mmp protein

Overview
Namemmp protein (CCC86590.3)
Smed IDSMED30014263
Length (bp)1918
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of mmp protein (SMED30014263) t-SNE clustered cells

Violin plots show distribution of expression levels for mmp protein (SMED30014263) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of mmp protein (SMED30014263) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for mmp protein (SMED30014263) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014263

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30014263SMESG000069202.1 dd_Smed_v4_2305_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
whole organismSMED30014263SMESG000069202.1 HE577120.1smed_ncbi_20200123PMID:28893948
Abnave et al., 2017
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymaSMED30014263SMESG000069202.1 HE577120.1smed_ncbi_20200123PMID:23405188
Isolani et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of mmp protein vs. Ensembl Human
Match: MMP25 (matrix metallopeptidase 25 [Source:HGNC Symbol;Acc:HGNC:14246])

HSP 1 Score: 236.498 bits (602), Expect = 3.787e-69
Identity = 166/529 (31.38%), Postives = 245/529 (46.31%), Query Frame = 2
Query:  248 YLNKYGYLQLPR--LDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYP-SKGLNRPQVRAIMTRAFNLWAKHVDINYTE-ETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGR--NLLAVAVHELGHSMGLGHSASETAIMYPFYVNPT--EGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIER-KDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKKYS 1807
            +L +YGYL  P      L SPE  R          AIK  Q+   LP+TG ++      +   RC  PD     +G             +++R +RY +      W K+ LTW+++S+P S  L++  VR +M+ A   W     + + E ++    + DI+I+F    H DS PFDG    LAHAF+P       +  SGD HFDD+E W    +DG   +L AVAVHE GH++GLGHS++  +IM PFY  P       +L  DD +G+Q +YG A       P        P        + + PI    D C+   DAI  IR  E + F G   WR+  S  + S         P  L+ +W  LP  +  +     R +D +I +F   +FW+ +D             PL  LGLP   E++D +F W  N   Y++ G +YW+ +EA+       P YPR + S+W+  P   D       G T+F KG +++ F    +K     P+P+ P W+ C   S
Sbjct:   35 WLTRYGYLPPPHPAQAQLQSPEKLRD---------AIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPDV----LG----------VAGLVRRRRRYALSG--SVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGE-----HPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQPPASPTHSPSFPIP---DRCEGNFDAIANIRG-ETFFFKGPWFWRLQPSGQLVS-------PRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGG-----ARPLTELGLPPG-EEVDAVFSWPQNGKTYLVRGRQYWRYDEAAAR---PDPGYPRDL-SLWEGAPPSPDDVTVSNAGDTYFFKGAHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPS 512          
BLAST of mmp protein vs. Ensembl Human
Match: MMP16 (matrix metallopeptidase 16 [Source:HGNC Symbol;Acc:HGNC:7162])

HSP 1 Score: 215.698 bits (548), Expect = 4.600e-61
Identity = 173/584 (29.62%), Postives = 262/584 (44.86%), Query Frame = 2
Query:  146 ELIHIDHEMINFIFTGLCLICYSINALSPH-RAMLYLNKYGYLQL--PRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHV-----DINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYP---IGSSSPPYSRSGDAHFDDDEFWV--EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKID--------------------FCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYT-GLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
             L  + H  + F+ T L ++C ++     +    ++L KYGYL    PR+  L S E            SA+   Q+ + +  TG ++      +   RCG PD       F++             R KRY +     KW  K +T+ IK+   K +  P+ R  + RAF++W         ++ Y+E      D DI I F S  HGDS PFDG    LAHA++P   IG         GD HFD DE W       DG +L  VAVHELGH++GL HS   TAIM PFY      N KL  DD+ G+Q IYG              P   P+ T+P + ++ P   +K D                     CD   + +  +R  E++VF  +  WR+  ++ +  +        P  + Y+W  LP ++D +    E  D     F+ N++W+ +D T    P Y   L     G+P +   ID+   W+     Y   G +YW+ +E   E   + P YP+ I +VWK +P     A+    +G T+F KGK +++FNN  +K+  G P+ +   ++GC
Sbjct:   11 RLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAE---------TMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHI-------------RRKRYALTG--QKWQHKHITYSIKNVTPK-VGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIG---------GDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPD--------KIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRR-EMFVFKDQWFWRVRNNRVMDGY--------PMQITYFWRGLPPSIDAV---YENSDGNFVFFKGNKYWVFKDTT--LQPGYPHDLITLGSGIPPH--GIDSAIWWEDVGKTYFFKGDRYWRYSE---EMKTMDPGYPKPI-TVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGC 532          
BLAST of mmp protein vs. Ensembl Human
Match: MMP17 (matrix metallopeptidase 17 [Source:HGNC Symbol;Acc:HGNC:7163])

HSP 1 Score: 209.92 bits (533), Expect = 5.798e-59
Identity = 150/522 (28.74%), Postives = 236/522 (45.21%), Query Frame = 2
Query:  248 YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKG-LNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIK--LDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIER-KDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            +L+++GYL  P  D          L      S AI   Q+   L  TG L+     ++   RC  PD                    +L + +R        KW K++L+W+++++P    L    VRA+M  A  +W+    +N+ E  G  + ADI I+F   +H D  PFDGP   +AHAF+P       +  +GD HFDDDE W  +  D  G +L AVAVHE GH++GL H A+  +IM P+Y  P    ++  L  +D   +  +YG     + + P         +   P   + APP       C T  DA+  IR  E + F GK  WR+   + + S         P  ++ +W  LP  LD +D   ER  D KI  F+ +R+W+ +DN      N  +G P  V         ID  F W +N   Y      YW+ ++ +    ++ P YP +   +W+ +P  LD A     G ++F +G+ +++  + E+++  G P+     W+ C
Sbjct:   55 WLSRFGYL--PPADPTTG-----QLQTQEELSKAITAMQQFGGLEATGILDEATLALMKTPRCSLPDL------------------PVLTQARRRRQAPAPTKWNKRNLSWRVRTFPRDSPLGHDTVRALMYYALKVWSDIAPLNFHEVAG--SAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGH-----HHTAGDTHFDDDEAWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPYEDKVRVWQLYG---VRESVSPTAQPEEPPLLPEPPDNRSSAPPRKDVPHRCSTHFDAVAQIRG-EAFFFKGKYFWRLTRDRHLVSLQ-------PAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDN------NVEEGYPRPVSDFSLPPGGIDAAFSWAHNDRTYFFKDQLYWRYDDHT---RHMDPGYP-AQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVC 523          
BLAST of mmp protein vs. Ensembl Human
Match: MMP24 (matrix metallopeptidase 24 [Source:HGNC Symbol;Acc:HGNC:7172])

HSP 1 Score: 206.838 bits (525), Expect = 1.292e-57
Identity = 167/561 (29.77%), Postives = 255/561 (45.45%), Query Frame = 2
Query:  218 NALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYN------DADIIIEFGSKEHGDSIPFDGPNYVLAHAFYP---IGSSSPPYSRSGDAHFDDDEFWV--EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINK---------------------KIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHG-KTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
             A +P     +L  YGYL LP     ++    ++L       SA+   Q+ + +P TG L+    + +   RCG PD+              + ++R  +R KRY +     KW +K +T+ I +Y  K +     R  + +AF++W K   + + EE  Y+       +ADI+I F S  HGDS PFDG    LAHA++P   IG         GD HFD DE W       DG +L  VAVHELGH++GL HS+  +AIM PFY      N KL  DD+ G+Q IYG  +          +    P+ TLP     +P   K                     K + CD   + +   R  E++VF  +  WR+  ++    +        P  +  +W  LP    +ID   ER D +   F+ +++W+ ++ T    P Y     L  LG     E IDT  RW+     Y   G +YW+ +E   E     P YP+ I +VWK +P     A+    G  T+F KG+ +++F+N ++ +  G P+ +   W+GC +
Sbjct:   74 EAEAPFAGQNWLKSYGYL-LPYDSRASALHSAKAL------QSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDH-------------PHLSRR--RRNKRYALTG--QKWRQKHITYSIHNYTPK-VGELDTRKAIRQAFDVWQKVTPLTF-EEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIG---------GDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPA--------EPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPSTPGTKPNICDGNFNTVALFRG-EMFVFKDRWFWRLRNNRVQEGY--------PMQIEQFWKGLPA---RIDAAYERADGRFVFFKGDKYWVFKEVT--VEPGYPHS--LGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSE---ERRATDPGYPKPI-TVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWMGCNQ 571          
BLAST of mmp protein vs. Ensembl Human
Match: MMP17 (matrix metallopeptidase 17 [Source:HGNC Symbol;Acc:HGNC:7163])

HSP 1 Score: 203.371 bits (516), Expect = 2.356e-57
Identity = 139/485 (28.66%), Postives = 219/485 (45.15%), Query Frame = 2
Query:  359 FQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKG-LNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIK--LDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIER-KDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
             Q+   L  TG L+     ++   RC  PD                    +L + +R        KW K++L+W+++++P    L    VRA+M  A  +W+    +N+ E  G  + ADI I+F   +H D  PFDGP   +AHAF+P       +  +GD HFDDDE W  +  D  G +L AVAVHE GH++GL H A+  +IM P+Y  P    ++  L  +D   +  +YG     + + P         +   P   + APP       C T  DA+  IR  E + F GK  WR+   + + S         P  ++ +W  LP  LD +D   ER  D KI  F+ +R+W+ +DN      N  +G P  V         ID  F W +N   Y      YW+ ++ +      YP    +   +W+ +P  LD A     G ++F +G+ +++  + E+++  G P+     W+ C
Sbjct:    1 MQQFGGLEATGILDEATLALMKTPRCSLPDL------------------PVLTQARRRRQAPAPTKWNKRNLSWRVRTFPRDSPLGHDTVRALMYYALKVWSDIAPLNFHEVAG--SAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGH-----HHTAGDTHFDDDEAWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPYEDKVRVWQLYG---VRESVSPTAQPEEPPLLPEPPDNRSSAPPRKDVPHRCSTHFDAVAQIRG-EAFFFKGKYFWRLTRDRHLVSLQ-------PAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDN------NVEEGYPRPVSDFSLPPGGIDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYP----AQSPLWRGVPSTLDDAMRWSDGASYFFRGQEYWKVLDGELEVAPGYPQSTARDWLVC 439          
BLAST of mmp protein vs. Ensembl Celegans
Match: zmp-5 (Zinc MetalloProtease [Source:UniProtKB/TrEMBL;Acc:O17913])

HSP 1 Score: 148.673 bits (374), Expect = 6.586e-39
Identity = 114/430 (26.51%), Postives = 195/430 (45.35%), Query Frame = 2
Query:  518 RVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTE-ETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEV-LGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVW--KDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            RVKRY I+     W K  +T+++K  PS+ ++  Q +A+  RAF  W +H  + +   +      A+I I F + +H D  PFDG   +LAHAF+P           GD HFD+DE W      G +L AVAVHE+GHS+GL HS++  +IM PFY   T   + L  DDI+ ++ +YG A    R            + T P                   +DA+ T++   I  F GK+ + +   KT   W+       P  +N  +P        ++     +   +Y F+K+ +W++  +  + N     G P ++  GL    + I+    +  +   Y      +W+ +         +  +PR+I S++  ++ P  +D A+   +  +F      +++ +   M+I +G P+ L+  W  C
Sbjct:   28 RVKRYSIEGSY--WGKSVITYRLKQ-PSQRMSLSQQKAVFARAFATWEEHTRLWFVAVDDEDEQKANIDIVFAAGDHEDGEPFDGKGNILAHAFFP--------RYGGDVHFDEDELWSANKTKGVDLYAVAVHEIGHSLGLKHSSNHLSIMAPFYKQYTGAVMHLHQDDISAVKRLYG-APVKIRKKASEHHIWRSELCTKP------------------YLDAVTTLKNGTILAFRGKMFFEL---KTTRKWLL------PRKINRIFPF----EGPLEAATTDRHGNVYFFKKDTYWVMTKHGDMMN-----GYPKKISQGLTDTPDGINAALYYHEDGKPYFFKKSYFWQYSRYGK-----HKLWPRAIVSIFENQNSPPEIDAAFQLNNTSSFLFHQNKYWKVSGDPMRIEKGFPRSLSRDWFNC 404          
BLAST of mmp protein vs. Ensembl Celegans
Match: zmp-3 (Matrix metalloproteinase-C [Source:UniProtKB/Swiss-Prot;Acc:G5EBU3])

HSP 1 Score: 136.732 bits (343), Expect = 7.734e-34
Identity = 99/289 (34.26%), Postives = 138/289 (47.75%), Query Frame = 2
Query:  221 ALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGN--YSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQ------GRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTE--GNI---KLDIDDINGMQSIY 1048
            +LS  +A  YL  +GY+  P  + L S       I      + SAI+KFQ+   + +TGFL+      +   RCG  D    P+                         + Q KW K  LT+ I+S+ S  L++  VR  ++ A+ LW+K   + ++E     + +DI I FG + H D  PFDG   VLAHA  P          SG  HFDDDE W  +        +  +LLAVA+HE GH++GL HS  E AIM PFY   T+  GN     L  DDI+ +Q+IY
Sbjct:   51 SLSDEKARSYLQTFGYV--PPSNSLQSRNGMAGDIQSAEQVFKSAIRKFQEFAGIAKTGFLDAATKAKMALSRCGVTD---APLALTSG--------------------SSQFKWSKTRLTYSIESWSSD-LSKDDVRRAISEAYGLWSKVTPLEFSEVPAG-STSDIKIRFGVRNHNDPWPFDGEGGVLAHATMP---------ESGMFHFDDDENWTYKDARKIHNNEATDLLAVAIHEGGHTLGLEHSRDENAIMAPFYQKTTDSSGNYVYPNLKSDDISAIQAIY 303          
BLAST of mmp protein vs. Ensembl Celegans
Match: zmp-2 (Matrix metalloproteinase-B [Source:UniProtKB/Swiss-Prot;Acc:O44836])

HSP 1 Score: 114.39 bits (285), Expect = 1.564e-26
Identity = 94/309 (30.42%), Postives = 139/309 (44.98%), Query Frame = 2
Query:  215 INALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKR--ILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWA--------KHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPN---------YVLAHAFYPIGSSSPPYSR--SGDAHFDDDEFW------VEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSAS 1060
            ++  S H     + KYGYL+   +D+ +  E+ ++L+           FQ+   + QTG ++    +     RC   D         V    + R KR  + KR K  +     +      L W I  Y S  ++R + R ++ +AF LW+        K V + + +E    ++ADI I +    HGD   FDG N          VLAH F+P       Y+R  +GD HFDD E W      V  G + R    V  HE+GH++GL HS    A+M+P+Y N     I+LDIDD  G+   YG AS
Sbjct:   50 VDEDSIHFVKGQMEKYGYLK--GIDHSSPQEFRQALMF----------FQEVLEVEQTGNVDEMTVEAASKPRCTQTD---------VRQEQTKRTKRFTLSKRAKWAHASGQSVT-----LKWYISDYTSD-IDRLETRKVVEKAFKLWSSQSYIKNEKKVTLTF-QEASSKDEADINILWAEGNHGDEHDFDGANGKIEGNKKENVLAHTFFP------GYARPLNGDIHFDDAEDWEIDVDQVGHGSNKRFFPYVLAHEIGHALGLDHSQKADALMHPYYKNVPINEIQLDIDDKCGVIWNYGGAS 324          
BLAST of mmp protein vs. Ensembl Celegans
Match: zmp-6 (MMP-like protein; Zinc MetalloProtease [Source:UniProtKB/TrEMBL;Acc:G5ECC4])

HSP 1 Score: 101.293 bits (251), Expect = 1.356e-23
Identity = 71/202 (35.15%), Postives = 96/202 (47.52%), Query Frame = 2
Query:  461 PIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQV---RAIMTRAFNLWAKHVDINYTE---ETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIY 1048
            PIGF       +R KR + R KR         W K  LTW++++   + L  P V   R  M RAFN W+    +++ E   +       DI I F   EH D  PFDG + V+AHAFYP         R G  HFD +E W     +G NL   AVHE+GH +GL HS    A M+     P +    L  DD+  ++S++
Sbjct:   32 PIGF------GSREKRYVIRAKR---------WKKHTLTWQLQT---QNLLDPDVFIVRNTMHRAFNEWSTVSSVDFREIPPDLVTKQPPDIYIAFEKGEHSDGFPFDGQDGVVAHAFYP---------RDGRLHFDAEEQWSLNSVEGVNLFQTAVHEIGHLLGLEHSMDVRAAMFA-AKRPYDPAFTLGDDDVRAIRSLF 205          
BLAST of mmp protein vs. Ensembl Celegans
Match: zmp-2 (Matrix metalloproteinase-B [Source:UniProtKB/Swiss-Prot;Acc:O44836])

HSP 1 Score: 103.99 bits (258), Expect = 2.320e-23
Identity = 82/252 (32.54%), Postives = 119/252 (47.22%), Query Frame = 2
Query:  410 AKMLVAKRCGNPD-----YGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKD-----LTWKIKSYPSKGLNRPQVRAIMTRAFNLWA--------KHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPN---------YVLAHAFYPIGSSSPPYSR--SGDAHFDDDEFW------VEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSAS 1060
            +++L  ++ GN D       S P     ++R     +   KR KR+ + + + KW         L W I  Y S  ++R + R ++ +AF LW+        K V + + +E    ++ADI I +    HGD   FDG N          VLAH F+P       Y+R  +GD HFDD E W      V  G + R    V  HE+GH++GL HS    A+M+P+Y N     I+LDIDD  G+   YG AS
Sbjct:   55 SEVLEVEQTGNVDEMTVEAASKPRCTQTDVR-----QEQTKRTKRFTL-SKRAKWAHASGQSVTLKWYISDYTSD-IDRLETRKVVEKAFKLWSSQSYIKNEKKVTLTF-QEASSKDEADINILWAEGNHGDEHDFDGANGKIEGNKKENVLAHTFFP------GYARPLNGDIHFDDAEDWEIDVDQVGHGSNKRFFPYVLAHEIGHALGLDHSQKADALMHPYYKNVPINEIQLDIDDKCGVIWNYGGAS 292          
BLAST of mmp protein vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0306656)

HSP 1 Score: 210.305 bits (534), Expect = 3.353e-60
Identity = 169/551 (30.67%), Postives = 246/551 (44.65%), Query Frame = 2
Query:  179 FIFTGLCLICYSINALSP----HRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFC-DTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDG-PEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGL-PLEVL-GLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGG---PKPLTPAWIGCK 1798
            FI  G      +    +P     +A +YL+++GYL     +  +S  +++       + SAI++FQ    L  TG L+ +  K++   RCG  D                R      R KRY +     +W  K+LT+KI  YP K L R  V A + RAF +W++  D+ +T +T       I I+F   EHGD   FDG    LAHAF+P+          GDAHFDD E W      G NL  VA HE GHS+GL HS   +A+M PFY    E   KLD DD   +QS+YG  + N+  P           Y+ PK      P++  I  C D+ VD +    + E Y F G   +++          +  + +G P+ ++  WP LP     ID     K+ K Y F+  ++W  +           DG+ P E+  G     + +D    W  N  IY   G K+W+ + A      V   YP+ I S W+ +P  LD A    +G T+F KG  +Y F++    +       P+P    W GCK
Sbjct:    9 FIVVGTLFSIMAAAQSAPVSTTTQAEIYLSQFGYLPASARNPASSGLHDQR-----TWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCGVRD----------------RVGTGDSRSKRYALQG--SRWRVKNLTYKISKYP-KRLKRVDVDAEIGRAFAVWSEDTDLTFTRKTS--GPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPV--------FGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRG-FEPVFKLDEDDKAAIQSLYGRKT-NQLRPTNVYPATTQRPYSPPKV-----PLDDSI--CKDSKVDTLFNSAQGETYAFKGDKYYKL---------TTDSVEEGYPQLISKGWPGLP---GNIDAAFTYKNGKTYFFKGTQYWRYQGRQ-------MDGVYPKEISEGFTGIPDHLDAAMVWGGNGKIYFFKGSKFWRFDPAKRP--PVKASYPKPI-SNWEGVPNNLDAALKYTNGYTYFFKGDKYYRFHDARFAVDSATPPFPRPTAHWWFGCK 494          
BLAST of mmp protein vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0304010)

