKHLLRFIKR++KK+    V +  +   E  L ++F+S+ ++ YDL+VD L++HAD NTFHRFDKFN KYNP+G   LRE+F+KT N  +G +FA I++EV  DLEESKYQ +ELRLSIYG+S DEWD LA+W   + + S   +W+IQ+PR++DV ++   +ANF+EM+ N+F PLFE T NP SHPELH FL  V   DSVDDESKPE      +   P +WT  DNPPY YY+YY + N+  LN LR +R L    LRPHCGEAG I HL+SG+ML++NI+HGLLLRK+PVLQYL+YL Q+GIAMSPLSNNSLFL+YHRNPLP +L +GL +S+STDDPLQFHFTKEPLMEEYSIAAQVWKL+S DMCELARNS+LMSGFS + K +WLG NY +EG   N+I  +NVP++R+A+R ETL  EL
Sbjct:  250 EYIADMNVMMSLIINGPVKSFCYRRLQYLSSKFQMHILLNEMKELAAQKRVPHRDFYNIRKVDTHIHASSCMNQKHLLRFIKRAMKKYQGEIVHV--ECGREQTLKDVFESMNLTAYDLSVDTLDMHADRNTFHRFDKFNSKYNPIGESILREIFIKTDNYIEGKYFAHIVKEVMSDLEESKYQNSELRLSIYGRSRDEWDRLAQWAVTHRVYSDNVRWLIQVPRLFDVYQTKKQLANFQEMLENIFMPLFEATINPCSHPELHLFLEHVVGFDSVDDESKPEHHIFNLDSPLPADWTTEDNPPYSYYLYYTYANMTVLNQLRRQRGLHTFVLRPHCGEAGPIHHLVSGFMLSENISHGLLLRKAPVLQYLYYLAQVGIAMSPLSNNSLFLSYHRNPLPEYLSRGLMISLSTDDPLQFHFTKEPLMEEYSIAAQVWKLSSCDMCELARNSVLMSGFSHRAKSYWLGPNYYKEGPLSNDIRRTNVPDIRVAYRSETLTEEL 747          
BLAST of AMP deaminase vs. Planmine SMEST
Match: SMESG000045239.1 (SMESG000045239.1)

HSP 1 Score: 1117.45 bits (2889), Expect = 0.000e+0
Identity = 573/573 (100.00%), Postives = 573/573 (100.00%), Query Frame = 1
Query:  262 SFASDDNVEFEKWPVTFTMNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKESSIVIKRKE 1980
            SFASDDNVEFEKWPVTFTMNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEFLFDVSSLDSVDDESKPEIGSMYKNIEKPDEWTKNDNPPYDYYIYYLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKESSIVIKRKE
Sbjct:  155 SFASDDNVEFEKWPVTFTMNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEFLFDVSSLDSVDDESKPEIGSMYKNIEKPDEWTKNDNPPYDYYIYYLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKESSIVIKRKE 727          

HSP 2 Score: 157.918 bits (398), Expect = 3.938e-40
Identity = 78/78 (100.00%), Postives = 78/78 (100.00%), Query Frame = 2
Query:   26 MSITPNLFKQQHQNTSIDSDSVDSDLQSNSKDVIENSLVSWKVKVPSEPSIQKGEEAHIKAEAVDYQRVTILGEELLT 259
            MSITPNLFKQQHQNTSIDSDSVDSDLQSNSKDVIENSLVSWKVKVPSEPSIQKGEEAHIKAEAVDYQRVTILGEELLT
Sbjct:    1 MSITPNLFKQQHQNTSIDSDSVDSDLQSNSKDVIENSLVSWKVKVPSEPSIQKGEEAHIKAEAVDYQRVTILGEELLT 78          
BLAST of AMP deaminase vs. Planmine SMEST
Match: SMESG000018449.1 (SMESG000018449.1)

HSP 1 Score: 619.772 bits (1597), Expect = 0.000e+0
Identity = 318/519 (61.27%), Postives = 397/519 (76.49%), Query Frame = 1
Query:  409 VKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKESSIV 1965
            V + EF+ D+  +   ++DGP+ SF F+RL+F++ +F+MH LLNE  E+ EQK+V HRDFYN+RKVD HIHA+SSMNQKHLLRFIK+ +K H N KV I K +   L L E+F S+ ++ YDL +DKL+VH D +TFHRFDKFN KYNPVG  +LREVFLKT N  +G FFA +++EV  DLEESKYQ  ELRLS+YG+  +EWD LAKW     + S   KW+IQ PRIYD+ ++ G I +F+EM+ N+F PLFEVT +P+SHPELH FL  VS  DSVDDESK E   + KN   P+ W   DNPPY YY+YY++ N+  LN LR++R + I   RPHCGEAG + HL++G++L  NINHGLLLRK+PVLQYL+YLCQIGIAMSPLSNNSLFL+Y RNPL  F+ +GL VS+STDDPLQFHFTKEPLMEEYSIAAQVWK TSTDMCELARNS++MSGFSD +K  WLG+ ++EEGV GN++  +NVPN+RIAFR E L  EL NLL+ +  K  S +
Sbjct:  250 VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAEL-NLLLRMTLKNLSFL 767          
BLAST of AMP deaminase vs. Planmine SMEST
Match: SMESG000018449.1 (SMESG000018449.1)

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 318/519 (61.27%), Postives = 397/519 (76.49%), Query Frame = 1
Query:  409 VKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKESSIV 1965
            V + EF+ D+  +   ++DGP+ SF F+RL+F++ +F+MH LLNE  E+ EQK+V HRDFYN+RKVD HIHA+SSMNQKHLLRFIK+ +K H N KV I K +   L L E+F S+ ++ YDL +DKL+VH D +TFHRFDKFN KYNPVG  +LREVFLKT N  +G FFA +++EV  DLEESKYQ  ELRLS+YG+  +EWD LAKW     + S   KW+IQ PRIYD+ ++ G I +F+EM+ N+F PLFEVT +P+SHPELH FL  VS  DSVDDESK E   + KN   P+ W   DNPPY YY+YY++ N+  LN LR++R + I   RPHCGEAG + HL++G++L  NINHGLLLRK+PVLQYL+YLCQIGIAMSPLSNNSLFL+Y RNPL  F+ +GL VS+STDDPLQFHFTKEPLMEEYSIAAQVWK TSTDMCELARNS++MSGFSD +K  WLG+ ++EEGV GN++  +NVPN+RIAFR E L  EL NLL+ +  K  S +
Sbjct:  247 VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAEL-NLLLRMTLKNLSFL 764          
BLAST of AMP deaminase vs. Planmine SMEST
Match: SMESG000018449.1 (SMESG000018449.1)

HSP 1 Score: 619.387 bits (1596), Expect = 0.000e+0
Identity = 318/519 (61.27%), Postives = 397/519 (76.49%), Query Frame = 1
Query:  409 VKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKESSIV 1965
            V + EF+ D+  +   ++DGP+ SF F+RL+F++ +F+MH LLNE  E+ EQK+V HRDFYN+RKVD HIHA+SSMNQKHLLRFIK+ +K H N KV I K +   L L E+F S+ ++ YDL +DKL+VH D +TFHRFDKFN KYNPVG  +LREVFLKT N  +G FFA +++EV  DLEESKYQ  ELRLS+YG+  +EWD LAKW     + S   KW+IQ PRIYD+ ++ G I +F+EM+ N+F PLFEVT +P+SHPELH FL  VS  DSVDDESK E   + KN   P+ W   DNPPY YY+YY++ N+  LN LR++R + I   RPHCGEAG + HL++G++L  NINHGLLLRK+PVLQYL+YLCQIGIAMSPLSNNSLFL+Y RNPL  F+ +GL VS+STDDPLQFHFTKEPLMEEYSIAAQVWK TSTDMCELARNS++MSGFSD +K  WLG+ ++EEGV GN++  +NVPN+RIAFR E L  EL NLL+ +  K  S +
Sbjct:  234 VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAEL-NLLLRMTLKNLSFL 751          
BLAST of AMP deaminase vs. Planmine SMEST
Match: SMESG000018449.1 (SMESG000018449.1)

HSP 1 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 318/519 (61.27%), Postives = 397/519 (76.49%), Query Frame = 1
Query:  409 VKHSEFIMDFKFIRQLITDGPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNHIHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKISCYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGIFFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKSTQNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHEXXXXXXXXXXXXXXXKPEIGSMYKNIEKPDEWTKXXXXXXXXXXXXLFTNLMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKSPVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDPLQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWLGENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKESSIV 1965