HSP 1 Score: 210.305 bits (534), Expect = 3.353e-60
Identity = 169/551 (30.67%), Postives = 246/551 (44.65%), Query Frame = 2
Query:  179 FIFTGLCLICYSINALSP----HRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFC-DTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDG-PEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGL-PLEVL-GLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGG---PKPLTPAWIGCK 1798
            FI  G      +    +P     +A +YL+++GYL     +  +S  +++       + SAI++FQ    L  TG L+ +  K++   RCG  D                R      R KRY +     +W  K+LT+KI  YP K L R  V A + RAF +W++  D+ +T +T       I I+F   EHGD   FDG    LAHAF+P+          GDAHFDD E W      G NL  VA HE GHS+GL HS   +A+M PFY    E   KLD DD   +QS+YG  + N+  P           Y+ PK      P++  I  C D+ VD +    + E Y F G   +++          +  + +G P+ ++  WP LP     ID     K+ K Y F+  ++W  +           DG+ P E+  G     + +D    W  N  IY   G K+W+ + A      V   YP+ I S W+ +P  LD A    +G T+F KG  +Y F++    +       P+P    W GCK
Sbjct:    9 FIVVGTLFSIMAAAQSAPVSTTTQAEIYLSQFGYLPASARNPASSGLHDQR-----TWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCGVRD----------------RVGTGDSRSKRYALQG--SRWRVKNLTYKISKYP-KRLKRVDVDAEIGRAFAVWSEDTDLTFTRKTS--GPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPV--------FGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRG-FEPVFKLDEDDKAAIQSLYGRKT-NQLRPTNVYPATTQRPYSPPKV-----PLDDSI--CKDSKVDTLFNSAQGETYAFKGDKYYKL---------TTDSVEEGYPQLISKGWPGLP---GNIDAAFTYKNGKTYFFKGTQYWRYQGRQ-------MDGVYPKEISEGFTGIPDHLDAAMVWGGNGKIYFFKGSKFWRFDPAKRP--PVKASYPKPI-SNWEGVPNNLDAALKYTNGYTYFFKGDKYYRFHDARFAVDSATPPFPRPTAHWWFGCK 494          
BLAST of mmp protein vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0304009)

HSP 1 Score: 209.92 bits (533), Expect = 5.682e-60
Identity = 168/551 (30.49%), Postives = 246/551 (44.65%), Query Frame = 2
Query:  179 FIFTGLCLICYSINALSP----HRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFC-DTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDG-PEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGL-PLEVL-GLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGG---PKPLTPAWIGCK 1798
            FI  G      +    +P     +A +YL+++GYL     +  +S  +++       + SAI++FQ    L  TG L+ +  K++   RCG                  +R      R KRY +     +W  K+LT+KI  YP K L R  V A + RAF +W++  D+ +T +T       I I+F   EHGD   FDG    LAHAF+P+          GDAHFDD E W      G NL  VA HE GHS+GL HS   +A+M PFY    E   KLD DD   +QS+YG  + N+  P           Y+ PK      P++  I  C D+ VD +    + E Y F G   +++          +  + +G P+ ++  WP LP     ID     K+ K Y F+  ++W  +           DG+ P E+  G     + +D    W  N  IY   G K+W+ + A      V   YP+ I S W+ +P  LD A    +G T+F KG  +Y F++    +       P+P    W GCK
Sbjct:    9 FIVVGTLFSIMAAAQSAPVSTTTQAEIYLSQFGYLPASARNPASSGLHDQR-----TWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCG----------------VRDRVGTGDSRSKRYALQG--SRWRVKNLTYKISKYP-KRLKRVDVDAEIGRAFAVWSEDTDLTFTRKTS--GPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPV--------FGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRG-FEPVFKLDEDDKAAIQSLYGRKT-NQLRPTNVYPATTQRPYSPPKV-----PLDDSI--CKDSKVDTLFNSAQGETYAFKGDKYYKL---------TTDSVEEGYPQLISKGWPGLP---GNIDAAFTYKNGKTYFFKGTQYWRYQGRQ-------MDGVYPKEISEGFTGIPDHLDAAMVWGGNGKIYFFKGSKFWRFDPAKRP--PVKASYPKPI-SNWEGVPNNLDAALKYTNGYTYFFKGDKYYRFHDARFAVDSATPPFPRPTAHWWFGCK 494          
BLAST of mmp protein vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0304011)

HSP 1 Score: 209.92 bits (533), Expect = 5.682e-60
Identity = 168/551 (30.49%), Postives = 246/551 (44.65%), Query Frame = 2
Query:  179 FIFTGLCLICYSINALSP----HRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFC-DTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDG-PEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGL-PLEVL-GLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGG---PKPLTPAWIGCK 1798
            FI  G      +    +P     +A +YL+++GYL     +  +S  +++       + SAI++FQ    L  TG L+ +  K++   RCG                  +R      R KRY +     +W  K+LT+KI  YP K L R  V A + RAF +W++  D+ +T +T       I I+F   EHGD   FDG    LAHAF+P+          GDAHFDD E W      G NL  VA HE GHS+GL HS   +A+M PFY    E   KLD DD   +QS+YG  + N+  P           Y+ PK      P++  I  C D+ VD +    + E Y F G   +++          +  + +G P+ ++  WP LP     ID     K+ K Y F+  ++W  +           DG+ P E+  G     + +D    W  N  IY   G K+W+ + A      V   YP+ I S W+ +P  LD A    +G T+F KG  +Y F++    +       P+P    W GCK
Sbjct:    9 FIVVGTLFSIMAAAQSAPVSTTTQAEIYLSQFGYLPASARNPASSGLHDQR-----TWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCG----------------VRDRVGTGDSRSKRYALQG--SRWRVKNLTYKISKYP-KRLKRVDVDAEIGRAFAVWSEDTDLTFTRKTS--GPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPV--------FGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRG-FEPVFKLDEDDKAAIQSLYGRKT-NQLRPTNVYPATTQRPYSPPKV-----PLDDSI--CKDSKVDTLFNSAQGETYAFKGDKYYKL---------TTDSVEEGYPQLISKGWPGLP---GNIDAAFTYKNGKTYFFKGTQYWRYQGRQ-------MDGVYPKEISEGFTGIPDHLDAAMVWGGNGKIYFFKGSKFWRFDPAKRP--PVKASYPKPI-SNWEGVPNNLDAALKYTNGYTYFFKGDKYYRFHDARFAVDSATPPFPRPTAHWWFGCK 494          
BLAST of mmp protein vs. Ensembl Fly
Match: Mmp1 (gene:FBgn0035049 transcript:FBtr0304006)

HSP 1 Score: 210.305 bits (534), Expect = 6.015e-60
Identity = 168/551 (30.49%), Postives = 246/551 (44.65%), Query Frame = 2
Query:  179 FIFTGLCLICYSINALSP----HRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFC-DTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDG-PEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGL-PLEVL-GLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGG---PKPLTPAWIGCK 1798
            FI  G      +    +P     +A +YL+++GYL     +  +S  +++       + SAI++FQ    L  TG L+ +  K++   RCG                  +R      R KRY +     +W  K+LT+KI  YP K L R  V A + RAF +W++  D+ +T +T       I I+F   EHGD   FDG    LAHAF+P+          GDAHFDD E W      G NL  VA HE GHS+GL HS   +A+M PFY    E   KLD DD   +QS+YG  + N+  P           Y+ PK      P++  I  C D+ VD +    + E Y F G   +++          +  + +G P+ ++  WP LP     ID     K+ K Y F+  ++W  +           DG+ P E+  G     + +D    W  N  IY   G K+W+ + A      V   YP+ I S W+ +P  LD A    +G T+F KG  +Y F++    +       P+P    W GCK
Sbjct:    9 FIVVGTLFSIMAAAQSAPVSTTTQAEIYLSQFGYLPASARNPASSGLHDQR-----TWVSAIEEFQSFAGLNITGELDAETMKLMSLPRCG----------------VRDRVGTGDSRSKRYALQG--SRWRVKNLTYKISKYP-KRLKRVDVDAEIGRAFAVWSEDTDLTFTRKTS--GPVHIEIKFVESEHGDGDAFDGQGGTLAHAFFPV--------FGGDAHFDDAELWTIGSPRGTNLFQVAAHEFGHSLGLSHSDQSSALMAPFYRG-FEPVFKLDEDDKAAIQSLYGRKT-NQLRPTNVYPATTQRPYSPPKV-----PLDDSI--CKDSKVDTLFNSAQGETYAFKGDKYYKL---------TTDSVEEGYPQLISKGWPGLPGN---IDAAFTYKNGKTYFFKGTQYWRYQGRQ-------MDGVYPKEISEGFTGIPDHLDAAMVWGGNGKIYFFKGSKFWRFDPAKRP--PVKASYPKPI-SNWEGVPNNLDAALKYTNGYTYFFKGDKYYRFHDARFAVDSATPPFPRPTAHWWFGCK 494          
BLAST of mmp protein vs. Ensembl Zebrafish
Match: mmp17a (matrix metallopeptidase 17a [Source:ZFIN;Acc:ZDB-GENE-070820-2])

HSP 1 Score: 246.128 bits (627), Expect = 4.827e-73
Identity = 166/530 (31.32%), Postives = 257/530 (48.49%), Query Frame = 2
Query:  248 YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYP--SKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDI--DDINGMQSIYG---SASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERK-DQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEV--LGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
            +L+K+GYL  P  D +N       L      + AIK  Q+   L +TG L+     ++   RC  PD     +       ++ R KR L          PQ KW K+ L+W+++++P  S  L R  VRA+M  A  +W+    +N+ E  G  N+ADI I+F   +H D  PFDGP   +AHAF+P    +     +GD HFDDDE W  +  D  G +L AVAVHE GH++GL H+++  +IM P+Y  P    +K ++  +D   +  +YG   S S+  +            +  LP+  +  PP     D C +  DA+  IR  E + F GK  WR+   K + S     LR  P  ++ +W  LP  LD +D   ER  D KI  F+  ++W+ +DN      N  +G P  V   GLP  +E +D +F W +N+  Y     +YW+ ++        YP+      ++WK +P  LD A       ++F KGK ++     +M++  G P+P+   W+ C +
Sbjct:    2 WLSKFGYL--PPSDPVNG-----QLQTKEALTKAIKAMQRFGGLEETGVLDQATLGLMKTPRCSLPDMSEPDL-------SAGRRKRALA---------PQNKWNKRHLSWRVRTFPKESTSLGRDTVRALMYYALKVWSDIAPLNFHEVAG--NEADIQIDFTKADHNDGYPFDGPGGTVAHAFFPGERFT-----AGDTHFDDDEAWTFRAPDSHGMDLFAVAVHEFGHAIGLAHTSAIESIMRPYYQGPVGDPLKYNLAYEDKVRVWQLYGVRDSVSHTLKPDDPSQTAEPPVLLDLPENRSTIPPARDAPDRCTSHFDAVAQIRG-EAFFFKGKYFWRLTREKHLVS-----LR--PAQIHRFWRGLPANLDSVDAVYERPGDHKIVFFKGGKYWVFKDN------NVEEGYPRSVSDFGLP--VEGVDAVFVWQHNEKTYFFKDNRYWRYDDHLRRMDLGYPK----DMALWKGIPAQLDDAMRWSDSASYFFKGKEYWRVAGSDMEVEVGYPRPIGKDWLVCTE 481          
BLAST of mmp protein vs. Ensembl Zebrafish
Match: mmp16b (matrix metallopeptidase 16b (membrane-inserted) [Source:ZFIN;Acc:ZDB-GENE-061009-22])

HSP 1 Score: 213.001 bits (541), Expect = 2.038e-60
Identity = 175/562 (31.14%), Postives = 252/562 (44.84%), Query Frame = 2
Query:  194 LCL---ICYSINALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWA-----KHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYP---IGSSSPPYSRSGDAHFDDDEFWV--EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKR--------------LXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLP-LPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            LCL   IC+S          ++L KYGYL         +P    +        SAI   Q  + L  TG LN      +   RCG PD                +A    +R KRY +     KW ++ +++ IK+   K  N+    AI  RAF++W      +   + + +      D DI I F S  HGDS PFDG    LAHA++P   IG         GD HFD DE W       DG +L  VAVHELGH++GL HS+  TAIM PFY      + KL  DD+ G+Q IYG  + N +              LP  P        +  P+    + P N K D CD   + +  +R  E++VF  +  WR+  +  V  +        P  ++Y+W  LP    KID   E  + K   F+ NRFW+ +D T    P Y   + L   G+P   + I+T   W+     Y   G +YW+ NE   +   + P YP+ I +VWK +P  P        +G T+F KGK +++FNN  +++  G P+ +   ++GC
Sbjct:   20 LCLALLICFSC---------VWLQKYGYLH-------PTPPNMAAQRSAQTMHSAIAAMQHKYGLNITGTLNKYTIDWMKKPRCGVPD--------------QLKAGSASRRKKRYALTG--QKWQREHISYSIKNVTPKVGNQETHDAI-RRAFDVWQGVTPLRFEAVPFRDLDSGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIG---------GDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSSDPTAIMAPFYQYMDTESFKLPHDDLQGIQKIYGPPNKNPQPTRLLTTATPPRLHLPSDPRKHERSRPHRPPQKNKPSHP-NSKPDICDGGFNTLAILRN-ELFVFKDQWFWRVRDNSVVPGY--------PMQISYFWRGLPP---KIDAVYENSEGKFVFFKGNRFWVFKDTT--LQPTYPQDISLFGSGMPT--QSIETAVWWEDVAKTYFFKGDRYWRYNE---DMRTMDPGYPQPI-TVWKGIPDSPQGAFVDKANGFTYFYKGKEYWKFNNQRLRVEPGYPRSILRDFMGC 518          
BLAST of mmp protein vs. Ensembl Zebrafish
Match: mmp17a (matrix metallopeptidase 17a [Source:ZFIN;Acc:ZDB-GENE-070820-2])

HSP 1 Score: 212.231 bits (539), Expect = 2.451e-60
Identity = 167/560 (29.82%), Postives = 257/560 (45.89%), Query Frame = 2
Query:  167 EMINF---IFTGLCLICYSINALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYP--SKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDI--DDINGMQSIYG---SASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERK-DQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEV--LGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
            EMI F    F        SI A      + +L+K+GYL  P  D +N       L      + AIK  Q+   L +TG L+     ++   RC  PD     +       ++ R KR L          PQ KW K+ L+W+++++P  S  L R  VRA+M  A  +W+    +N+ E  G  N+ADI I+F   +H D  PFDGP   +AHAF+P    +     +GD HFDDDE W  +  D  G +L AVAVHE GH++GL H+++  +IM P+Y  P    +K ++  +D   +  +YG   S S+  +                    T  PP+   +D  +       TI    I+  +    WR    K + S     LR  P  ++ +W  LP  LD +D   ER  D KI  F+  ++W+ +DN      N  +G P  V   GLP  +E +D +F W +N+  Y     +YW+ ++        YP+      ++WK +P  LD A       ++F KGK ++     +M++  G P+P+   W+ C +
Sbjct:   19 EMILFPVLWFLSQTRAAPSITAEQMDMGVDWLSKFGYL--PPSDPVNG-----QLQTKEALTKAIKAMQRFGGLEETGVLDQATLGLMKTPRCSLPDMSEPDL-------SAGRRKRALA---------PQNKWNKRHLSWRVRTFPKESTSLGRDTVRALMYYALKVWSDIAPLNFHEVAG--NEADIQIDFTKADHNDGYPFDGPGGTVAHAFFPGERFT-----AGDTHFDDDEAWTFRAPDSHGMDLFAVAVHEFGHAIGLAHTSAIESIMRPYYQGPVGDPLKYNLAYEDKVRVWQLYGVRDSVSHTLKPDDPS--------------QTAEPPV--LLDLPENRS----TIPTPSIFQITPSF-WR---RKHLVS-----LR--PAQIHRFWRGLPANLDSVDAVYERPGDHKIVFFKGGKYWVFKDN------NVEEGYPRSVSDFGLP--VEGVDAVFVWQHNEKTYFFKDNRYWRYDDHLRRMDLGYPK----DMALWKGIPAQLDDAMRWSDSASYFFKGKEYWRVAGSDMEVEVGYPRPIGKDWLVCTE 505          
BLAST of mmp protein vs. Ensembl Zebrafish
Match: mmp24 (matrix metallopeptidase 24 [Source:ZFIN;Acc:ZDB-GENE-040724-262])

HSP 1 Score: 209.534 bits (532), Expect = 5.495e-59
Identity = 167/548 (30.47%), Postives = 251/548 (45.80%), Query Frame = 2
Query:  248 YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHV-----DINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYP---IGSSSPPYSRSGDAHFDDDEFWV--EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYG-------------------SASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHG-KTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
            +L  YGYL LP     +    E+++       SA+   Q+ + +P TG L+    + +   RCG PD+             S R     +R KRY +     KW  K +T+ I ++  K   +   RAI  +AF++W         ++ Y+E      +ADI+I F S  HGDS PFDG    LAHA++P   IG         GD HFD DE W       DG +L  VAVHELGH++GL HS+  +AIM PFY      N KL +DD+ G+Q IYG                     S ++R       P        P     + P + K + CD   + +   R  E++VF  +  WR+  +K    +        P  ++++W  LP    +ID   ER D K   F+ +++W+ ++ T  + P Y   L      LP++   IDT  RW+     Y   G +YW+ NE   E     P YP+ I  +WK +P     A+    G  T+F KGK +++F+N ++ +  G PK +   W+GC +
Sbjct:   44 WLKNYGYL-LPHDIRTSDLRSEKAM------QSAVAAMQRFYGIPVTGILDQTTIEWMRKPRCGVPDH----------PHISRR-----RRNKRYALTG--QKWRDKKITYSIHNFTPKVGEKDTQRAIR-QAFDVWQTVTPLSFQEVAYSEIKNEGKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIG---------GDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPLDDLQGIQKIYGIPTAMLEPTRPLPTFPARRPHSTSERKHERQSRPGRPSAGDRP-----SSPGHGKPNICDGNFNTVAFFRR-EMFVFKDRWFWRLRNNKVQEGY--------PMLIDHFWKGLPH---RIDAAYERSDGKFVFFKGDKYWIFKEVT--AEPGYPHSLVELGSYLPSD--GIDTALRWESVGKTYFFKGDQYWRYNE---EKRTTDPGYPKPI-GIWKGIPDAPQGAFVSREGFYTYFYKGKDYWKFDNQKLTVEPGYPKSILKDWMGCDQ 532          
BLAST of mmp protein vs. Ensembl Zebrafish
Match: mmp25a (matrix metallopeptidase 25a [Source:ZFIN;Acc:ZDB-GENE-070820-22])