            V + EF+ D+  +   ++DGP+ SF F+RL+F++ +F+MH LLNE  E+ EQK+V HRDFYN+RKVD HIHA+SSMNQKHLLRFIK+ +K H N KV I K +   L L E+F S+ ++ YDL +DKL+VH D +TFHRFDKFN KYNPVG  +LREVFLKT N  +G FFA +++EV  DLEESKYQ  ELRLS+YG+  +EWD LAKW     + S   KW+IQ PRIYD+ ++ G I +F+EM+ N+F PLFEVT +P+SHPELH FL  VS  DSVDDESK E   + KN   P+ W   DNPPY YY+YY++ N+  LN LR++R + I   RPHCGEAG + HL++G++L  NINHGLLLRK+PVLQYL+YLCQIGIAMSPLSNNSLFL+Y RNPL  F+ +GL VS+STDDPLQFHFTKEPLMEEYSIAAQVWK TSTDMCELARNS++MSGFSD +K  WLG+ ++EEGV GN++  +NVPN+RIAFR E L  EL NLL+ +  K  S +
Sbjct:  226 VDYLEFVRDYHALSTFVSDGPLKSFCFKRLNFLNYRFKMHTLLNEWKETAEQKSVAHRDFYNIRKVDTHIHASSSMNQKHLLRFIKKCIKLHPNEKVMIEKASGRILSLVEVFKSMDLTPYDLTIDKLDVHCDRDTFHRFDKFNAKYNPVGQSELREVFLKTDNYNNGRFFAHVIKEVMADLEESKYQNAELRLSVYGRKYNEWDSLAKWAVTNKVYSDNVKWMIQFPRIYDIFRTKGIIKSFQEMLHNIFTPLFEVTRDPSSHPELHAFLNHVSGFDSVDDESKSESCVIDKNTLNPENWVCQDNPPYAYYLYYMYANMSVLNELRSQRGMDIFTFRPHCGEAGPVQHLVAGFLLGHNINHGLLLRKAPVLQYLYYLCQIGIAMSPLSNNSLFLDYQRNPLYDFMCRGLHVSLSTDDPLQFHFTKEPLMEEYSIAAQVWKFTSTDMCELARNSVMMSGFSDTIKSFWLGKQFKEEGVQGNDVFRTNVPNIRIAFRFEALTAEL-NLLLRMTLKNLSFL 743          
The following BLAST results are available for this feature:
BLAST of AMP deaminase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AMPD20.000e+058.97adenosine monophosphate deaminase 2 [Source:HGNC S... [more]
AMPD20.000e+058.97adenosine monophosphate deaminase 2 [Source:HGNC S... [more]
AMPD20.000e+058.97adenosine monophosphate deaminase 2 [Source:HGNC S... [more]
AMPD20.000e+058.97adenosine monophosphate deaminase 2 [Source:HGNC S... [more]
AMPD20.000e+058.97adenosine monophosphate deaminase 2 [Source:HGNC S... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ampd-10.000e+059.72AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9... [more]
ampd-10.000e+059.84AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9... [more]
ampd-10.000e+059.84AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9... [more]
ampd-10.000e+059.84AMP deaminase [Source:UniProtKB/TrEMBL;Acc:A0A2C9... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AMPdeam0.000e+060.40gene:FBgn0052626 transcript:FBtr0340444[more]
AMPdeam0.000e+060.40gene:FBgn0052626 transcript:FBtr0303292[more]
AMPdeam0.000e+060.40gene:FBgn0052626 transcript:FBtr0340445[more]
AMPdeam0.000e+060.40gene:FBgn0052626 transcript:FBtr0301044[more]
AMPdeam0.000e+060.40gene:FBgn0052626 transcript:FBtr0301046[more]
back to top
BLAST of AMP deaminase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ampd2b0.000e+059.32adenosine monophosphate deaminase 2b [Source:ZFIN;... [more]
ampd2b0.000e+059.32adenosine monophosphate deaminase 2b [Source:ZFIN;... [more]
ampd2a0.000e+059.42adenosine monophosphate deaminase 2a [Source:ZFIN;... [more]
ampd2a0.000e+058.45adenosine monophosphate deaminase 2a [Source:ZFIN;... [more]
ampd3b0.000e+053.90adenosine monophosphate deaminase 3b [Source:ZFIN;... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc5a50.000e+057.88solute carrier family 5 member 5 [Source:Xenbase;A... [more]