HSP 1 Score: 207.994 bits (528), Expect = 1.104e-58
Identity = 163/556 (29.32%), Postives = 256/556 (46.04%), Query Frame = 2
Query:  194 LCLICYSINALSPH---RAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAK-RILKRVKRYYIDNPQMKWLKKDLTWKIKSYP----SKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYN-DADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWV-EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTE--GNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTL-----PKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPAN--LEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKKY 1804
            LC++C +  AL P    R + +L +YGYLQ P  D L        L    +   A++K Q+   + +TG L+ K  +M+   RC  PD     I F   ++ + R K +++ + KRY +  P+M+W K D+TW ++ +P    S  LN   VR I+  A  +W+++  + +       +   DI + F S  H D  PFDG    LAHAF+P          +GD HFD +E W         +L  VAVH+ GH++GL HS+S  +IM P+Y  P     +  L   D  G+Q++YG     K  P V         ++      P Y    PP     D C    DA+  IR  EI+ F G+  WR+D S ++       L   P  ++ +W  LP    ++D   ER+D  I  F  N++W+  +   L  P Y   L    L   A    E ++ +F W +N   Y+ +   YW+ +EA GE   +   YP+   ++W  +P   D     L G+T+F K   ++      + +    PK +   W+ C ++
Sbjct:   18 LCVVC-ARPALMPDQYARGVDWLIRYGYLQSP--DTLIG-----GLQTKESIEEAVRKMQRFAGIEETGNLDQKTLEMMGRPRCSLPDT----ISFEELLKRNRRGKNKVMMKKKRYTL--PKMRWDKTDITWSMQDFPPPSVSPALNPGLVRLILGNALRVWSENTPLRFHYSPDEPSPQTDITVTFTSGYHEDGYPFDGKGGALAHAFFPGKGD-----LAGDTHFDAEESWSYGDWSSDSDLFTVAVHDFGHALGLFHSSSSDSIMKPYYFGPVGEMNSYSLTAVDRLGIQALYGKQHNLKPPPSVAAPTTYPTQFSTTYLLHPPYY---PP--DSADRCQGGYDAVANIR-AEIFFFRGQHFWRVDHSGSL-------LSSTPALIHSFWIGLPPDTARVDAAYERRDGHIVFFIGNQYWVFRNTMAL--PGYPRRLSDWGLHTAAGQLAESVEAVFVWPHNGKTYVFSSGLYWRFDEAGGE-RKMEEGYPKPA-AIWG-MPSHPDDIIAFLDGETYFFKDSNYWILQRGGLDLESASPKSIATDWMKCDRH 536          
BLAST of mmp protein vs. Ensembl Xenopus
Match: mmp17 (matrix metallopeptidase 17 [Source:NCBI gene;Acc:100125088])

HSP 1 Score: 226.483 bits (576), Expect = 2.863e-65
Identity = 161/552 (29.17%), Postives = 248/552 (44.93%), Query Frame = 2
Query:  179 FIFTGLCLICYSINALSP-----HRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKG-LNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDI--DDINGMQSIYGSASYNKRLXXXXXXXXXXXXY--TLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIER-KDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            F+   L  +  S+ A +P     +R + +L K+GYL  P             L      S AIK  Q+   L  TG L+    +++   RC  PD         ++   ++R KR  +         P  KW K++L+W+++++P +  L    VRA+M  A  +W+    +N+ E  G  N+ADI I+F   +H D  PFDGP   +AHAF+P       +  SGD HFDD+E W  +  D  G +L AVAVHE GH++GL H +   +IM P+Y  P    +K D+  DD   +  +YG                    +   LP+  +   P   + D C T  DA+  IR  E + F GK  WR+  +K + S         P  ++ +W  LP  +D +D   E+  D KI  F+ +R+W+ +DN      N  +G P  +      L  ID  F W +N   Y      +W  +         YP        +WK +P  LD A     G T+F +GK +++  N  M+  +G P+ +   W+ C
Sbjct:   16 FLIGLLIALRESMAAPTPTAEDINRGVDWLTKFGYLPPPD-------PVTGQLQTQEELSKAIKAMQEFGGLKATGILDEPTLELMKTPRCSLPD---------LSHSQASRKKRSAQ---------PVTKWSKRNLSWRVRNFPKESSLGHDTVRALMYYALKVWSDITPLNFHEVAG--NNADIQIDFSRADHNDGYPFDGPGGTVAHAFFP-----GEHLTSGDTHFDDEESWTFRSSDIHGMDLFAVAVHEFGHAIGLTHISDMESIMRPYYQGPVGDPLKYDLPYDDKVRIWQLYGVRESVSPTAKPDVSKTEDHPFLPDLPENRSTIQPRKDEPDRCSTHFDAVAQIRG-EAFFFKGKYFWRLTRTKHLVSL-------QPAQIHRFWRGLPLNMDSVDAVFEKTTDHKIVFFKGDRYWVFKDN------NVEEGYPRPITDFGLPLGGIDAAFSWSHNDKTYFFKDNLFWSYDNKEHRMDEGYPLETM----LWKGIPATLDDAMGWSDGATYFFRGKEYWKTVNSNMEAEQGYPQSIAKDWLVC 517          
BLAST of mmp protein vs. Ensembl Xenopus
Match: mmp17 (matrix metallopeptidase 17 [Source:NCBI gene;Acc:100125088])

HSP 1 Score: 224.172 bits (570), Expect = 1.063e-64
Identity = 155/524 (29.58%), Postives = 236/524 (45.04%), Query Frame = 2
Query:  248 YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKG-LNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDI--DDINGMQSIYGSASYNKRLXXXXXXXXXXXXY--TLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIER-KDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            +L K+GYL  P             L      S AIK  Q+   L  TG L+    +++   RC  PD         ++   ++R KR  +         P  KW K++L+W+++++P +  L    VRA+M  A  +W+    +N+ E  G  N+ADI I+F   +H D  PFDGP   +AHAF+P       +  SGD HFDD+E W  +  D  G +L AVAVHE GH++GL H +   +IM P+Y  P    +K D+  DD   +  +YG                    +   LP+  +   P   + D C T  DA+  IR  E + F GK  WR+  +K + S         P  ++ +W  LP  +D +D   E+  D KI  F+ +R+W+ +DN      N  +G P  +      L  ID  F W +N   Y      +W  +         YP        +WK +P  LD A     G T+F +GK +++  N  M+  +G P+ +   W+ C
Sbjct:   13 WLTKFGYLPPPD-------PVTGQLQTQEELSKAIKAMQEFGGLKATGILDEPTLELMKTPRCSLPD---------LSHSQASRKKRSAQ---------PVTKWSKRNLSWRVRNFPKESSLGHDTVRALMYYALKVWSDITPLNFHEVAG--NNADIQIDFSRADHNDGYPFDGPGGTVAHAFFP-----GEHLTSGDTHFDDEESWTFRSSDIHGMDLFAVAVHEFGHAIGLTHISDMESIMRPYYQGPVGDPLKYDLPYDDKVRIWQLYGVRESVSPTAKPDVSKTEDHPFLPDLPENRSTIQPRKDEPDRCSTHFDAVAQIRG-EAFFFKGKYFWRLTRTKHLVSL-------QPAQIHRFWRGLPLNMDSVDAVFEKTTDHKIVFFKGDRYWVFKDN------NVEEGYPRPITDFGLPLGGIDAAFSWSHNDKTYFFKDNLFWSYDNKEHRMDEGYPLETM----LWKGIPATLDDAMGWSDGATYFFRGKEYWKTVNSNMEAEQGYPQSIAKDWLVC 486          
BLAST of mmp protein vs. Ensembl Xenopus
Match: mmp14 (matrix metallopeptidase 14 [Source:NCBI gene;Acc:594950])

HSP 1 Score: 219.164 bits (557), Expect = 1.717e-62
Identity = 178/553 (32.19%), Postives = 255/553 (46.11%), Query Frame = 2
Query:  194 LCLICYSINA-LSPHRAMLYLNKYGYLQLP--RLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTE------ETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYP---IGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAP----PINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGK-TFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            LC +C S +A  SP     +L +YGYL     R   L SP+         + ++AI   QK + L  TG  +++  + +   RCG PD     I  NV             R KRY I    +KW  KD+T+ I++Y  K        AI  RAF +W     + + E      + GY   ADI++ F    HGDS PFDG    LAHA++P   IG         GD HFD  E W  +  D  G +L  VAVHELGH++GL HS   +AIM PFY      N +L  DD  G+Q +YG  ++ + LP     P   P  T  +     P    P     D C    D I  +R  E++VF  +  WR+   + +  +        P  +  +W  LP +   I+   ERKD K   F+ ++ W+ ++   +  P Y   L     GLP++  +ID    W  N   Y   G KY++ NE   E   V P YP+ ++ VW+ +P  +  A+ G  G  T+F KG  +++FNN  +K   G PK +   W+GC
Sbjct:   26 LCSVCSSSSAKFSPE---AWLQQYGYLPPGDLRTHTLRSPQ---------SMNAAISAMQKFYGLKVTGSFDSETERAMKRPRCGVPDKFGAEIKANV-------------RRKRYAIQG--LKWQHKDITFCIQNYTPKIGEYSTYEAI-RRAFKVWESVTPLRFREVRYVDIKDGYTKHADIMLFFAEGFHGDSTPFDGEGGFLAHAYFPGPGIG---------GDTHFDSAEPWTARNDDLDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTQNFQLPDDDRRGIQQLYG-PNHGEGLPTRAPRPTRAPRPTQTQRPDDTPHDPNPPTYGPDICQGNFDTIAMLRG-EMFVFKERWFWRVRHKRVMDGY--------PMPIGQFWRGLPSS---INSAYERKDGKFVFFKGDKHWVFDE--AILEPGYPKTLKELGRGLPSD--RIDAALYWMPNGKTYFFRGTKYYRFNE---EMRAVDPDYPKPVN-VWEGIPDSIKGAFMGSDGAFTYFYKGNKYWKFNNQLLKTESGYPKSVLVDWMGC 520          
BLAST of mmp protein vs. Ensembl Xenopus
Match: mmp14 (matrix metallopeptidase 14 [Source:NCBI gene;Acc:594950])

HSP 1 Score: 219.164 bits (557), Expect = 2.583e-62
Identity = 178/553 (32.19%), Postives = 255/553 (46.11%), Query Frame = 2
Query:  194 LCLICYSINA-LSPHRAMLYLNKYGYLQLP--RLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTE------ETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYP---IGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAP----PINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGK-TFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            LC +C S +A  SP     +L +YGYL     R   L SP+         + ++AI   QK + L  TG  +++  + +   RCG PD     I  NV             R KRY I    +KW  KD+T+ I++Y  K        AI  RAF +W     + + E      + GY   ADI++ F    HGDS PFDG    LAHA++P   IG         GD HFD  E W  +  D  G +L  VAVHELGH++GL HS   +AIM PFY      N +L  DD  G+Q +YG  ++ + LP     P   P  T  +     P    P     D C    D I  +R  E++VF  +  WR+   + +  +        P  +  +W  LP +   I+   ERKD K   F+ ++ W+ ++   +  P Y   L     GLP++  +ID    W  N   Y   G KY++ NE   E   V P YP+ ++ VW+ +P  +  A+ G  G  T+F KG  +++FNN  +K   G PK +   W+GC
Sbjct:   57 LCSVCSSSSAKFSPE---AWLQQYGYLPPGDLRTHTLRSPQ---------SMNAAISAMQKFYGLKVTGSFDSETERAMKRPRCGVPDKFGAEIKANV-------------RRKRYAIQG--LKWQHKDITFCIQNYTPKIGEYSTYEAI-RRAFKVWESVTPLRFREVRYVDIKDGYTKHADIMLFFAEGFHGDSTPFDGEGGFLAHAYFPGPGIG---------GDTHFDSAEPWTARNDDLDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTQNFQLPDDDRRGIQQLYG-PNHGEGLPTRAPRPTRAPRPTQTQRPDDTPHDPNPPTYGPDICQGNFDTIAMLRG-EMFVFKERWFWRVRHKRVMDGY--------PMPIGQFWRGLPSS---INSAYERKDGKFVFFKGDKHWVFDE--AILEPGYPKTLKELGRGLPSD--RIDAALYWMPNGKTYFFRGTKYYRFNE---EMRAVDPDYPKPVN-VWEGIPDSIKGAFMGSDGAFTYFYKGNKYWKFNNQLLKTESGYPKSVLVDWMGC 551          
BLAST of mmp protein vs. Ensembl Xenopus
Match: trim14 (tripartite motif containing 14 [Source:Xenbase;Acc:XB-GENE-6048753])

HSP 1 Score: 215.312 bits (547), Expect = 5.379e-61
Identity = 171/580 (29.48%), Postives = 263/580 (45.34%), Query Frame = 2
Query:  140 FPELIHIDHEMINFIFTGLCLICYSINALSPHRAML--YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHV-----DINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYP---IGSSSPPYSRSGDAHFDDDEFWV--EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYT-------------TVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGK-TFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
             P+L  +D   ++ +F  +   C   + LS    +L  +L  YGYL LP    +++ +  +++       SA+   Q+ + +P TG L+    + +   RCG PD+             S+R     +R KRY +     KW +K +T+ I +Y  K +     R  + +AF++W K       +I Y+E      +ADI+I F S  HGDS PFDG    LAHA++P   IG         GD HFD DE W       DG +L  VAVHELGH++GL HS   +AIM PFY      N KL  DD+ G+Q IYG  +                I++  +                  P    + + CD   + +   R  E++VF  +  WR+  +K    +        P  +  +W  LP    KID   ER D K   F+ +++W+ ++ T  + P Y     L  LG     E IDT  RW+     Y   G +YW+ NE   E     P YP+ I ++WK +P     A+    G  T+F KG+ +++F+N  + +  G P+ +   W+GC +
Sbjct:    2 MPKLEGLDQIDVS-VFESVMPQCRLTDLLSNSLLVLQRWLKTYGYL-LPYDIRISALQSGKAM------QSAVSAMQQFYGIPVTGELDQMTIEWMKKPRCGVPDHP----------HLSHR-----RRNKRYALTG--QKWRQKHITYSIHNYTPK-VGELDTRKAIRQAFDVWQKVTPLTFEEIPYSEIKNERKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIG---------GDTHFDSDEPWTLGNSNHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAETMEPTRPLPTLPPRRIHSTSERKHERQPRPPRPPLGDKPPSTGSRPNICDGNFNTVALFRG-EMFVFKDRWFWRLRNNKVQEGY--------PMQIEQFWKGLPP---KIDAAYERSDGKFVFFKGDKYWVFKEVT--AEPGYPHS--LVELGSCLPREGIDTALRWETFSKTYFFKGDRYWRYNE---EKRAADPGYPKPI-TIWKGIPESPQGAFVSKEGSYTYFYKGREYWKFDNQRLTVEPGYPRSIVKDWMGCNQ 526          
BLAST of mmp protein vs. Ensembl Mouse
Match: Mmp25 (matrix metallopeptidase 25 [Source:MGI Symbol;Acc:MGI:2443938])

HSP 1 Score: 248.44 bits (633), Expect = 2.419e-73
Identity = 169/522 (32.38%), Postives = 245/522 (46.93%), Query Frame = 2
Query:  248 YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQ-VRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPT--EGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERK-DQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            +L +YGYL  P  D +++       + D     AIK  Q+   LP+TG ++    K +   RC  PD     +G          A  +++R +RY +      W K+ LTW I+S+  K    PQ VR +++ A  +WA    + + E    Y + DIII F    H DS PFDG    LAHAF+P       +  SGD HFDD+E W     D  G +L AVAVHE GH++GLGHS++  +IM PFY  P       +L  DD +G+Q +YG  S N    P        P        + A P+    D C+   DA+  IR  EI++F G   WR+  S  + S         P  L+ +W  LP  +  I     R  D +I +F   +FW+ ++  +L         PL   GLP   E +D +F W +N   Y++ G KYW+ +E +       P YPR++ S+W   P   D       G T+F KG +F+ F    +K     P+P+ P W+ C
Sbjct:   90 WLTRYGYL--PPADPVHAQMQSLEKLQD-----AIKVMQRFAGLPETGQMDPMTIKTMRKPRCSLPDV----LG----------AAGLVRRRRRYSLSG--SVWKKRTLTWSIRSFSQKSQLSPQIVRTLLSYALAVWATESGLTFQEVNSQYQEPDIIIHFARAYHQDSYPFDGSGGTLAHAFFPGE-----HPISGDTHFDDEETWTFGSTDDNGIDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPATYRLPQDDRDGLQQLYGRVSQNPNARPTRKPLVPPPQPPAMPPDSPATPVP---DRCEGNFDAVANIRG-EIFLFKGPWFWRLQPSGQLVS-------PRPAGLHRFWEGLPTHVKVIQAAYARPLDGRIILFSGPQFWVFQER-QLEG----AARPLVEFGLPPG-EDVDAVFSWPHNGKTYLIRGQKYWRYDEVAAR---PDPGYPRAL-SLWDGAPFAPDDVTISNTGDTYFFKGTHFWRFAEGSVKAESDSPQPIGPKWLDC 562          
BLAST of mmp protein vs. Ensembl Mouse
Match: Mmp16 (matrix metallopeptidase 16 [Source:MGI Symbol;Acc:MGI:1276107])

HSP 1 Score: 213.386 bits (542), Expect = 2.482e-60
Identity = 171/573 (29.84%), Postives = 258/573 (45.03%), Query Frame = 2
Query:  179 FIFTGLCLICYSINALSPH-RAMLYLNKYGYLQL--PRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHV-----DINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYP---IGSSSPPYSRSGDAHFDDDEFWV--EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKID--------------------FCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYT-GLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            F+ T L ++C ++     +    ++L KYGYL    PR+  L S E            SA+   Q+ + +  TG ++      +   RCG PD       FN+             R KRY +     KW  K +T+ IK+   K +  P+ R  + RAF++W         ++ Y+E      D DI I F S  HGDS PFDG    LAHA++P   IG         GD HFD DE W       DG +L  VAVHELGH++GL HS   TAIM PFY      N KL  DD+ G+Q IYG              P   P+ T+P + +V P   ++ D                     CD   + +  +R  E++VF  +  WR+  ++ +  +        P  + Y+W  LP ++D +    E  D     F+ N++W+ +D T    P Y   L     G+P +   ID+   W+     Y   G +YW+ +E   E   + P YP+ I ++WK +P     A+    +G T+F KGK +++FNN  +K+  G P+ +   ++GC
Sbjct:   22 FLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAE---------TMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNI-------------RRKRYALTG--QKWQHKHITYSIKNVTPK-VGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIG---------GDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPD--------KIPPPTRPLPTVPPHRSVPPADPRRHDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRR-EMFVFKDQWFWRVRNNRVMDGY--------PMQITYFWRGLPPSIDAV---YENSDGNFVFFKGNKYWVFKDTT--LQPGYPHDLITLGNGIPPH--GIDSAIWWEDVGKTYFFKGDRYWRYSE---EMKTMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGC 532          
BLAST of mmp protein vs. Ensembl Mouse
Match: Mmp17 (matrix metallopeptidase 17 [Source:MGI Symbol;Acc:MGI:1346076])

HSP 1 Score: 211.46 bits (537), Expect = 6.261e-60
Identity = 154/527 (29.22%), Postives = 238/527 (45.16%), Query Frame = 2
Query:  248 YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKG-LNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIK--LDIDDINGMQSIYG---SASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIER-KDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
            +L+++GYL  P  D  +       L      S AI   Q+   L  TG L+     ++   RC  PD    P G        +R KR            P  KW K++L+W+++++P    L R  VRA+M  A  +W+    +N+ E  G  N ADI I+F   +H D  PFDGP   +AHAF+P       +  +GD HFDDDE W  +  D  G +L AVAVHE GH++GL H A+ ++IM P+Y  P    ++  L  +D   +  +YG   S S   +L         +        ++  PP       C    DA+  IR  E + F GK  WR+   + + S         P  ++ +W  LP  LD +D   ER  D KI  F+ +R+W+ +DN      N  +G P  V         ID +F W +N   Y      YW+ ++ +      YP    +   +W+ +P  LD A     G ++F +G+ +++  + E++   G P+     W+ C +
Sbjct:   54 WLSRFGYL--PPADPASG-----QLQTQEELSKAITAMQQFGGLETTGILDEATLALMKTPRCSLPDL---PPG------AQSRRKRQTP---------PPTKWSKRNLSWRVRTFPRDSPLGRDTVRALMYYALKVWSDITPLNFHEVAG--NAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGD-----HHTAGDTHFDDDEPWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAPSSIMQPYYQGPVGDPLRYGLPYEDRVRVWQLYGVRESVSPTAQLDTPEPEEPPLLPEPPNNRSST-PPQKDVPHRCTAHFDAVAQIRG-EAFFFKGKYFWRLTRDRHLVSLQ-------PAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDN------NVEEGYPRPVSDFSLPPGGIDAVFSWAHNDRTYFFKDQLYWRYDDHTRRMDPGYP----AQGPLWRGVPSMLDDAMRWSDGASYFFRGQEYWKVLDGELEAAPGYPQSTARDWLVCGE 529          
BLAST of mmp protein vs. Ensembl Mouse
Match: Mmp24 (matrix metallopeptidase 24 [Source:MGI Symbol;Acc:MGI:1341867])

HSP 1 Score: 206.068 bits (523), Expect = 1.165e-57
Identity = 169/558 (30.29%), Postives = 252/558 (45.16%), Query Frame = 2
Query:  230 PHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGN-YSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYN------DADIIIEFGSKEHGDSIPFDGPNYVLAHAFYP---IGSSSPPYSRSGDAHFDDDEFWV--EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINK---------------------KIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHG-KTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
            P     +L  YGYL    L Y    E   S +  G    SA+   Q+ + +P TG L+    + +   RCG PD+              + ++R  +R KRY +     KW +K +T+ I +Y  K +     R  + +AF++W K   + + EE  Y+       +ADI+I F S  HGDS PFDG    LAHA++P   IG         GD HFD DE W       DG +L  VAVHELGH++GL HS   +AIM PFY      N KL  DD+ G+Q IYG  +          +    P+ TLP     +P   K                     K + CD   + +   R  E++VF  +  WR+  ++    +        P  +  +W  LP    +ID   ER D +   F+ +++W+ ++ T    P Y     L  LG     E IDT  RW+     Y   G +YW+ +E   E     P YP+ I +VWK +P     A+    G  T+F KG+ +++F+N ++ +  G P+ +   W+GCK+
Sbjct:   51 PFAGQNWLKSYGYL----LPY----ESRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDH-------------PHLSRR--RRNKRYALTG--QKWRQKHITYSIHNYTPK-VGELDTRKAIRQAFDVWQKVTPLTF-EEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIG---------GDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPA--------EPLEPTRPLPTLPVRRIHSPSERKHERHPRPPRPPLGDRPSTPGAKPNICDGNFNTVALFRG-EMFVFKDRWFWRLRNNRVQEGY--------PMQIEQFWKGLPA---RIDAAYERADGRFVFFKGDKYWVFKEVT--VEPGYPHS--LGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSE---ERRATDPGYPKPI-TVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWMGCKQ 544          
BLAST of mmp protein vs. Ensembl Mouse
Match: Mmp14 (matrix metallopeptidase 14 (membrane-inserted) [Source:MGI Symbol;Acc:MGI:101900])

HSP 1 Score: 200.29 bits (508), Expect = 9.262e-56
Identity = 168/531 (31.64%), Postives = 241/531 (45.39%), Query Frame = 2
Query:  248 YLNKYGYLQLP--RLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTE------ETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYP---IGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYN-KRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGK-TFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            +L +YGYL     R     SP+         + S+AI   QK + L  TG  +      +   RCG PD     I  NV             R KRY I    +KW   ++T+ I++Y  K        AI  +AF +W     + + E        G+   ADI+I F    HGDS PFDG    LAHA++P   IG         GD HFD  E W  Q  D  G ++  VAVHELGH++GL HS   +AIM PFY      N  L  DD  G+Q +YGS S +  ++PP P   +   +   PK     P I      CD   D +  +R  E++VF  +  WR+  ++ +  +        P  +  +W  LP +   I+   ERKD K   F+ ++ W+ ++ +    P Y   +     GLP   +KID    W  N   Y   G KY++ NE   EF  V   YP++I  VW+ +P     ++ G     T+F KG  +++FNN ++K+  G PK     W+GC
Sbjct:   38 WLQQYGYLPPGDLRTHTQRSPQ---------SLSAAIAAMQKFYGLQVTGKADLATMMAMRRPRCGVPDKFGTEIKANV-------------RRKRYAIQG--LKWQHNEITFCIQNYTPKVGEYATFEAI-RKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIG---------GDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPDKPKNPAYGPNI------CDGNFDTVAMLRG-EMFVFKERWFWRVRNNQVMDGY--------PMPIGQFWRGLPAS---INTAYERKDGKFVFFKGDKHWVFDEAS--LEPGYPKHIKELGRGLPT--DKIDAALFWMPNGKTYFFRGNKYYRFNE---EFRAVDSEYPKNI-KVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGC 508          
BLAST of mmp protein vs. UniProt/SwissProt
Match: sp|Q3U435|MMP25_MOUSE (Matrix metalloproteinase-25 OS=Mus musculus OX=10090 GN=Mmp25 PE=2 SV=1)

HSP 1 Score: 248.44 bits (633), Expect = 1.692e-72
Identity = 169/522 (32.38%), Postives = 245/522 (46.93%), Query Frame = 2
Query:  248 YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQ-VRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPT--EGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERK-DQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            +L +YGYL  P  D +++       + D     AIK  Q+   LP+TG ++    K +   RC  PD     +G          A  +++R +RY +      W K+ LTW I+S+  K    PQ VR +++ A  +WA    + + E    Y + DIII F    H DS PFDG    LAHAF+P       +  SGD HFDD+E W     D  G +L AVAVHE GH++GLGHS++  +IM PFY  P       +L  DD +G+Q +YG  S N    P        P        + A P+    D C+   DA+  IR  EI++F G   WR+  S  + S         P  L+ +W  LP  +  I     R  D +I +F   +FW+ ++  +L         PL   GLP   E +D +F W +N   Y++ G KYW+ +E +       P YPR++ S+W   P   D       G T+F KG +F+ F    +K     P+P+ P W+ C
Sbjct:   90 WLTRYGYL--PPADPVHAQMQSLEKLQD-----AIKVMQRFAGLPETGQMDPMTIKTMRKPRCSLPDV----LG----------AAGLVRRRRRYSLSG--SVWKKRTLTWSIRSFSQKSQLSPQIVRTLLSYALAVWATESGLTFQEVNSQYQEPDIIIHFARAYHQDSYPFDGSGGTLAHAFFPGE-----HPISGDTHFDDEETWTFGSTDDNGIDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPATYRLPQDDRDGLQQLYGRVSQNPNARPTRKPLVPPPQPPAMPPDSPATPVP---DRCEGNFDAVANIRG-EIFLFKGPWFWRLQPSGQLVS-------PRPAGLHRFWEGLPTHVKVIQAAYARPLDGRIILFSGPQFWVFQER-QLEG----AARPLVEFGLPPG-EDVDAVFSWPHNGKTYLIRGQKYWRYDEVAAR---PDPGYPRAL-SLWDGAPFAPDDVTISNTGDTYFFKGTHFWRFAEGSVKAESDSPQPIGPKWLDC 562          
BLAST of mmp protein vs. UniProt/SwissProt
Match: sp|Q9NPA2|MMP25_HUMAN (Matrix metalloproteinase-25 OS=Homo sapiens OX=9606 GN=MMP25 PE=1 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 1.819e-68
Identity = 166/529 (31.38%), Postives = 245/529 (46.31%), Query Frame = 2
Query:  248 YLNKYGYLQLPR--LDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYP-SKGLNRPQVRAIMTRAFNLWAKHVDINYTE-ETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGR--NLLAVAVHELGHSMGLGHSASETAIMYPFYVNPT--EGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIER-KDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKKYS 1807
            +L +YGYL  P      L SPE  R          AIK  Q+   LP+TG ++      +   RC  PD     +G             +++R +RY +      W K+ LTW+++S+P S  L++  VR +M+ A   W     + + E ++    + DI+I+F    H DS PFDG    LAHAF+P       +  SGD HFDD+E W    +DG   +L AVAVHE GH++GLGHS++  +IM PFY  P       +L  DD +G+Q +YG A       P        P        + + PI    D C+   DAI  IR  E + F G   WR+  S  + S         P  L+ +W  LP  +  +     R +D +I +F   +FW+ +D             PL  LGLP   E++D +F W  N   Y++ G +YW+ +EA+       P YPR + S+W+  P   D       G T+F KG +++ F    +K     P+P+ P W+ C   S
Sbjct:   35 WLTRYGYLPPPHPAQAQLQSPEKLRD---------AIKVMQRFAGLPETGRMDPGTVATMRKPRCSLPDV----LG----------VAGLVRRRRRYALSG--SVWKKRTLTWRVRSFPQSSQLSQETVRVLMSYALMAWGMESGLTFHEVDSPQGQEPDILIDFARAFHQDSYPFDGLGGTLAHAFFPGE-----HPISGDTHFDDEETWTFGSKDGEGTDLFAVAVHEFGHALGLGHSSAPNSIMRPFYQGPVGDPDKYRLSQDDRDGLQQLYGKAPQTPYDKPTRKPLAPPPQPPASPTHSPSFPIP---DRCEGNFDAIANIRG-ETFFFKGPWFWRLQPSGQLVS-------PRPARLHRFWEGLPAQVRVVQAAYARHRDGRILLFSGPQFWVFQDRQLEGG-----ARPLTELGLPPG-EEVDAVFSWPQNGKTYLVRGRQYWRYDEAAAR---PDPGYPRDL-SLWEGAPPSPDDVTVSNAGDTYFFKGAHYWRFPKNSIKTEPDAPQPMGPNWLDCPAPS 512          
BLAST of mmp protein vs. UniProt/SwissProt
Match: sp|P51512|MMP16_HUMAN (Matrix metalloproteinase-16 OS=Homo sapiens OX=9606 GN=MMP16 PE=1 SV=2)

HSP 1 Score: 215.698 bits (548), Expect = 2.209e-60
Identity = 173/584 (29.62%), Postives = 262/584 (44.86%), Query Frame = 2
Query:  146 ELIHIDHEMINFIFTGLCLICYSINALSPH-RAMLYLNKYGYLQL--PRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHV-----DINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYP---IGSSSPPYSRSGDAHFDDDEFWV--EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKID--------------------FCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYT-GLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
             L  + H  + F+ T L ++C ++     +    ++L KYGYL    PR+  L S E            SA+   Q+ + +  TG ++      +   RCG PD       F++             R KRY +     KW  K +T+ IK+   K +  P+ R  + RAF++W         ++ Y+E      D DI I F S  HGDS PFDG    LAHA++P   IG         GD HFD DE W       DG +L  VAVHELGH++GL HS   TAIM PFY      N KL  DD+ G+Q IYG              P   P+ T+P + ++ P   +K D                     CD   + +  +R  E++VF  +  WR+  ++ +  +        P  + Y+W  LP ++D +    E  D     F+ N++W+ +D T    P Y   L     G+P +   ID+   W+     Y   G +YW+ +E   E   + P YP+ I +VWK +P     A+    +G T+F KGK +++FNN  +K+  G P+ +   ++GC
Sbjct:   11 RLDFVHHSGVFFLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAE---------TMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHI-------------RRKRYALTG--QKWQHKHITYSIKNVTPK-VGDPETRKAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIG---------GDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPD--------KIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRR-EMFVFKDQWFWRVRNNRVMDGY--------PMQITYFWRGLPPSIDAV---YENSDGNFVFFKGNKYWVFKDTT--LQPGYPHDLITLGSGIPPH--GIDSAIWWEDVGKTYFFKGDRYWRYSE---EMKTMDPGYPKPI-TVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGC 532          
BLAST of mmp protein vs. UniProt/SwissProt
Match: sp|Q9WTR0|MMP16_MOUSE (Matrix metalloproteinase-16 OS=Mus musculus OX=10090 GN=Mmp16 PE=2 SV=3)

HSP 1 Score: 213.386 bits (542), Expect = 1.736e-59
Identity = 171/573 (29.84%), Postives = 258/573 (45.03%), Query Frame = 2
Query:  179 FIFTGLCLICYSINALSPH-RAMLYLNKYGYLQL--PRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHV-----DINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYP---IGSSSPPYSRSGDAHFDDDEFWV--EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKID--------------------FCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYT-GLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            F+ T L ++C ++     +    ++L KYGYL    PR+  L S E            SA+   Q+ + +  TG ++      +   RCG PD       FN+             R KRY +     KW  K +T+ IK+   K +  P+ R  + RAF++W         ++ Y+E      D DI I F S  HGDS PFDG    LAHA++P   IG         GD HFD DE W       DG +L  VAVHELGH++GL HS   TAIM PFY      N KL  DD+ G+Q IYG              P   P+ T+P + +V P   ++ D                     CD   + +  +R  E++VF  +  WR+  ++ +  +        P  + Y+W  LP ++D +    E  D     F+ N++W+ +D T    P Y   L     G+P +   ID+   W+     Y   G +YW+ +E   E   + P YP+ I ++WK +P     A+    +G T+F KGK +++FNN  +K+  G P+ +   ++GC
Sbjct:   22 FLQTLLWILCATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAE---------TMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFNI-------------RRKRYALTG--QKWQHKHITYSIKNVTPK-VGDPETRRAIRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIG---------GDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPD--------KIPPPTRPLPTVPPHRSVPPADPRRHDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRR-EMFVFKDQWFWRVRNNRVMDGY--------PMQITYFWRGLPPSIDAV---YENSDGNFVFFKGNKYWVFKDTT--LQPGYPHDLITLGNGIPPH--GIDSAIWWEDVGKTYFFKGDRYWRYSE---EMKTMDPGYPKPI-TIWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGC 532          
BLAST of mmp protein vs. UniProt/SwissProt
Match: sp|Q9R0S3|MMP17_MOUSE (Matrix metalloproteinase-17 OS=Mus musculus OX=10090 GN=Mmp17 PE=1 SV=3)

HSP 1 Score: 211.46 bits (537), Expect = 4.379e-59
Identity = 154/527 (29.22%), Postives = 238/527 (45.16%), Query Frame = 2
Query:  248 YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKG-LNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIK--LDIDDINGMQSIYG---SASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIER-KDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
            +L+++GYL  P  D  +       L      S AI   Q+   L  TG L+     ++   RC  PD    P G        +R KR            P  KW K++L+W+++++P    L R  VRA+M  A  +W+    +N+ E  G  N ADI I+F   +H D  PFDGP   +AHAF+P       +  +GD HFDDDE W  +  D  G +L AVAVHE GH++GL H A+ ++IM P+Y  P    ++  L  +D   +  +YG   S S   +L         +        ++  PP       C    DA+  IR  E + F GK  WR+   + + S         P  ++ +W  LP  LD +D   ER  D KI  F+ +R+W+ +DN      N  +G P  V         ID +F W +N   Y      YW+ ++ +      YP    +   +W+ +P  LD A     G ++F +G+ +++  + E++   G P+     W+ C +
Sbjct:   54 WLSRFGYL--PPADPASG-----QLQTQEELSKAITAMQQFGGLETTGILDEATLALMKTPRCSLPDL---PPG------AQSRRKRQTP---------PPTKWSKRNLSWRVRTFPRDSPLGRDTVRALMYYALKVWSDITPLNFHEVAG--NAADIQIDFSKADHNDGYPFDGPGGTVAHAFFPGD-----HHTAGDTHFDDDEPWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAPSSIMQPYYQGPVGDPLRYGLPYEDRVRVWQLYGVRESVSPTAQLDTPEPEEPPLLPEPPNNRSST-PPQKDVPHRCTAHFDAVAQIRG-EAFFFKGKYFWRLTRDRHLVSLQ-------PAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDN------NVEEGYPRPVSDFSLPPGGIDAVFSWAHNDRTYFFKDQLYWRYDDHTRRMDPGYP----AQGPLWRGVPSMLDDAMRWSDGASYFFRGQEYWKVLDGELEAAPGYPQSTARDWLVCGE 529          
BLAST of mmp protein vs. TrEMBL
Match: K0JB92 (Mmp protein OS=Schmidtea mediterranea OX=79327 GN=mmp PE=2 SV=1)

HSP 1 Score: 1096.26 bits (2834), Expect = 0.000e+0
Identity = 546/546 (100.00%), Postives = 546/546 (100.00%), Query Frame = 2
Query:  170 MINFIFTGLCLICYSINALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKKYS 1807
            MINFIFTGLCLICYSINALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLPPVPDVPNNIPIYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKKYS
Sbjct:    1 MINFIFTGLCLICYSINALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLPPVPDVPNNIPIYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKKYS 546          
BLAST of mmp protein vs. TrEMBL
Match: A0A158QRZ4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS48 PE=3 SV=1)