slc5a50.000e+057.88solute carrier family 5 member 5 [Source:Xenbase;A... [more]
slc5a50.000e+058.77solute carrier family 5 member 5 [Source:Xenbase;A... [more]
slc5a50.000e+059.46solute carrier family 5 member 5 [Source:Xenbase;A... [more]
slc5a50.000e+058.07solute carrier family 5 member 5 [Source:Xenbase;A... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ampd20.000e+061.00adenosine monophosphate deaminase 2 [Source:MGI Sy... [more]
Ampd20.000e+061.00adenosine monophosphate deaminase 2 [Source:MGI Sy... [more]
Ampd20.000e+061.00adenosine monophosphate deaminase 2 [Source:MGI Sy... [more]
Ampd30.000e+054.86adenosine monophosphate deaminase 3 [Source:MGI Sy... [more]
Ampd30.000e+054.86adenosine monophosphate deaminase 3 [Source:MGI Sy... [more]
back to top
BLAST of AMP deaminase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q02356|AMPD2_RAT0.000e+061.00AMP deaminase 2 OS=Rattus norvegicus OX=10116 GN=A... [more]
sp|Q01433|AMPD2_HUMAN0.000e+058.97AMP deaminase 2 OS=Homo sapiens OX=9606 GN=AMPD2 P... [more]
sp|Q9DBT5|AMPD2_MOUSE0.000e+061.00AMP deaminase 2 OS=Mus musculus OX=10090 GN=Ampd2 ... [more]
sp|O08739|AMPD3_MOUSE0.000e+054.86AMP deaminase 3 OS=Mus musculus OX=10090 GN=Ampd3 ... [more]
sp|Q01432|AMPD3_HUMAN0.000e+055.11AMP deaminase 3 OS=Homo sapiens OX=9606 GN=AMPD3 P... [more]
back to top
BLAST of AMP deaminase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1HRS20.000e+063.53A_deaminase domain-containing protein (Fragment) O... [more]
A0A0X3P7Y60.000e+058.94AMP deaminase 2 OS=Schistocephalus solidus OX=7066... [more]
A0A224XKR10.000e+063.53AMP deaminase OS=Panstrongylus lignarius OX=156445... [more]
A0A0V0G7X80.000e+063.33AMP deaminase OS=Triatoma dimidiata OX=72491 PE=3 ... [more]
A0A1E1XD260.000e+060.70Putative adenosine monophosphate deaminase (Fragme... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ampd2a0.000e+059.37adenosine monophosphate deaminase 2a [Source:ZFIN;... [more]
ampd3b0.000e+055.02AMP deaminase 3 [Source:NCBI gene;Acc:103023811][more]
ampd3b0.000e+055.02AMP deaminase 3 [Source:NCBI gene;Acc:103023811][more]
ampd3b0.000e+055.02AMP deaminase 3 [Source:NCBI gene;Acc:103023811][more]
ampd3a0.000e+053.95AMP deaminase 3-like [Source:NCBI gene;Acc:1030437... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ampd11.904e-17854.46adenosine monophosphate deaminase 1 (isoform M) [S... [more]
ENSPMAT00000010379.19.401e-15048.90pep scaffold:Pmarinus_7.0:GL480085:7718:22400:1 ge... [more]
ampd2a1.487e-8353.69adenosine monophosphate deaminase 2a [Source:ZFIN;... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
AMD11.035e-17251.65AMP deaminase; tetrameric enzyme that catalyzes th... [more]
YBR284W_mRNA8.051e-4729.59Putative metallo-dependent hydrolase superfamily p... [more]