HSP 1 Score: 484.952 bits (1247), Expect = 1.352e-161
Identity = 257/546 (47.07%), Postives = 359/546 (65.75%), Query Frame = 2
Query:  224 LSPHRAMLYLNKYGYLQLP-RLDYLNS-PEYERSL---------IMDGN--YSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYG----SNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVE-QGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKIN-EASGEFGYV--YPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCK 1798
            +S  +AM  L++YGYL  P R+++ +  P+  R L         ++D N  Y  A++ FQ  ++LP TG L+++  ++L A RCGNPD       +P G     R +  ++R L+R KRY I +P+M+W KK +TW+++SYP+  LNR Q  A+   AFN W+   D+++ EE  YY DADIII+FGS+ HGDSI FDGP  VLAHAFYP+    P YS +GDAHFDD+E W +   ++ R+LL+VA HELGHSMGLGHS+  T++M+P+Y+   +  ++LD DDINGMQ IYG+    K LP +PD+P+      +P+ TTVAP I  + D+C+ +VDAII +R +E+Y+F G+ QWR+ +SKTV++WISY+LRDGP  + YYW +LP  +D ID  IER D  IYIF+ NRFWLL DN +L+      GLPL  LGLPANL+K+DT+F+WD NK  YI AG +YW ++ +A    G V  +P YPR I   W+ +P P+  AYT L+G+T F  G  +Y F+N  M+  +G PK      IGC+
Sbjct:   40 ISTQQAMHLLHRYGYLNPPKRMNFADPIPDSNRILHNHPDDPDAMIDSNRLYHDAVRAFQTRYSLPVTGKLDSETLELLSAARCGNPDIDFTKTPSPPG-----RRTKFSRRDLRRSKRYLIGDPKMRWAKKKITWQVRSYPTHHLNRSQTHAVFQHAFNKWSSVADLDFVEEKDYYKDADIIIKFGSRRHGDSIAFDGPGGVLAHAFYPM--PEPVYSLAGDAHFDDEENWSDGPHKEHRDLLSVATHELGHSMGLGHSSVPTSVMFPYYLRKWK-RVELDQDDINGMQKIYGAPKPGKVLPAIPDLPDIPL---IPETTTVAPDITTQFDYCNISVDAIIEVRGLELYIFKGEYQWRVTWSKTVSNWISYQLRDGPTKIAYYWNVLPPDVDHIDAAIERNDSIIYIFKDNRFWLLVDNKRLAGGCPRSGLPLTKLGLPANLKKVDTVFKWDVNKEFYIFAGDEYWLLDPQAQHPIGKVAPWPDYPRRIKDTWRGIPTPVTTAYTTLNGETLFFDGSRYYVFDNTAMRARDGYPKQAKLGIIGCQ 574          
BLAST of mmp protein vs. TrEMBL
Match: A0A5K3EM84 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 484.952 bits (1247), Expect = 2.300e-161
Identity = 257/546 (47.07%), Postives = 359/546 (65.75%), Query Frame = 2
Query:  224 LSPHRAMLYLNKYGYLQLP-RLDYLNS-PEYERSL---------IMDGN--YSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYG----SNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVE-QGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKIN-EASGEFGYV--YPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCK 1798
            +S  +AM  L++YGYL  P R+++ +  P+  R L         ++D N  Y  A++ FQ  ++LP TG L+++  ++L A RCGNPD       +P G     R +  ++R L+R KRY I +P+M+W KK +TW+++SYP+  LNR Q  A+   AFN W+   D+++ EE  YY DADIII+FGS+ HGDSI FDGP  VLAHAFYP+    P YS +GDAHFDD+E W +   ++ R+LL+VA HELGHSMGLGHS+  T++M+P+Y+   +  ++LD DDINGMQ IYG+    K LP +PD+P+      +P+ TTVAP I  + D+C+ +VDAII +R +E+Y+F G+ QWR+ +SKTV++WISY+LRDGP  + YYW +LP  +D ID  IER D  IYIF+ NRFWLL DN +L+      GLPL  LGLPANL+K+DT+F+WD NK  YI AG +YW ++ +A    G V  +P YPR I   W+ +P P+  AYT L+G+T F  G  +Y F+N  M+  +G PK      IGC+
Sbjct:   50 ISTQQAMHLLHRYGYLNPPKRMNFADPIPDSNRILHNHPDDPDAMIDSNRLYHDAVRAFQTRYSLPVTGKLDSETLELLSAARCGNPDIDFTKTPSPPG-----RRTKFSRRDLRRSKRYLIGDPKMRWAKKKITWQVRSYPTHHLNRSQTHAVFQHAFNKWSSVADLDFVEEKDYYKDADIIIKFGSRRHGDSIAFDGPGGVLAHAFYPM--PEPVYSLAGDAHFDDEENWSDGPHKEHRDLLSVATHELGHSMGLGHSSVPTSVMFPYYLRKWK-RVELDQDDINGMQKIYGAPKPGKVLPAIPDLPDIPL---IPETTTVAPDITTQFDYCNISVDAIIEVRGLELYIFKGEYQWRVTWSKTVSNWISYQLRDGPTKIAYYWNVLPPDVDHIDAAIERNDSIIYIFKDNRFWLLVDNKRLAGGCPRSGLPLTKLGLPANLKKVDTVFKWDVNKEFYIFAGDEYWLLDPQAQHPIGKVAPWPDYPRRIKDTWRGIPTPVTTAYTTLNGETLFFDGSRYYVFDNTAMRARDGYPKQAKLGIIGCQ 584          
BLAST of mmp protein vs. TrEMBL
Match: A0A068WAJ7 (Matrix metallopeptidase 7 M10 family OS=Echinococcus granulosus OX=6210 GN=EgrG_000939100 PE=3 SV=1)

HSP 1 Score: 480.33 bits (1235), Expect = 8.027e-160
Identity = 253/542 (46.68%), Postives = 348/542 (64.21%), Query Frame = 2
Query:  224 LSPHRAMLYLNKYGYLQLPRLDYLNSP---------EYERSLIMDGN----YSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDE-FWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKIN-EASGEFGYVYPR--YPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCK 1798
            +S  +A+  L++YGYL  P    +  P          Y   +    N    Y +A+K FQ+ ++LP TG L++   ++L A RCGNPD   +         +  +++R   RVKRY I +P+M+W KK LTW+I SYP+  LNR Q  A+   AFN W+   D+++ EE  YY DADI+I+FGS+ HGDSI FDGP  VLAHAFYP+    P YS +GDAHFDD+E +W    ++ RNLL+VA HELGHSMGLGHS+  T++M+P+Y++  +  ++LD DDINGMQ IYG+    K LP +PD+P+     ++P+ TTV P  NK+ID+C+T+VDAII +R +E+Y+F G+ QWR+ +SKTV+ WISY+LRDGP  + YYW +LP  +D ID  +ER D  IYIFR N+FWLL DN +L+      GLPL  LGLPA+L K+D +F+WD N+A YI AG  YW ++ +    FG V P   YPR I   W+ +P P+  AYT L+G+T F  G  +Y F+N  M+   G PKP     IGC+
Sbjct:   40 ISTQKAIRLLHRYGYLNPPNRKRVADPISVARRIFPRYRSDVFGMTNPNALYRNALKVFQRRYSLPVTGRLDSSTMELLAAPRCGNPDIDPD--------ESLIQSERRPSRVKRYLIGDPKMRWTKKKLTWQIHSYPTHHLNRSQTHAVFQHAFNKWSSVADLDFVEEKNYYKDADIVIKFGSRRHGDSIAFDGPGGVLAHAFYPM--PEPVYSLAGDAHFDDEEEWWDGPHQEYRNLLSVATHELGHSMGLGHSSVHTSVMFPYYLSKWK-RVELDQDDINGMQKIYGAPRPGKVLPEIPDLPDIP---SIPETTTVKPDTNKQIDYCNTSVDAIIEVRGLELYIFKGEYQWRVTWSKTVSDWISYQLRDGPTKIAYYWNVLPPDVDFIDAAVERPDSLIYIFRDNKFWLLADNKRLAGGCPRSGLPLTKLGLPASLRKVDAVFKWDVNQAFYIFAGDVYWLLDVKTHPPFGKVAPSPDYPRRIKDTWRGIPTPVTTAYTTLNGETLFFDGSQYYAFDNTAMQARRGYPKPAKLGIIGCQ 567          
BLAST of mmp protein vs. TrEMBL
Match: W6U5D0 (Matrix metalloproteinase-25 OS=Echinococcus granulosus OX=6210 GN=EGR_08815 PE=3 SV=1)

HSP 1 Score: 479.559 bits (1233), Expect = 1.488e-159
Identity = 254/542 (46.86%), Postives = 345/542 (63.65%), Query Frame = 2
Query:  224 LSPHRAMLYLNKYGYLQLPRLDYLNSP---------EYERSLIMDGN----YSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDE-FWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKIN-EASGEFGYVYPR--YPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCK 1798
            +S  +A+  L++YGYL  P    +  P          Y   +    N    Y +A+K FQ+ ++LP TG L++   ++L A RCGNPD   +        R S        RVKRY I +P+M+W KK LTW+I SYP+  LNR Q  A+   AFN W+   D+++ EE  YY DADI+I+FGS+ HGDSI FDGP  VLAHAFYP+    P YS +GDAHFDD+E +W    ++ RNLL+VA HELGHSMGLGHS+  T++M+P+Y++  +  ++LD DDINGMQ IYG+    K LP +PD+P+     ++P+ TTV P  NK+ID+C+T+VDAII +R +E+Y+F G+ QWR+ +SKTV+ WISY+LRDGP  + YYW +LP  +D ID  +ER D  IYIFR N+FWLL DN +L+      GLPL  LGLPA+L K+D +F+WD N+A YI AG  YW ++ +    FG V P   YPR I   W+ +P P+  AYT L+G+T F  G  +Y F+N  M+   G PKP     IGC+
Sbjct:   40 ISTQKAIRLLHRYGYLNPPNRKRVADPISVARRIFPRYRSDVFGMTNPNALYRNALKVFQRRYSLPVTGRLDSSTMELLAAPRCGNPDIDPDESLIQSEGRPS--------RVKRYLIGDPKMRWTKKKLTWQIHSYPTHHLNRSQTHAVFQHAFNKWSSVADLDFVEEKNYYKDADIVIKFGSRRHGDSIAFDGPGGVLAHAFYPM--PEPVYSLAGDAHFDDEEEWWDGPHQEYRNLLSVATHELGHSMGLGHSSVHTSVMFPYYLSKWK-RVELDQDDINGMQKIYGAPRPGKVLPEIPDLPDIP---SIPETTTVKPDTNKQIDYCNTSVDAIIEVRGLELYIFKGEYQWRVTWSKTVSDWISYQLRDGPTKIAYYWNVLPPDVDFIDAAVERPDSLIYIFRDNKFWLLADNKRLAGGCPRSGLPLTKLGLPASLRKVDAVFKWDVNQAFYIFAGDVYWLLDVKTHPPFGKVAPSPDYPRRIKDTWRGIPTPVTTAYTTLNGETLFFDGSQYYAFDNTAMQARRGYPKPAKLGIIGCQ 567          
BLAST of mmp protein vs. Ensembl Cavefish
Match: mmp17a (matrix metallopeptidase 17 [Source:NCBI gene;Acc:103024431])

HSP 1 Score: 229.18 bits (583), Expect = 2.468e-66
Identity = 163/545 (29.91%), Postives = 253/545 (46.42%), Query Frame = 2
Query:  212 SINALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKG--LNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDI--DDINGMQSIYG---SASYNKRLXXXXXXXXXXXX-------YTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERK-DQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            S+ A      + +L+K+GYL  P  D +        L      + AIK  Q+   L +TG L+     ++   RC  PD  +  I      R                   PQ KW K+ L+W+++++P +   L R  VRA+M  A  +W+    +N+ E  G  N+ADI I+F   +H D  PFDGP   +AHAF+P    +     +GD HFDDDE W  +  D  G +L AVAVHE GH++GL H+++  +IM P+Y  P    +K D+  +D   +  +YG   S S+   +          P          LP+  +  PP     D C +  DA+  IR  E + F GK  WR+   + + S     LR  P  ++ +W  LP  LD +D   ER  D KI  F+  ++W+ +DN  +    Y    P+   GLP  +E +D +F W +N   Y     +YW+ ++        YP+      ++WK +P  LD A       ++F KGK ++     +M++  G P+P+   W+ C
Sbjct:   39 SLTAEQMDMGVDWLSKFGYL--PPADPVTG-----QLQTKEALTKAIKAMQRFGGLEETGVLDQATLGLMKTPRCSLPDVSAPEIAAGRRRRALA----------------PQNKWNKRHLSWRVRTFPKESALLGRDTVRALMYYALKVWSDIAPLNFHEVAG--NEADIQIDFTKADHNDGYPFDGPGGTVAHAFFPGERFT-----AGDTHFDDDEAWTFRSPDSHGMDLFAVAVHEFGHAIGLAHTSAIESIMRPYYQGPVGDPLKYDLPYEDKVRVWQLYGVRDSVSHTGTIVERSLSSMTSPSTESTVPLLDLPENRSTVPPARDAPDRCTSHFDAVAQIRG-EAFFFKGKYFWRLTRERHLVS-----LR--PAQIHRFWRGLPDNLDSVDAVYERPGDHKIVFFKGVKYWVFKDN--IVEEGY--PRPISDFGLP--MEGVDAVFVWLHNDKTYFFKDNRYWRYDDHLRRMDLGYPK----DTTLWKGVPAQLDDAMRWSDSASYFFKGKEYWRVAGSDMEVEAGYPRPIGKDWLVC 535          
BLAST of mmp protein vs. Ensembl Cavefish
Match: mmp16b (matrix metalloproteinase-16-like [Source:NCBI gene;Acc:103028887])

HSP 1 Score: 205.297 bits (521), Expect = 1.676e-57
Identity = 170/582 (29.21%), Postives = 261/582 (44.85%), Query Frame = 2
Query:  152 IHIDHEMINFIFTGLCLICYSINALSPHRAMLYLNKYGYLQ--LPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTE------ETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYP---IGSSSPPYSRSGDAHFDDDEFWV-------EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXX---------------XXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLP-LPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            + + H  + ++   LC++C ++          +L +YGYL    P +  L S +            SAI   Q+ + L  TG L+      +   RCG PD         + I +S+R+++    +          KW +  +T+ IK+   K   R    AI  RAF++W     +N+        E+G   D DI I F S  HGDS PFDG    LAHA++P   IG         GD HFD DE W         +   G +L  VAVHELGH++GL HS   TAIM PFY      + KL  DD+ G+Q IYG    N +   +                        +  P+ +  + P N K + CD   + +  +R+ E++VF  +  WR+  +  V  +        P  ++Y+W  LP    KID   E  + K   F+ +RFW+ +D T    P Y   + L   G+P   + I+T   W+     Y   G +YW+ NE   +   + P YP+ I +VWK +P  P        +G T+F KGK +++FNNL +++  G P+ +   ++GC
Sbjct:   12 LELAHTALVWVCVSLCVVCSAVGE-DDFSVEDWLERYGYLHHTEPNMAVLRSAQ---------TVQSAIAAMQRVYGLNVTGSLDQSTIAWMKKPRCGVPD--------QLKISSSSRSRKRRYALT-------GQKWQRTHITYSIKNVTPKVGARETHEAIR-RAFDVWQGVTPLNFEAVPYSALESGK-RDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIG---------GDTHFDSDEPWTLGNPNHDGERMAGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMDTESFKLPHDDLQGIQKIYGPPDRNPQPTRLLTTAPPPRLHPPSDPRKPDRQNRAHRPPQRSKPSHP-NSKPNICDGGFNTLAILRQ-ELFVFKDQWFWRVRDNSVVPGY--------PMQISYFWKGLPP---KIDAVYENSEGKFVFFKGHRFWVFKDTT--LQPTYPQDISLFGSGMPT--QNIETAVWWEDVAKTYFFKGDRYWRYNE---DMRTMDPGYPKPI-TVWKGIPDSPQGAFVDKANGFTYFYKGKEYWKFNNLRLRVEPGYPRSILRDFMGC 536          
BLAST of mmp protein vs. Ensembl Cavefish
Match: mmp24 (matrix metallopeptidase 24 [Source:NCBI gene;Acc:103022628])

HSP 1 Score: 198.364 bits (503), Expect = 5.304e-55
Identity = 161/545 (29.54%), Postives = 246/545 (45.14%), Query Frame = 2
Query:  248 YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHV-----DINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYP---IGSSSPPYSRSGDAHFDDDEFWV--EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTL--------------PKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEK--IDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHG-KTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
            +L  YGYL LP     +    E+S+       SA+   Q+ + +P TG L+    + +   RCG PD+              + ++R  +R KRY +     KW  K +++ I ++  K   +   RAI  +AF++W         ++ Y E      +ADI+I F S  HGDS PFDG    LAHA++P   IG         GD HFD DE W       DG +L  VAVHELGH++GL HS   +AIM PFY      + KL +DD+ G+Q IYG  +                 ++               P     + P   + + CD   + +   R  E++VF  +  WR+  +K    +        P  ++ +W  LP    +ID   ER D K   F+ +++W+  + T  S      G P  ++ L   L +  IDT  RW+     Y   G +YW+ NE   E       YP+ I +VWK +P     A+    G  T+F KGK +++F+N ++ +  G PK +   W+GC +
Sbjct:   45 WLKNYGYL-LPDNIRTSDLRSEKSM------QSAVAAMQRFYGIPVTGVLDQTTIEWMKKPRCGVPDH-------------PHFSRR--RRNKRYALTG--QKWRDKKISYSIHNFTPKVGEKDTQRAI-RQAFDVWQTVTPLTFQEVAYPEIKKDGKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIG---------GDTHFDSDEPWTLGNSNHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHDFKLPLDDLQGIQKIYGIPTAMLEPTRPLPTLPARRTHSTSERKHDRQTRPPRPPSGDRPSSPGYGRPNICDGNFNTVAFFRR-EMFVFKDRWFWRLRNNKVQEGY--------PMLIDQFWKGLPP---RIDAAYERSDGKFVFFKGDKYWVFREVTVES------GYPHSLVELGNCLPRDGIDTALRWEPVGKTYFFKGDQYWRYNE---EKRMTDQGYPKPI-TVWKGIPEGPQGAFISREGFYTYFYKGKDYWKFDNQKLMVEPGYPKSILKDWMGCDQ 533          
BLAST of mmp protein vs. Ensembl Cavefish
Match: mmp14a (matrix metallopeptidase 14 [Source:NCBI gene;Acc:103024760])

HSP 1 Score: 195.667 bits (496), Expect = 2.679e-54
Identity = 164/548 (29.93%), Postives = 241/548 (43.98%), Query Frame = 2
Query:  200 LICYSINALSPHRAMLYLNKYGYLQLP--RLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYND--------ADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSN-PNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGK-TFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
            L+    N     RA  +L +YGYL     R   + SP+         + +SAI   QK + L  TG ++    K +   RCG PD   + +  N+             R KRY +    +KW K+++T+ I++Y  K   R    AI  RAF +W   + + + E    +N         ADI++ F    HGDS PFDG    LAHA++P           GD HFD  E W     D  G ++  VAVHELGH++GL HS   +AIM PFY      N  L  DD  G+Q IYG+ S           P        P   +  P      D C+   D I  +R  E++VF  K  WR+   K    +        P  + ++W  LP +   I+   ER D K   F+ +++W+  + T     P  F  L     GLP +  ++D    +      Y   G KY++ NE S     V   YP+ I S W+ +P  +  A     G  T+F K   +++FNN + ++  G PK +  AW+GC++
Sbjct:   14 LLAEGTNGEKEVRAEAWLQQYGYLPPGDVRAQAIRSPK---------SITSAISAMQKFYGLTVTGTMDPATLKAMQRPRCGVPDKFGSELKSNL-------------RRKRYVVQG--LKWEKREITFSIQNYTPKVGERATQEAI-RRAFKVWEAAIPLTFREIP--FNQIRDRPEKFADIMLSFAEGFHGDSTPFDGEGGFLAHAYFP------GQGIGGDTHFDGAEPWTTGNVDLGGNDVFLVAVHELGHALGLEHSGDPSAIMAPFYQWMDTENFVLPDDDRRGIQQIYGAGS------GEVPKPPAPRPTRRPDRPSFGP------DICEGHFDTIAMLRG-EMFVFKEKWFWRMRDGKPQQGY--------PMPIGHFWKGLPPS---INAAYERADGKFVFFKGDKYWVFSEATMDQGYPKTFKELG---TGLPKD--RLDAALYYTPTGNTYFFRGNKYYRFNENSRS---VDSDYPKPI-SKWQGVPDNVKGAIMSDDGAYTYFYKANKYWKFNNQQTRVEAGYPKSVLTAWMGCEE 495          
BLAST of mmp protein vs. Ensembl Cavefish
Match: mmp25b (matrix metallopeptidase 25b [Source:ZFIN;Acc:ZDB-GENE-100308-4])