YJL070C_mRNA9.557e-4228.36Putative metallo-dependent hydrolase superfamily p... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO383890.000e+057.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of AMP deaminase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ampd2b0.000e+060.97AMP deaminase 2 [Source:NCBI gene;Acc:101164309][more]
ampd2b0.000e+060.97AMP deaminase 2 [Source:NCBI gene;Acc:101164309][more]
ampd2a0.000e+061.20AMP deaminase 2 [Source:NCBI gene;Acc:101167198][more]
ampd2a0.000e+061.20AMP deaminase 2 [Source:NCBI gene;Acc:101167198][more]
ampd2a0.000e+061.20AMP deaminase 2 [Source:NCBI gene;Acc:101167198][more]
back to top
BLAST of AMP deaminase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000045239.13.938e-40100.00SMESG000045239.1[more]
SMESG000018449.10.000e+061.27SMESG000018449.1[more]
SMESG000018449.10.000e+061.27SMESG000018449.1[more]
SMESG000018449.10.000e+061.27SMESG000018449.1[more]
SMESG000018449.10.000e+061.27SMESG000018449.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014264 ID=SMED30014264|Name=AMP deaminase|organism=Schmidtea mediterranea sexual|type=transcript|length=2078bp
TATATATAATTATCAATTCAGAATTATGAGCATTACTCCAAATTTATTTA
AACAACAGCATCAAAACACAAGCATAGATTCAGATTCGGTTGATAGTGAT
CTCCAAAGTAATTCTAAAGATGTTATAGAAAATTCTTTGGTGAGTTGGAA
AGTCAAAGTTCCATCGGAACCCAGTATACAAAAAGGAGAGGAAGCTCACA
TCAAAGCTGAAGCGGTTGACTATCAAAGGGTTACAATTCTTGGTGAAGAA
CTTTTAACGATTCGTTTGCCAGTGATGATAATGTTGAATTTGAAAAATGG
CCAGTAACGTTTACAATGAACAAAGGAGTTGTTCAGATGGATCTCATGAA
CGAGGTCACTGAGAGTTCTAGAAAACAAATGAAAGACATCATTGACTCCA
TACCCCACGTGAAACATTCTGAATTTATTATGGATTTCAAATTCATAAGA
CAGTTAATAACCGATGGTCCAATAATTTCCTTTAGTTTTCGGAGATTATC
TTTTATTCATTCTAAATTTCAAATGCATGTCCTATTAAATGAGGATTTGG
AATCTCGAGAGCAGAAAAATGTTCCACATCGAGACTTTTACAATGTTCGA
AAGGTGGACAATCATATACATGCTGCCAGTTCAATGAACCAAAAGCATTT
ACTTCGTTTTATCAAGAGAAGTGTCAAGAAACATTCTAATTTGAAAGTCT
TTATTAATAAAGATACCAATGTAGAACTTGGACTGGGAGAACTATTCGAT
TCATTGAAAATATCTTGCTATGATCTCAATGTTGACAAGCTCAATGTTCA
TGCAGACAGCAATACGTTCCACAGGTTTGACAAGTTTAATTTGAAATATA
ATCCAGTTGGGGTCGGTGATTTGAGGGAGGTGTTCCTTAAAACGAGTAAT
TTATGCGATGGAATATTTTTTGCTCAAATACTTCAAGAAGTTTTCCAAGA
TTTAGAAGAAAGTAAATATCAATATACAGAATTGAGATTGTCCATTTATG
GGAAATCTCTCGATGAATGGGATGAACTAGCGAAATGGGTGAAGAAATAT
GGAATGAAATCCACACAAAATAAATGGATCATCCAAATACCAAGGATATA
TGATGTTCTCAAAAGTAATGGGTTCATTGCAAACTTCGAAGAAATGATTC
GAAACGTTTTCTTTCCTCTTTTCGAGGTTACAGGAAATCCAAACTCTCAT
CCAGAACTTCATGAATTTCTATTTGATGTTTCTTCACTCGATTCAGTTGA
CGATGAATCGAAACCGGAAATAGGATCAATGTATAAGAATATAGAAAAAC
CAGATGAATGGACGAAAAATGACAATCCACCATACGATTATTACATATAT
TATTTATTCACAAATTTAATGAAGCTCAATCATTTAAGGACAAAAAGGAG
ATTGCCTATTTTAAAACTTCGACCTCACTGTGGAGAAGCTGGATCTATTT
TGCATTTAATTTCCGGGTATATGCTCGCTGATAATATCAATCACGGTCTT
TTATTGAGAAAATCTCCTGTACTGCAATATTTGTTTTACTTATGCCAGAT
AGGCATAGCCATGTCACCTTTGAGCAATAATTCTCTATTTTTAAATTATC
ACAGAAATCCTTTACCTATTTTCTTGGGTAAAGGATTGAAAGTGTCAATC
AGTACGGATGATCCTCTGCAATTTCATTTCACAAAAGAGCCGTTAATGGA
AGAGTACAGTATTGCTGCACAGGTTTGGAAGTTGACATCGACCGACATGT
GTGAACTTGCAAGAAATAGTATTCTAATGAGTGGATTTTCGGACAAATTG
AAAAGGCATTGGTTAGGTGAGAATTATCAAGAGGAAGGCGTACATGGCAA
CGAAATACATCTTTCAAATGTACCAAATGTAAGAATAGCTTTTAGACTTG
AAACATTAGTTGGAGAGCTAGTAAATTTGTTAATTTCTATTGTCGGTAAA
GAATCTTCTATTGTCATTAAACGAAAGGAATAGAAAATACAAATTTTGTC
AAGAATATTGCAATATTTTGGATTTGAATTTCATTTAAAATTATGTATGA
AATTTTAATAAAATAGACCAGAAATTCG
back to top

protein sequence of SMED30014264-orf-1

>SMED30014264-orf-1 ID=SMED30014264-orf-1|Name=SMED30014264-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=102bp
IYNYQFRIMSITPNLFKQQHQNTSIDSDSVDSDLQSNSKDVIENSLVSWK
VKVPSEPSIQKGEEAHIKAEAVDYQRVTILGEELLTIRLPVMIMLNLKNG
Q*
back to top

protein sequence of SMED30014264-orf-2

>SMED30014264-orf-2 ID=SMED30014264-orf-2|Name=SMED30014264-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=556bp
MNKGVVQMDLMNEVTESSRKQMKDIIDSIPHVKHSEFIMDFKFIRQLITD
GPIISFSFRRLSFIHSKFQMHVLLNEDLESREQKNVPHRDFYNVRKVDNH
IHAASSMNQKHLLRFIKRSVKKHSNLKVFINKDTNVELGLGELFDSLKIS
CYDLNVDKLNVHADSNTFHRFDKFNLKYNPVGVGDLREVFLKTSNLCDGI
FFAQILQEVFQDLEESKYQYTELRLSIYGKSLDEWDELAKWVKKYGMKST
QNKWIIQIPRIYDVLKSNGFIANFEEMIRNVFFPLFEVTGNPNSHPELHE
FLFDVSSLDSVDDESKPEIGSMYKNIEKPDEWTKNDNPPYDYYIYYLFTN
LMKLNHLRTKRRLPILKLRPHCGEAGSILHLISGYMLADNINHGLLLRKS
PVLQYLFYLCQIGIAMSPLSNNSLFLNYHRNPLPIFLGKGLKVSISTDDP
LQFHFTKEPLMEEYSIAAQVWKLTSTDMCELARNSILMSGFSDKLKRHWL
GENYQEEGVHGNEIHLSNVPNVRIAFRLETLVGELVNLLISIVGKESSIV
IKRKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR012317Poly(ADP-ribose)pol_cat_dom
IPR001365A/AMP_deaminase_dom
IPR006329AMPD
IPR006650A/AMP_deam_AS
IPR032466Metal_Hydrolase
Vocabulary: molecular function
TermDefinition
GO:0003950NAD+ ADP-ribosyltransferase activity
GO:0019239deaminase activity
GO:0003876AMP deaminase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0032264IMP salvage
GO:0009168purine ribonucleoside monophosphate biosynthetic process
GO:0006188IMP biosynthetic process
GO:0009117nucleotide metabolic process
GO:0042632cholesterol homeostasis
GO:0046033AMP metabolic process
GO:0046034ATP metabolic process
GO:0046039GTP metabolic process
GO:0052652cyclic purine nucleotide metabolic process
GO:0072015glomerular visceral epithelial cell development
GO:0097009energy homeostasis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006329AMP deaminaseTIGRFAMTIGR01429TIGR01429coord: 16..537
e-value: 1.3E-246
score: 818.0
IPR006329AMP deaminasePIRSFPIRSF001251AMP_deaminasecoord: 2..550
e-value: 2.9E-252
score: 837.5
IPR006329AMP deaminasePANTHERPTHR11359AMP DEAMINASEcoord: 13..538
NoneNo IPR availableGENE3DG3DSA:3.20.20.140coord: 23..532
e-value: 8.7E-238
score: 792.0
NoneNo IPR availableGENE3DG3DSA:2.30.30.800coord: 107..199
e-value: 8.7E-238
score: 792.0
NoneNo IPR availablePANTHERPTHR11359:SF0AMP DEAMINASEcoord: 13..538
IPR001365Adenosine/AMP deaminase domainPFAMPF00962A_deaminasecoord: 93..502
e-value: 8.4E-103
score: 344.1
IPR006650Adenosine/AMP deaminase active sitePROSITEPS00485A_DEAMINASEcoord: 444..450
IPR032466Metal-dependent hydrolaseSUPERFAMILYSSF51556Metallo-dependent hydrolasescoord: 22..536