HSP 1 Score: 187.193 bits (474), Expect = 1.925e-51
Identity = 168/541 (31.05%), Postives = 247/541 (45.66%), Query Frame = 2
Query:  236 RAMLYLNKYGYLQLP--RLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTE-ETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGR--NLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNI---KLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKY---TTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERK-DQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPAN--LEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPR----YPRSIHSVWKDLPL-PLDVAYTGLHGKTFFIKGKYFY--EFNNLEMKIVEGGPKPLTPAWIGC 1795
            R + +L++YGYL  P  R   L + E             AI++ Q+   L +TG L++   K++   RC  PD           + T +R +   +R KRY +    ++W K +LTW     P+  L    V  +M  A  +W+ + +I ++  +      ADI I F    H D  PFDG    LAHAF+P G+       +GD HFDD+E W   G+DG   +L  VAVHE GH++GL HS+   +IM P+Y     G+I   KL  DD+  +Q +YG                       PKY    T   P +K  D C+   DAI  IR  +++ F G   WR+     V+          P  +  +W  LP+  DKID   ERK D  I  F  ++FW+ +D   L  P Y    P+   G+     +EK+D  F W +N   YI +G  +W+  E+ G      PR    YPR+  S+WK  P  P D+   G  G T+F KG  ++  +   L+  ++   PK     W+ C
Sbjct:   33 RGVDWLSRYGYLPPPDPRTGKLQTKE---------GIEKAIRQMQRFGGLKETGKLDSATLKLMSTPRCSLPDI----------VGTEDRLR---RRRKRYTLSG--LRWDKTNLTWSPSLPPN--LKPDLVSTLMFHALQVWSDNTNIQFSGLQPKDAKVADIRISFARFLHDDGYPFDGKGGTLAHAFFP-GT----VEIAGDTHFDDEETWTYGGQDGAGTDLFTVAVHEFGHALGLSHSSVNPSIMMPYYQGAV-GDIRSYKLPQDDVQAIQILYGEIK--------------------PKYFIDRTTPDPGSK--DRCEGGFDAIGNIRG-DVFFFKGPYFWRMQRGSLVSL--------NPAQITNFWIGLPQGTDKIDAVYERKTDSHIIFFIGSQFWVFKDTVAL--PGYPQ--PISKWGMRNQQVVEKVDAAFVWAHNGKTYIFSGGLFWRFTESQGG---AVPRPDAEYPRNA-SLWKGAPANPDDIMSWGSAGDTYFFKGNSYWVVKSGGLDQDVII--PKSTAVDWMFC 500          
BLAST of mmp protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001966.1 (pep scaffold:Pmarinus_7.0:GL476330:946825:981591:-1 gene:ENSPMAG00000001746.1 transcript:ENSPMAT00000001966.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 190.66 bits (483), Expect = 4.651e-53
Identity = 154/557 (27.65%), Postives = 245/557 (43.99%), Query Frame = 2
Query:  248 YLNKYGYLQL--PRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGY-----YNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWV--EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIY------------------GSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKK---------------IDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGK-TFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWI 1789
            +L +YGYL     R+  + SP         G  S+A+   Q+ + +  TG ++    + +   RCG PD            R     +  L+R KRY +     +W +K +T+ +++Y  K +     R  + RAF++W +   + + E + +       +ADI+I F S  HGDS PFDG    LAHA++P     P     GD HFD DE W        G +L  VA+HELGH++GL HS    AIM PFY      N  L  DD+ G+Q IY                  G A  +K        P        P+     P   +                 D C+   D +  +R  E++VF  +  WR+  ++ +  +        P ++ ++W  LP     ID   ER D K   F+ +++W+ ++   ++ P Y   L     GLP   ++ID    W+  +  +   G +YW+ NE +       P YPRS+ +VWK +P     A+ G  G  T+F KGK +++F+N  + +  G P+ +   W+
Sbjct:    1 WLQRYGYLPGGDARMSTIRSP---------GVMSAAVSAMQRFYGINVTGTVDADTLRWMKRPRCGVPD------------RIDQGLQAGLRR-KRYALTG--QRWQQKHITYSLQNYTPK-VGEADTRRALRRAFDVWQQVTPLVFEEVSNHEIRSSRREADIMIFFASGNHGDSSPFDGEGGFLAHAYFP----GP--GIGGDTHFDADEPWTLGNGNAGGNDLFLVAIHELGHALGLEHSNDPAAIMAPFYQYMDTENFVLPRDDLQGIQQIYVEQGKLQGDPLICSPLLAGPAEQDKVPSRPLPTPPPPRRPETPRRVDKVPKPPRSPDLGVDRPPPPPGTTPDICEGRFDTVAILRG-EMFVFKDRWFWRVRNNRVLDGY--------PMNIGHFWRGLPTN---IDAAYERPDGKFVFFKGDQYWVFKE--AMAEPGYPRSLAQFGNGLPH--DRIDAALWWEPMRKTFFFQGDRYWRFNEDNHA---TDPGYPRSV-TVWKGIPDGPKGAFMGREGAYTYFYKGKDYWKFDNERLSVESGYPRSILNDWM 506          
BLAST of mmp protein vs. Ensembl Sea Lamprey
Match: mmp19 (matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GENE-100308-3])

HSP 1 Score: 167.548 bits (423), Expect = 3.504e-46
Identity = 120/409 (29.34%), Postives = 186/409 (45.48%), Query Frame = 2
Query:  620 QVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSA------SYNKRLXXXXXXXXXXXXYTLP---------KYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
            +V+ I+ RAF+ W++   + + E T     ADI I+F   +HGD  PFDGP  VLAHA++P           G AHFD+DE W E    G NL  VA HE GH +GLGHS  + A+M PFY+       +L  DDI G+QS+YG+       +  +R+      P +   + +P         +  T +P  +   D C   +DAI    +   Y FSG   W +  +     +        P   +  W  LP +L        +     + F  +++W        S+P Y     +   GLP+N++    +FR      IY+  G +YW+ NE   +  +    YPR + + W+ +P   D A T  +G +FF K   ++  N+   +   G P+     W+GC +
Sbjct:   25 EVKKIIARAFHEWSRVTPLRFYE-TPTSPKADIHIQFSRLQHGDFAPFDGPGRVLAHAYFP---------EDGRAHFDEDEQWSEGTAQGINLHIVATHEFGHLLGLGHSKEQAALMAPFYMG-YRPKFRLHADDIAGIQSLYGTRLGKRHHTATRRVAQPAPPPRSRARW-MPHGRREDEGAERPTRSPIPHDVPDPCTAQLDAITMGPDGRTYAFSGAYCWVVTDTGVQQGY--------PVATSSLWSGLPASLSAA--AHSKHTGHTFFFAGDKYWRYRGFA--SDPGYPKM--MSSTGLPSNVDAA-LMFR----DRIYVFKGGEYWRWNEYHEQAVHG---YPRKMATTWRGVPSSPDAALTWGNGHSFFFKDGRYWRINSHSRRTEPGYPRDTAAVWMGCSR 399          
BLAST of mmp protein vs. Ensembl Sea Lamprey
Match: MMP14 (matrix metallopeptidase 14 [Source:HGNC Symbol;Acc:HGNC:7160])

HSP 1 Score: 163.696 bits (413), Expect = 6.031e-45
Identity = 132/446 (29.60%), Postives = 202/446 (45.29%), Query Frame = 2
Query:  248 YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETG---YYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLP--LEVLGLPANLEKIDTIFRWDYNKAIYIMAGYK 1564
            +L +YGYL  P  D L    Y    ++    S A+   Q  + +P TG ++    + +   RCG PD       +   +   +R KR       Y I++  +KW  + +T+ I++Y  K +   +    +  AF++W     + +T+ +G     NDADIII F S  HGD  PFDG    LAHA++P           GD HFD DE W   G D  G +L  VAVHELGH++GL HS   +AIM PFY      + +L  DD+ G+Q IY S     +               +P+    +PP     D C    D I  +R  E++VF  +  WR+   +   ++        P  + ++W  LP   + ++   ER D K   F+ ++FW+ +++   S      G P  L  LG     ++ID    W+ +   YI  G K
Sbjct:    5 WLQQYGYL--PAGD-LQMATYRSGQML----SEAVSSMQAFYGIPVTGTMDELTRQWMQKPRCGVPDR------YGTTVTAGSRHKR-------YAINH--LKWHHQHITYDIQNYTPK-VGEYETHQAIRHAFDVWQAVTPLTFTQVSGRDGSGNDADIIIFFASGYHGDRSPFDGVGGFLAHAYFP------GKGIGGDTHFDADEPWTLGGHDYTGNDLFIVAVHELGHALGLEHSNDPSAIMAPFYQYMDTDDFQLPYDDLLGIQQIYVSPGKPNKPNKPKPPKTKPGQ-DVPR--PGSPP-----DICKGGFDTIAMLRG-EMFVFKDQWFWRVKDKRVPENY--------PMPIGHFWLGLP---NNVESAYERGDGKFVFFKGSKFWVFDESVAES------GYPRSLSELGSGIPNDQIDAAVWWEPSGKTYIFRGDK 395          
BLAST of mmp protein vs. Ensembl Sea Lamprey
Match: mmp19 (matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GENE-100308-3])

HSP 1 Score: 161.77 bits (408), Expect = 1.175e-43
Identity = 145/541 (26.80%), Postives = 227/541 (41.96%), Query Frame = 2
Query:  197 CL-ICYSINALS---------PHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWI 1789
            C+  C  IN L+           +AM YL K+GY+   R    N  E E+++   G + S + +            L + +AK ++ +                  +  + A  + K     ++     +W K  L +   +  +  L   +V+ I+ RAF+ W++   + + E T     ADI I+F   +HGD  PFDGP  VLAHA++P           G AHFD+DE W E    G NL  VA HE GH +GLGHS  + A+M PFY+       +L  DDI G+QS+YG+     RL    + P+     T    T    PI K    C      + T  +   Y FSG   W +  +     +        P   +  W  LP +L        +     + F  +++W        S+P Y     +   GLP+N++    +FR      IY+  G +YW+ NE   +       YPR + + W+ +P   D A T  +G +FF K   ++  N+   +   G P+     W+
Sbjct:   10 CMATCVMINVLAQDLPSSTPDAKQAMEYLQKFGYISNGRFKVEN--EMEKAIRYCGIFVSVVIRTT----------LKSLVAKCMIEQ---------------CTAQCCDIA--LDKPTASCFVSGG--RWRKTTLAYHFLNL-TPDLKGNEVKKIIARAFHEWSRVTPLRFYE-TPTSPKADIHIQFSRLQHGDFAPFDGPGRVLAHAYFP---------EDGRAHFDEDEQWSEGTAQGINLHIVATHEFGHLLGLGHSKEQAALMAPFYMG-YRPKFRLHADDIAGIQSLYGT-----RLVFPREAPSRSLFMTRSACT----PIKKNTHIC------VGTGPDGRTYAFSGAYCWVVTDTGVQQGY--------PVATSSLWSGLPASLSA--AAHSKHTGHTFFFAGDKYWRYRGFA--SDPGYPK--MMSSTGLPSNVDAA-LMFR----DRIYVFKGGEYWRWNEYHEQ---AVHGYPRKMATTWRGVPSSPDAALTWGNGHSFFFKDGRYWRINSHSRRTEPGYPRDTAAVWM 470          
BLAST of mmp protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005331.1 (pep scaffold:Pmarinus_7.0:GL476741:9169:28768:-1 gene:ENSPMAG00000004733.1 transcript:ENSPMAT00000005331.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 154.451 bits (389), Expect = 9.949e-42
Identity = 126/418 (30.14%), Postives = 186/418 (44.50%), Query Frame = 2
Query:  554 KWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFY---VNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLED-NTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            KWLKK+LT++  +YPS G++R +    +  AF+LW     + +  +     +ADI+I F  + HGD  PFDGP+ VLAHA+ P    SP     GD HFDD+E W   G  G NL  VA HELGH++GL HS    +IM P Y   ++P      L  DD  G++++YG+                       K      P   ++   +  VDA   I   ++Y+F G+  WR+  S T            P  ++ +WP  P  +D +      ++  +  F   R W L        +P       L  LGLP    K+D            +  G +YW  NE +         +PR +H  W  +P  LD A T  +  TFFIKG+  +       ++ +     LT +W+GC
Sbjct:   27 KWLKKNLTYRFVNYPS-GMSRERAEDALAEAFDLWRSVSTLTF--QMLREGEADIMISFERRYHGDEFPFDGPHGVLAHAYEP----SP--GLGGDLHFDDEEQW-SVGLIGYNLRVVAAHELGHALGLQHSNERGSIMNPSYQVWIHPY-----LSEDDKAGIRALYGTV----------------------KLKQCPVPCAPRLCGGNLRVDAASFIHR-QLYIFQGEYFWRVSSSLTGAGL--------PGLVSSHWPGAPNRIDALYANA--RNHTLVFFSGERVWALRGFEVDTGSPR-----DLHSLGLPPGTLKVDAAV--PGRDHTLLFTGRQYWSYNEVTKRMD---AGFPRELHEDWPGIPTDLDAAVTK-NEFTFFIKGQQVFRMWTRPRRLDK--VMNLT-SWLGC 382          
BLAST of mmp protein vs. Ensembl Nematostella
Match: EDO41167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S526])

HSP 1 Score: 205.297 bits (521), Expect = 1.013e-58
Identity = 156/542 (28.78%), Postives = 238/542 (43.91%), Query Frame = 2
Query:  179 FIFTGLCLICYSINALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEV--LGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCK 1798
            ++  G+ L    I+  +P  A  YL +YGYL  P            ++    + S AI++FQ+   L +TG ++      +   RCG PD     +G + N R          R +RY +     +W K ++T++  SY +  L+R  VR I  RA  LW+  + +N  E +     AD  + F S +HGD  PFDGP   LAHAF+P           GD HFDD E + E    G NLL VA HELGH++GL HS    ++M P+Y    + N++L  DD+ G++ +YGS + +         P+               P     D C T +D ++   +   Y F     W++  +     +        P+ ++  WP LP   D +D  +   +   + F+   +W      K      +   P  +   GLP    KID  F W  N   Y +   KY++ N  SG     YPR      SVW  LP  +D A     G TFF    Y++ F++   ++  G PK +   W+GC+
Sbjct:    4 WLVLGVLLQWVCISDTAPI-AQDYLTRYGYLDAPN-------RKTGAIRSRQDLSRAIRQFQRYTGLQETGIMDAATKSKMEQPRCGLPDI----VGTSENAR----------RKRRYALQGS--RWEKSEITYRFASYGND-LSRTAVRRIFARAAKLWSDKMQLNIKETSD--AKADFTVSFNSYDHGDGDPFDGPGGTLAHAFFP--------QYGGDLHFDDSETYTEGKDAGVNLLFVAAHELGHTLGLSHSDVWQSVMAPYYPG-YKANLELHEDDVKGIRHLYGSRTSSTIPTSSSGGPDK--------------PAGGGPDTCTTDLDTVVVAGDGNTYAFKDAYVWKLRETGFAPGY--------PQLISKLWPGLP---DSLDAAVGWGEDITFFFKGKLYW------KYQGFKVYPDYPKRISNWGLPG---KIDAAFVWGRNGRTYFIKDDKYYRHNPYSGVIDNGYPR----PLSVWPGLPERVDAAVQDARGITFFFYKNYYFRFDDDRFRVDYGYPKSMNKVWLGCE 471          
BLAST of mmp protein vs. Ensembl Nematostella
Match: EDO48606 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ22])

HSP 1 Score: 191.815 bits (486), Expect = 2.261e-54
Identity = 159/521 (30.52%), Postives = 229/521 (43.95%), Query Frame = 2
Query:  248 YLNKYGYL--QLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYND--ADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDT-TVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGC 1795
            +L KYGYL  + PR  +L + E           + AI+  Q+   L +TG ++      +   RCG PD+             +++A+R     KRY +      W K DLT++IK Y S  L +     I   AF  W     +   E +    D   DI+I+F    HGD  PFDGP   LAHAFYP  +       SGDAHFDDDE +      G NL  VA+HE GHS+G+ HS    +IM+P+Y    +  I+L  DD+  +Q IYG+ +                 YT P   T  PP    +D C     DA +  ++   Y F+G      D+  T+T   S     GP  +   W  L      ID    RKD + Y+F K+ F+     T L         P+   GLP  L  +D IF W  N   YI     YW+ +E +         YPR +  VWK++P  +D      + KT+F K   ++  ++  ++   G P+ +   W+ C
Sbjct:    1 FLTKYGYLVPKDPRQGHLRTRE---------ELTKAIRMLQRFAGLNETGVMDAATIAQMGKSRCGMPDFSP-----------ADKARR----KKRYQLHG--TFWKKNDLTYRIKGYTSD-LPKSDQERIYKWAFAQWTGVSKLKIREASPDLPDDKVDILIDFVRGYHGDGYPFDGPGGTLAHAFYPHNNEGI----SGDAHFDDDEDFTTGKDSGINLDWVALHEFGHSLGIDHSEVHGSIMFPWYQGYKQ-KIQLTWDDVMAIQGIYGTVTVKP--------------YTGPTTPTKFPPA---VDMCKVPRYDAWLLGKDGVTYAFTG------DYYFTITD-PSLIGGKGPFKVADKWKELRTP---IDAAYTRKDGR-YVFFKDGFYWKYYQTTLEEHK-----PITAYGLPEELSGMDGIFVWGRNSRTYIFKDGYYWRYDEYNSRMDL---GYPRQVDGVWKNIPDKVDAIMKWRNEKTYFFKSGQYWRLDDFSIQSESGYPQSIAKKWMLC 453          
BLAST of mmp protein vs. Ensembl Nematostella
Match: EDO48502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ23])

HSP 1 Score: 172.555 bits (436), Expect = 6.026e-47
Identity = 154/540 (28.52%), Postives = 238/540 (44.07%), Query Frame = 2
Query:  248 YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFL-NTKIAKMLVAKRCGNPDYGSNPI------------GFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTT--VDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKI-YIFRKNRFWLLEDNTKLSNPNYFDGLPLE--VLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKD-LPLPLDVAYTGLHGKTFFIKGKYFYEFN--NLEMKIVEGG---PKPLTPAWIGC 1795
            YL KYGYL    +D  N       +  D    +AIK  Q+      TG + +  +  +L   RCG PD G   +             +   +R    +K + K +          +     L ++I++Y +  L R +V   +  A  +WA    + + E      + +I I F + +HGD  PFDGP   LAHAFYP  ++      SGDAHFDD+E++  +   G +L  VAVHE GHS+GL HS++  AIMYPFY      + +L  DD  G+Q+IYG+ +    +      P    I+  P   T AP +  K   CD     D I+   E   Y F G+  W I  +   T         G   ++ +WP L    D ID    R   K+ +I + ++FW+ ++ T L        LPL    L L + L  +D   +W  N  IY   G +YW+ +        +   YPR I   W   +P  +  A    + K++F KG  ++  +  +  +K++E     P+ +   W+ C
Sbjct:    1 YLTKYGYLS--PIDPRNG-----KIRTDKELKTAIKTLQRFGGFKATGDIEDPHLVDLLNRSRCGMPDVGPADVYKRKRRYLLQGSTWRTTVRQILTSKLLYKELWHETRARQNNRISFSTLKYRIENY-TPDLPREEVDNAIRNALAMWAAVTPLTFIEVYDPRIEVEIRIRFVTGDHGDGYPFDGPGGTLAHAFYPHDNTG----LSGDAHFDDEEYFTLRTDHGIDLFWVAVHEFGHSLGLDHSSNVDAIMYPFYRGYVP-DFQLHYDDKAGVQAIYGTKT---SITAKTVEPVTPTIHVDP---TEAPGVADK---CDPKGYFDTIVQTEEGYSYAFRGEYFWPIGDTGAWT---------GALKISDFWPGLQGVKD-IDAAFYRNQDKVTFIIKGDKFWMFKNRTPLEGKQ---ALPLSDPELALDSELVGMDAALQWAKNGKIYFFKGDRYWRYDPYK---KLIDVGYPRLIQEGWNGAVPDNIQAAMQWKNQKSYFFKGNVYWAVDESSFPVKVLEVNPPYPRSIATYWMAC 502          
BLAST of mmp protein vs. Ensembl Nematostella
Match: EDO48363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJE6])

HSP 1 Score: 139.813 bits (351), Expect = 5.660e-37
Identity = 97/280 (34.64%), Postives = 136/280 (48.57%), Query Frame = 2
Query:  239 AMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLK--KDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSI-------PFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYG 1051
            A  YLNKY YL         +P YER    D  ++SAIK+ Q+  ++PQTG ++    +++   RCG PD              SNRA+R    +   +  N    +++   DL+  ++              I   AF  WAK   + +++ T   NDA+++I FGS+ H  +        PFDG    LAHA               DAHFD+DE +     DG NLL VAVHE GH++GL HS  + AIMYP+Y    +  I L  DDI G+QS+YG
Sbjct:   26 ARKYLNKYRYL---------APSYERGGNHD--FTSAIKQMQRFAHIPQTGVVDAATFRLMHTPRCGMPDKSQGK---------SNRARRYSTNIANRHSQNNLKYYVQHGADLSADLQD------------QIFATAFQHWAKVSSLTFSQ-TSILNDANLLISFGSRNHKGTAREPICTDPFDGEGGTLAHASLA----------GADAHFDEDETFTHNSYDGVNLLWVAVHEFGHNLGLDHSDVQGAIMYPYYTG-YDPKIALHSDDIKGVQSLYG 261          
BLAST of mmp protein vs. Ensembl Nematostella
Match: EDO44847 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUF6])

HSP 1 Score: 135.961 bits (341), Expect = 1.569e-36
Identity = 85/237 (35.86%), Postives = 122/237 (51.48%), Query Frame = 2
Query:  344 SAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEH-GDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYG 1051
            +A++KFQ    LP TG ++      +   RCG PD   N +                 R++RY       KW+KK LT+ I       L +P    +  +A + WA+   ++++    + N AD+ I FG K H G + PFDGP  VLAHAF+P           G AHFD+DE + +    G NLL VA HE GHS+GL HS  ++AIM+P+Y      ++ L  DDI G++S+YG
Sbjct:   19 TALEKFQSFAGLPVTGEIDASTIAQMKMPRCGMPDVDDNGL-----------------RIRRY---KRGPKWMKKHLTYHISH--GSDLPKPVQDGVFAKALDYWARVSGLSFSRTMDFQN-ADLRISFGYKSHSGCASPFDGPGGVLAHAFFP---------HDGRAHFDEDENFTDGTSQGTNLLWVATHEFGHSLGLDHSNVQSAIMFPYY-GLYRPDLDLHEDDIQGIRSLYG 222          
BLAST of mmp protein vs. Ensembl Medaka
Match: ENSORLT00000044490.1 (matrix metalloproteinase-17 [Source:NCBI gene;Acc:105355263])

HSP 1 Score: 226.868 bits (577), Expect = 1.363e-65
Identity = 164/528 (31.06%), Postives = 250/528 (47.35%), Query Frame = 2
Query:  248 YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYP--SKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDI--DDINGMQSIYG---SASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERK-DQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
            +L+K+GYL  P  D +        L      + AIK  QK   L +TG  +     ++   RC  PD                + +  L R +R     PQ KW K+ LTW+++++P  S  L R  VRA+M  A  +W+    +N+ E  G  NDADI I+F   +H D  PFDGP   +AHAF+P    +     +GD HFDDDE W  +  D  G +L AVAVHE GH++GL H+++  +IM P+Y  P    +K D+  +D   +  +YG   + S+  +            +  LP+  +         D C +  DA+  IR  E + F GK  WR+   K + S     LR  P  ++ +W  LP  LD +D   ER  D KI  F+  ++W+ +DN  +    Y    P+   GLP  +E +D  F W +N   Y     ++W+ ++        YP+   SI  +WK LP  LD A     G ++F KGK +++     M++  G P+ +   W+ C +
Sbjct:   47 WLSKFGYL--PPADPVTG-----QLQTKEALTKAIKAMQKFGGLKETGVFDQATLGLMKTPRCSLPDV--------------PQVEATLGRKRRSV--TPQNKWNKRHLTWRVRTFPKDSALLGRDTVRALMYYALKVWSDIAPLNFHEVAG--NDADIQIDFTKADHNDGYPFDGPGGTVAHAFFPGERFT-----AGDTHFDDDEAWTFRSPDSHGMDLFAVAVHEFGHAIGLVHTSAMESIMRPYYQGPVGDPLKYDLPYEDKVRVWQLYGVRDTVSHTNQPGNPSQTAEPPVLLDLPENKSTLLLTGDVPDRCTSHFDAVAQIRG-EAFFFKGKYFWRLTREKHLVS-----LR--PAQIHRFWRGLPTNLDSVDAVYERPGDHKIVFFKGLKYWVFKDN--IVEEGY--PRPISDFGLP--VEAVDAAFVWLHNDKTYFFKDNRFWRYDDHLRRMDLGYPK--DSI--LWKGLPSELDDAMRWSDGSSYFFKGKEYWQVPGSNMEVEAGSPRLIAKDWLFCTE 526          
BLAST of mmp protein vs. Ensembl Medaka
Match: mmp17a (matrix metalloproteinase-17 [Source:NCBI gene;Acc:101155447])

HSP 1 Score: 224.942 bits (572), Expect = 6.755e-65
Identity = 159/528 (30.11%), Postives = 246/528 (46.59%), Query Frame = 2
Query:  248 YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYP--SKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDI--DDINGMQSIYG---SASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERK-DQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
            +L+K+GYL  P             L      + AIK  QK   L  TG L+     ++   RC  PD     +      R+ ++                Q KW K+ L+W+++++P  S  L R  VRA+M  A  +W+    +N+ E  G  NDADI I+F   +H D  PFDGP   +AHAF+P    +     +GD HFDDDE W  +  +  G +L AVAVHE GH++GL H+++  +IM P+Y  P    +K D+  +D   +  +YG   S SY  +       P+   +  LP   +    +    D C +  DA+  IR  E + F GK  WR+   K + S     LR  P  ++ +W  LP  LD +D   ER  D KI  F+  ++W+ +DN      N  +G P  +      +E +D  F W +N   Y     ++W+ ++        YP+   SI  +WK LP  LD A     G ++F  GK +++    +M++  G P+ +   W+ C +
Sbjct:   42 WLSKFGYLPPPD-------PVTGQLQTKEALTRAIKAMQKFGGLKVTGLLDQATLGLMKTPRCSLPDVSEMDVASRRRRRSPSQ----------------QNKWNKRHLSWRVRTFPKDSALLGRDTVRALMYYALKVWSDIAPLNFHEVAG--NDADIQIDFTKADHNDGYPFDGPGGTVAHAFFPGERFT-----AGDTHFDDDEAWTFRSPESHGMDLFAVAVHEFGHAIGLVHTSAMESIMRPYYQGPVGDPLKYDLPYEDKVRVWQLYGVRDSVSYTNQPGGASQTPDPPVLLDLPDNRSTPLLVQDAPDRCTSRFDAVAQIRG-EAFFFKGKYFWRLTREKHLVS-----LR--PAQIHRFWKGLPPNLDSVDAVYERPGDHKIVFFKGLKYWVFKDN------NVEEGYPRPITDFGLPVEAVDAAFVWQHNDKTYFFKDNQFWRYDDHLRHMDMGYPK--DSI--LWKGLPPHLDDAMRWSDGSSYFFNGKEYWQVPGSDMEVEAGSPRLIAKDWLFCTE 521          
BLAST of mmp protein vs. Ensembl Medaka
Match: mmp24 (matrix metallopeptidase 24 [Source:NCBI gene;Acc:100125421])

HSP 1 Score: 221.861 bits (564), Expect = 1.752e-63
Identity = 170/542 (31.37%), Postives = 252/542 (46.49%), Query Frame = 2
Query:  239 AMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWA-----KHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWV--EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASY-------------NKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHG-KTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
            A  +L  YGYL+ P  +  +  E E+++       SA+   Q+ + +P TG L+    + +   RCG PD             TS R     +R KRY +     KW +K +++ I +Y  K   +   RAI  +AF++W         ++ Y+E      +ADI+I F S  HGDS PFDG    LAHA++P           GD HFD DE W       DG +L  VAVHELGH++GL HS   +AIM PFY      + +L +DD+ G+Q IYG  +               +         +       P     A P N K + CD   + +   R  E++VF  +  WR+  +K    +        P  ++ +W  LP    +ID   ER D K   F+ ++FW+ ++ +  + P Y   L LE LG     E IDT  RW+     Y   G +YW+ NE   E   V P YP+ I SVWK +P     A+    G  T+F KGK +++F+N ++ +  G PK +   W+GC +
Sbjct:   55 AKTWLRNYGYLR-PHNNQTSDLEQEKAM------HSALAAMQRFYGIPVTGILDETTMQWMWTPRCGVPD----------QPHTSRR-----QRNKRYALTG--QKWREKKISYSISNYTPKVGQKDTQRAIR-QAFSVWQMVTPLSFQEVPYSEIKKEGKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGAGIG------GDTHFDSDEPWTLGNPSSDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMDTRDFQLPLDDLQGIQKIYGVPTAMLEPTRPLPTLPSRRTHSTSDRKHDRNSRPARPHSDRPALPGNGKPNVCDGNFNTVAFFRR-EMFVFKDRWFWRLRNNKVQEGY--------PMQIDQFWKGLPP---RIDAAYERSDGKFVFFKGDKFWVFKEVS--AEPGYPQSL-LE-LGRSLPKEGIDTALRWEPVGKTYFFKGDQYWRYNE---ERSTVDPGYPKPI-SVWKGIPEAPQGAFINRDGYYTYFYKGKDYWKFDNQKLTVEPGYPKSILRDWMGCDQ 545          
BLAST of mmp protein vs. Ensembl Medaka
Match: ENSORLT00000013798.2 (matrix metalloproteinase-17 [Source:NCBI gene;Acc:105355263])

HSP 1 Score: 219.164 bits (557), Expect = 3.891e-63
Identity = 162/527 (30.74%), Postives = 245/527 (46.49%), Query Frame = 2
Query:  248 YLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYP--SKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRD--GRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDI--DDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKID--FCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERK-DQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
            +L+K+GYL  P  D +        L      + AIK  QK   L +TG  +     ++   RC  PD                + +  L R +R     PQ KW K+ LTW+++++P  S  L R  VRA+M  A  +W+    +N+ E  G  NDADI I+F   +H D  PFDGP   +AHAF+P    +     +GD HFDDDE W  +  D  G +L AVAVHE GH++GL H+++  +IM P+Y  P    +K D+  +D   +  +YG                          +    P+ + I    C +  DA+  IR  E + F GK  WR+   K + S     LR  P  ++ +W  LP  LD +D   ER  D KI  F+  ++W+ +DN  +    Y    P+   GLP  +E +D  F W +N   Y     ++W+ ++        YP+   SI  +WK LP  LD A     G ++F KGK +++     M++  G P+ +   W+ C +
Sbjct:   15 WLSKFGYL--PPADPVTG-----QLQTKEALTKAIKAMQKFGGLKETGVFDQATLGLMKTPRCSLPDV--------------PQVEATLGRKRRSV--TPQNKWNKRHLTWRVRTFPKDSALLGRDTVRALMYYALKVWSDIAPLNFHEVAG--NDADIQIDFTKADHNDGYPFDGPGGTVAHAFFPGERFT-----AGDTHFDDDEAWTFRSPDSHGMDLFAVAVHEFGHAIGLVHTSAMESIMRPYYQGPVGDPLKYDLPYEDKVRVWQLYGVRD---------------------TVSHTNQPVKEYIQDYRCTSHFDAVAQIRG-EAFFFKGKYFWRLTREKHLVS-----LR--PAQIHRFWRGLPTNLDSVDAVYERPGDHKIVFFKGLKYWVFKDN--IVEEGY--PRPISDFGLP--VEAVDAAFVWLHNDKTYFFKDNRFWRYDDHLRRMDLGYPK--DSI--LWKGLPSELDDAMRWSDGSSYFFKGKEYWQVPGSNMEVEAGSPRLIAKDWLFCTE 472          
BLAST of mmp protein vs. Ensembl Medaka
Match: mmp24 (matrix metallopeptidase 24 [Source:NCBI gene;Acc:100125421])

HSP 1 Score: 216.468 bits (550), Expect = 3.851e-62
Identity = 161/507 (31.76%), Postives = 236/507 (46.55%), Query Frame = 2
Query:  344 SAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWA-----KHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWV--EQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASY-------------NKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHG-KTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKK 1801
            SA+   Q+ + +P TG L+    + +   RCG PD             TS R     +R KRY +     KW +K +++ I +Y  K   +   RAI  +AF++W         ++ Y+E      +ADI+I F S  HGDS PFDG    LAHA++P           GD HFD DE W       DG +L  VAVHELGH++GL HS   +AIM PFY      + +L +DD+ G+Q IYG  +               +         +       P     A P N K + CD   + +   R  E++VF  +  WR+  +K    +        P  ++ +W  LP    +ID   ER D K   F+ ++FW+ ++ +  + P Y   L LE LG     E IDT  RW+     Y   G +YW+ NE   E   V P YP+ I SVWK +P     A+    G  T+F KGK +++F+N ++ +  G PK +   W+GC +
Sbjct:    3 SALAAMQRFYGIPVTGILDETTMQWMWTPRCGVPD----------QPHTSRR-----QRNKRYALTG--QKWREKKISYSISNYTPKVGQKDTQRAIR-QAFSVWQMVTPLSFQEVPYSEIKKEGKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGAGIG------GDTHFDSDEPWTLGNPSSDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMDTRDFQLPLDDLQGIQKIYGVPTAMLEPTRPLPTLPSRRTHSTSDRKHDRNSRPARPHSDRPALPGNGKPNVCDGNFNTVAFFRR-EMFVFKDRWFWRLRNNKVQEGY--------PMQIDQFWKGLPP---RIDAAYERSDGKFVFFKGDKFWVFKEVS--AEPGYPQSL-LE-LGRSLPKEGIDTALRWEPVGKTYFFKGDQYWRYNE---ERSTVDPGYPKPI-SVWKGIPEAPQGAFINRDGYYTYFYKGKDYWKFDNQKLTVEPGYPKSILRDWMGCDQ 465          
BLAST of mmp protein vs. Planmine SMEST
Match: SMESG000069202.1 (SMESG000069202.1)

HSP 1 Score: 1212.59 bits (3136), Expect = 0.000e+0
Identity = 600/600 (100.00%), Postives = 600/600 (100.00%), Query Frame = 2
Query:    8 SGCLNNESSDAQHPKCTREMFMQFTLIVSYKIHSQNVYTFTLFDFPELIHIDHEMINFIFTGLCLICYSINALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKKYS 1807
            SGCLNNESSDAQHPKCTREMFMQFTLIVSYKIHSQNVYTFTLFDFPELIHIDHEMINFIFTGLCLICYSINALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLPPVPDVPNNIPIYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKKYS
Sbjct:   56 SGCLNNESSDAQHPKCTREMFMQFTLIVSYKIHSQNVYTFTLFDFPELIHIDHEMINFIFTGLCLICYSINALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLPPVPDVPNNIPIYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKKYS 655          
BLAST of mmp protein vs. Planmine SMEST
Match: SMESG000069202.1 (SMESG000069202.1)

HSP 1 Score: 1170.61 bits (3027), Expect = 0.000e+0
Identity = 584/600 (97.33%), Postives = 584/600 (97.33%), Query Frame = 2
Query:    8 SGCLNNESSDAQHPKCTREMFMQFTLIVSYKIHSQNVYTFTLFDFPELIHIDHEMINFIFTGLCLICYSINALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGKYFYEFNNLEMKIVEGGPKPLTPAWIGCKKYS 1807
            SGCLNNESSDAQHPKCTREMFMQFTLIVSYKIHSQNVYTFTLFDFPELIHIDHEMINFIFTGLCLICYSINALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLPPVPDVPNNIPIYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIK                GGPKPLTPAWIGCKKYS
Sbjct:   56 SGCLNNESSDAQHPKCTREMFMQFTLIVSYKIHSQNVYTFTLFDFPELIHIDHEMINFIFTGLCLICYSINALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLPPVPDVPNNIPIYTLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKTVTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFWLLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYKYWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIK----------------GGPKPLTPAWIGCKKYS 639          
BLAST of mmp protein vs. Planmine SMEST
Match: SMESG000049445.1 (SMESG000049445.1)

HSP 1 Score: 128.642 bits (322), Expect = 6.103e-31
Identity = 94/302 (31.13%), Postives = 137/302 (45.36%), Query Frame = 2
Query:  170 MINFIFTGLCLICYSINALSPHRA------MLYLNKYGYLQLPRLDYLNSPEYERSLIMD-GNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIK-LDIDDINGMQSIYG 1051
            +I +I     ++  S+ A +P  +       +YL KYGY+ +P  + +N   + RS ++D    S  IK FQ+   L  TG L+ +  K     RCG  D           I+T +                   KW +K+L +K     ++ L    VR  +  AFN WA+   + +TE        + I++F    H D  PFDG +  LAHAF+P           G  HFD DE + E    G NL  VA HE+GH++GL HS    A+M  FY   T+ N+  L+ DD   +Q IYG
Sbjct:    8 LIKWILIFGNVVSVSVAATTPSPSSRKLFGQMYLVKYGYISIP--EKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD-----------IQTRSMFG----------------KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFD-EEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPT---------DGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQKIQQIYG 270          
BLAST of mmp protein vs. Planmine SMEST
Match: SMESG000049445.1 (SMESG000049445.1)

HSP 1 Score: 126.331 bits (316), Expect = 2.732e-30
Identity = 89/271 (32.84%), Postives = 125/271 (46.13%), Query Frame = 2
Query:  245 LYLNKYGYLQLPRLDYLNSPEYERSLIMD-GNYSSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVNPTEGNIK-LDIDDINGMQSIYG 1051
            +YL KYGY+ +P  + +N   + RS ++D    S  IK FQ+   L  TG L+ +  K     RCG  D           I+T +                   KW +K+L +K     ++ L    VR  +  AFN WA+   + +TE        + I++F    H D  PFDG +  LAHAF+P           G  HFD DE + E    G NL  VA HE+GH++GL HS    A+M  FY   T+ N+  L+ DD   +Q IYG
Sbjct:    1 MYLVKYGYISIP--EKVNQTGFGRSTLLDPKEVSDGIKLFQQKNGLKVTGILDEETRKKFELPRCGVKD-----------IQTRSMFG----------------KWKQKNLKYKFVGPVTQYLTMSAVREAIQSAFNYWAEVTPLTFTEVFD-EEKTNFILKFSRYSHDDEFPFDGRDGTLAHAFFPT---------DGRIHFDSDEIFTEGEERGYNLRIVAAHEIGHALGLPHSYDSEALMASFYAGYTDKNMPLLNEDDKQKIQQIYG 232          
BLAST of mmp protein vs. Planmine SMEST
Match: SMESG000014326.1 (SMESG000014326.1)

HSP 1 Score: 87.0409 bits (214), Expect = 8.456e-18
Identity = 82/312 (26.28%), Postives = 130/312 (41.67%), Query Frame = 2
Query:  341 SSAIKKFQKTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRILKRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAKHVDINYTEETGYYNDADIIIEFGSKEHG------------DSIPFDG-PNYVLAHAFYPIGSSSPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETAIMYPFYVN-PTEGNIKLDIDDINGMQSIYGSASYNKRLXXXXXXXXXXXXYTLPKYTTVAPPINKKIDFCDTT-VDAIITIREVEIYVFSG 1231
            S A+K  QK   LP  G +  ++   +   RCG  D       +N     + ++K    +  R+YI + +              +P+  ++  +++  +  A N W+   DI Y  +      +   + F   EH             D  P D  P  VLAHAF+P         +SG+ HFD  E W E   DG NL  VA HE+GH++GL HS    A+M P+Y    +E + +L  DD  G  S+YG+    KR             +            N+K + C+TT +++     +  +YV +G
Sbjct:   46 SDAVKNIQKMAGLPTDGKITKELLAHVEKSRCGGKDSKKKSKRYN-----AAQSKWDKGQTYRFYIHDER--------------HPTT-MSLGEIQRALIIALNYWSTAADI-YFGKVSSKQGSMFSLSFADAEHKMYDVHNNFAESRDPYPLDNVPGNVLAHAFFP---------KSGNLHFDSAEEWTEGKDDGINLRVVAAHEMGHAIGLYHSNDPKALMAPWYGGYISESDFRLPDDDSQGAISLYGNTKNGKR-------------FVRSDRAKREQSSNQK-ELCNTTNINSAFQFADGHVYVVTG 313          
The following BLAST results are available for this feature:
BLAST of mmp protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MMP253.787e-6931.38matrix metallopeptidase 25 [Source:HGNC Symbol;Acc... [more]
MMP164.600e-6129.62matrix metallopeptidase 16 [Source:HGNC Symbol;Acc... [more]
MMP175.798e-5928.74matrix metallopeptidase 17 [Source:HGNC Symbol;Acc... [more]
MMP241.292e-5729.77matrix metallopeptidase 24 [Source:HGNC Symbol;Acc... [more]
MMP172.356e-5728.66matrix metallopeptidase 17 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of mmp protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zmp-56.586e-3926.51Zinc MetalloProtease [Source:UniProtKB/TrEMBL;Acc... [more]
zmp-37.734e-3434.26Matrix metalloproteinase-C [Source:UniProtKB/Swis... [more]
zmp-21.564e-2630.42Matrix metalloproteinase-B [Source:UniProtKB/Swis... [more]
zmp-61.356e-2335.15MMP-like protein; Zinc MetalloProtease [Source:Un... [more]
zmp-22.320e-2332.54Matrix metalloproteinase-B [Source:UniProtKB/Swis... [more]
back to top
BLAST of mmp protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mmp13.353e-6030.67gene:FBgn0035049 transcript:FBtr0306656[more]
Mmp13.353e-6030.67gene:FBgn0035049 transcript:FBtr0304010[more]
Mmp15.682e-6030.49gene:FBgn0035049 transcript:FBtr0304009[more]
Mmp15.682e-6030.49gene:FBgn0035049 transcript:FBtr0304011[more]
Mmp16.015e-6030.49gene:FBgn0035049 transcript:FBtr0304006[more]
back to top
BLAST of mmp protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mmp17a4.827e-7331.32matrix metallopeptidase 17a [Source:ZFIN;Acc:ZDB-G... [more]
mmp16b2.038e-6031.14matrix metallopeptidase 16b (membrane-inserted) [S... [more]
mmp17a2.451e-6029.82matrix metallopeptidase 17a [Source:ZFIN;Acc:ZDB-G... [more]
mmp245.495e-5930.47matrix metallopeptidase 24 [Source:ZFIN;Acc:ZDB-GE... [more]
mmp25a1.104e-5829.32matrix metallopeptidase 25a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of mmp protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mmp172.863e-6529.17matrix metallopeptidase 17 [Source:NCBI gene;Acc:1... [more]
mmp171.063e-6429.58matrix metallopeptidase 17 [Source:NCBI gene;Acc:1... [more]
mmp141.717e-6232.19matrix metallopeptidase 14 [Source:NCBI gene;Acc:5... [more]
mmp142.583e-6232.19matrix metallopeptidase 14 [Source:NCBI gene;Acc:5... [more]
trim145.379e-6129.48tripartite motif containing 14 [Source:Xenbase;Acc... [more]
back to top
BLAST of mmp protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mmp252.419e-7332.38matrix metallopeptidase 25 [Source:MGI Symbol;Acc:... [more]
Mmp162.482e-6029.84matrix metallopeptidase 16 [Source:MGI Symbol;Acc:... [more]
Mmp176.261e-6029.22matrix metallopeptidase 17 [Source:MGI Symbol;Acc:... [more]
Mmp241.165e-5730.29matrix metallopeptidase 24 [Source:MGI Symbol;Acc:... [more]
Mmp149.262e-5631.64matrix metallopeptidase 14 (membrane-inserted) [So... [more]
back to top
BLAST of mmp protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3U435|MMP25_MOUSE1.692e-7232.38Matrix metalloproteinase-25 OS=Mus musculus OX=100... [more]
sp|Q9NPA2|MMP25_HUMAN1.819e-6831.38Matrix metalloproteinase-25 OS=Homo sapiens OX=960... [more]
sp|P51512|MMP16_HUMAN2.209e-6029.62Matrix metalloproteinase-16 OS=Homo sapiens OX=960... [more]
sp|Q9WTR0|MMP16_MOUSE1.736e-5929.84Matrix metalloproteinase-16 OS=Mus musculus OX=100... [more]
sp|Q9R0S3|MMP17_MOUSE4.379e-5929.22Matrix metalloproteinase-17 OS=Mus musculus OX=100... [more]
back to top
BLAST of mmp protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K0JB920.000e+0100.00Mmp protein OS=Schmidtea mediterranea OX=79327 GN=... [more]
A0A158QRZ41.352e-16147.07Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3EM842.300e-16147.07Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068WAJ78.027e-16046.68Matrix metallopeptidase 7 M10 family OS=Echinococc... [more]
W6U5D01.488e-15946.86Matrix metalloproteinase-25 OS=Echinococcus granul... [more]
back to top
BLAST of mmp protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mmp17a2.468e-6629.91matrix metallopeptidase 17 [Source:NCBI gene;Acc:1... [more]
mmp16b1.676e-5729.21matrix metalloproteinase-16-like [Source:NCBI gene... [more]
mmp245.304e-5529.54matrix metallopeptidase 24 [Source:NCBI gene;Acc:1... [more]
mmp14a2.679e-5429.93matrix metallopeptidase 14 [Source:NCBI gene;Acc:1... [more]
mmp25b1.925e-5131.05matrix metallopeptidase 25b [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of mmp protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001966.14.651e-5327.65pep scaffold:Pmarinus_7.0:GL476330:946825:981591:-... [more]
mmp193.504e-4629.34matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GE... [more]
MMP146.031e-4529.60matrix metallopeptidase 14 [Source:HGNC Symbol;Acc... [more]
mmp191.175e-4326.80matrix metallopeptidase 19 [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000005331.19.949e-4230.14pep scaffold:Pmarinus_7.0:GL476741:9169:28768:-1 g... [more]
back to top
BLAST of mmp protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of mmp protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO411671.013e-5828.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486062.261e-5430.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485026.026e-4728.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483635.660e-3734.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448471.569e-3635.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of mmp protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000044490.11.363e-6531.06matrix metalloproteinase-17 [Source:NCBI gene;Acc:... [more]
mmp17a6.755e-6530.11matrix metalloproteinase-17 [Source:NCBI gene;Acc:... [more]
mmp241.752e-6331.37matrix metallopeptidase 24 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000013798.23.891e-6330.74matrix metalloproteinase-17 [Source:NCBI gene;Acc:... [more]
mmp243.851e-6231.76matrix metallopeptidase 24 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of mmp protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069202.10.000e+0100.00SMESG000069202.1[more]
SMESG000069202.10.000e+097.33SMESG000069202.1[more]
SMESG000049445.16.103e-3131.13SMESG000049445.1[more]
SMESG000049445.12.732e-3032.84SMESG000049445.1[more]
SMESG000014326.18.456e-1826.28SMESG000014326.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30014263
GenBankCCC86590.3
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014263 ID=SMED30014263|Name=mmp protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1918bp
GTAAAGATCTGGTTGTTTGAACAATGAATCAAGTGATGCCCAGCATCCTA
AATGCACACGTGAAATGTTTATGCAATTCACGTTGATTGTGTCATATAAA
ATTCACAGTCAGAACGTTTATACATTCACTTTATTCGACTTTCCAGAACT
TATACATATTGACCACGAAATGATAAATTTTATTTTTACTGGTCTATGTT
TGATTTGTTACAGTATCAATGCTCTTTCGCCTCATAGGGCTATGTTATAC
CTGAATAAATATGGATACCTGCAACTTCCTAGATTGGACTACCTAAATAG
TCCTGAATATGAAAGATCATTAATTATGGATGGTAATTACAGTAGTGCTA
TTAAAAAGTTTCAAAAGACTTTCAATCTACCACAAACCGGATTTTTAAAC
ACTAAAATTGCAAAAATGCTGGTTGCAAAGAGATGCGGAAATCCTGATTA
CGGCTCCAATCCGATTGGATTTAATGTGAATATCAGAACGTCCAATCGAG
CGAAACGAATTTTGAAACGGGTCAAACGATATTATATCGACAATCCTCAA
ATGAAATGGTTGAAAAAAGATCTCACTTGGAAAATAAAATCTTATCCTTC
AAAAGGCCTTAATCGGCCTCAAGTACGTGCTATTATGACACGGGCTTTTA
ATTTGTGGGCAAAACATGTTGACATAAATTATACCGAAGAAACTGGTTAT
TACAATGATGCTGATATTATAATCGAATTTGGATCAAAGGAGCACGGAGA
TTCAATTCCATTTGACGGACCAAATTATGTACTAGCACACGCGTTTTATC
CAATTGGATCATCAAGTCCACCTTATAGTAGATCAGGTGACGCTCATTTT
GATGATGATGAGTTTTGGGTGGAGCAGGGTCGAGATGGCAGAAATTTATT
GGCAGTCGCTGTACACGAACTTGGTCATTCTATGGGTCTAGGGCATTCTG
CTTCAGAAACTGCAATAATGTATCCTTTTTATGTGAATCCTACAGAAGGG
AACATAAAATTAGATATCGATGATATAAATGGAATGCAGAGCATTTATGG
TTCTGCATCATATAATAAAAGGTTACCACCAGTTCCCGACGTTCCAAACA
ATATTCCAATTTATACATTACCAAAGTACACCACAGTTGCACCCCCAATA
AATAAAAAAATCGATTTTTGTGACACTACAGTCGATGCCATTATCACTAT
TCGGGAGGTAGAAATTTATGTTTTCAGTGGCAAGCTGCAGTGGCGAATAG
ATTTCTCTAAGACTGTCACGTCTTGGATTTCTTATGAACTTCGAGATGGT
CCTGAAGATTTAAACTACTACTGGCCGATATTGCCAAAAACCTTAGACAA
AATTGATGGAGGCATAGAAAGAAAAGATCAAAAGATTTATATATTCAGAA
AAAATCGATTCTGGTTATTGGAAGACAACACAAAATTGTCAAATCCAAAT
TATTTTGATGGTCTGCCCTTAGAAGTCCTAGGGCTTCCTGCAAACTTGGA
AAAAATCGACACAATATTTCGATGGGATTACAATAAAGCCATATACATAA
TGGCGGGTTACAAATACTGGAAAATAAATGAAGCCTCTGGAGAATTCGGA
TACGTTTATCCAAGATATCCTAGATCCATTCATTCAGTGTGGAAAGACTT
ACCCTTACCACTCGATGTTGCTTATACAGGATTGCATGGGAAAACGTTTT
TTATCAAAGGTAAATATTTCTATGAGTTCAACAATTTGGAAATGAAAATT
GTTGAAGGCGGCCCAAAGCCGTTAACGCCAGCTTGGATCGGATGTAAGAA
ATACAGTTGATTCTAGGACTTTGTACGCATTTAATTGTCATTGGAGTATA
CAAATACAAATATAATTTCAGTGATAAATTTAAATTAGATTTAGTGAAAA
AAAGCCAAAAGAAAAAAA
back to top

protein sequence of SMED30014263-orf-1

>SMED30014263-orf-1 ID=SMED30014263-orf-1|Name=SMED30014263-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=582bp
MFMQFTLIVSYKIHSQNVYTFTLFDFPELIHIDHEMINFIFTGLCLICYS
INALSPHRAMLYLNKYGYLQLPRLDYLNSPEYERSLIMDGNYSSAIKKFQ
KTFNLPQTGFLNTKIAKMLVAKRCGNPDYGSNPIGFNVNIRTSNRAKRIL
KRVKRYYIDNPQMKWLKKDLTWKIKSYPSKGLNRPQVRAIMTRAFNLWAK
HVDINYTEETGYYNDADIIIEFGSKEHGDSIPFDGPNYVLAHAFYPIGSS
SPPYSRSGDAHFDDDEFWVEQGRDGRNLLAVAVHELGHSMGLGHSASETA
IMYPFYVNPTEGNIKLDIDDINGMQSIYGSASYNKRLPPVPDVPNNIPIY
TLPKYTTVAPPINKKIDFCDTTVDAIITIREVEIYVFSGKLQWRIDFSKT
VTSWISYELRDGPEDLNYYWPILPKTLDKIDGGIERKDQKIYIFRKNRFW
LLEDNTKLSNPNYFDGLPLEVLGLPANLEKIDTIFRWDYNKAIYIMAGYK
YWKINEASGEFGYVYPRYPRSIHSVWKDLPLPLDVAYTGLHGKTFFIKGK
YFYEFNNLEMKIVEGGPKPLTPAWIGCKKYS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000136whole organism
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036375Hemopexin-like_dom_sf
IPR033739M10A_MMP
IPR036365PGBD-like_sf
IPR021190Pept_M10A
IPR018487Hemopexin-like_repeat
IPR006026Peptidase_Metallo
IPR016293Pept_M10A_stromelysin-type
IPR000585Hemopexin-like_dom
IPR002477Peptidoglycan-bd-like
IPR001818Pept_M10_metallopeptidase
IPR024079MetalloPept_cat_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004222metalloendopeptidase activity
GO:0008270zinc ion binding
GO:0008237metallopeptidase activity
GO:0005509calcium ion binding
GO:0008233peptidase activity
GO:0016787hydrolase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0031012extracellular matrix
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 578..581
NoneNo IPR availablePANTHERPTHR10201:SF248coord: 62..334
coord: 343..578
NoneNo IPR availablePANTHERPTHR10201MATRIX METALLOPROTEINASEcoord: 343..578
NoneNo IPR availablePANTHERPTHR10201MATRIX METALLOPROTEINASEcoord: 62..334
NoneNo IPR availableSUPERFAMILYSSF55486Metalloproteases ("zincins"), catalytic domaincoord: 143..328
IPR021190Peptidase M10APRINTSPR00138MATRIXINcoord: 119..132
score: 38.68
coord: 191..206
score: 22.26
coord: 281..306
score: 61.44
coord: 316..329
score: 55.49
coord: 216..244
score: 61.23
IPR021190Peptidase M10APIRSFPIRSF001191MMP_stromelysincoord: 29..581
e-value: 1.2E-107
score: 358.4
IPR006026Peptidase, metallopeptidaseSMARTSM00235col_5coord: 161..330
e-value: 6.3E-36
score: 135.4
IPR018487Hemopexin-like repeatsSMARTSM00120HX_rpt_3coord: 373..425
e-value: 0.2
score: 20.8
coord: 481..531
e-value: 0.032
score: 23.4
coord: 533..577
e-value: 0.1
score: 21.7
coord: 430..469
e-value: 9.7
score: 8.1
IPR018487Hemopexin-like repeatsPFAMPF00045Hemopexincoord: 541..577
e-value: 2.7E-5
score: 24.0
coord: 373..424
e-value: 2.1E-5
score: 24.4
IPR018487Hemopexin-like repeatsPROSITEPS51642HEMOPEXIN_2coord: 530..577
score: 11.195
IPR018487Hemopexin-like repeatsPROSITEPS51642HEMOPEXIN_2coord: 478..529
score: 12.12
IPR018487Hemopexin-like repeatsPROSITEPS51642HEMOPEXIN_2coord: 370..423
score: 7.859
IPR018487Hemopexin-like repeatsPROSITEPS51642HEMOPEXIN_2coord: 427..474
score: 7.104
IPR036375Hemopexin-like domain superfamilyGENE3DG3DSA:2.110.10.10coord: 362..577
e-value: 8.1E-44
score: 151.9
IPR036375Hemopexin-like domain superfamilySUPERFAMILYSSF50923Hemopexin-like domaincoord: 367..578
IPR024079Metallopeptidase, catalytic domain superfamilyGENE3DG3DSA:3.40.390.10coord: 48..335
e-value: 1.2E-71
score: 242.9
IPR001818Peptidase M10, metallopeptidasePFAMPF00413Peptidase_M10coord: 164..329
e-value: 4.0E-47
score: 160.0
IPR033739Peptidase M10A, catalytic domainCDDcd04278ZnMc_MMPcoord: 164..329
e-value: 5.9506E-66
score: 210.138
IPR036365PGBD-like superfamilySUPERFAMILYSSF47090PGBD-likecoord: 55..129