Oxysterol-binding protein

Overview
NameOxysterol-binding protein
Smed IDSMED30014257
Length (bp)2688
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Oxysterol-binding protein (SMED30014257) t-SNE clustered cells

Violin plots show distribution of expression levels for Oxysterol-binding protein (SMED30014257) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Oxysterol-binding protein (SMED30014257) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Oxysterol-binding protein (SMED30014257) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014257

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30014257SMESG000008795.1 dd_Smed_v4_4931_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014257SMESG000008795.1 dd_Smed_v4_4931_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014257SMESG000008795.1 dd_Smed_v4_4931_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014257SMESG000008795.1 Contig13050uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30014257SMESG000008795.1 Contig13050newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30014257SMESG000008795.1 dd_Smed_v4_4931_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBP2 (oxysterol binding protein 2 [Source:HGNC Symbol;Acc:HGNC:8504])

HSP 1 Score: 435.261 bits (1118), Expect = 1.070e-143
Identity = 211/429 (49.18%), Postives = 284/429 (66.20%), Query Frame = 3
Query: 1269 NTSNIATFSEVIPIRSKRT-RRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETV-----KGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDG--------TKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +  N+   + ++P  S +  RR +IP KPN ++NLWS++KNCIG++LS+IPMPVNF+EP+SMLQRL ED EY  +LDKA  C + +EQ+  VAAF+VSSY+ T +RI KPFNP+LGET+ELDR DD G R   EQ+ HHPPS A +  S   W  W + ++S+KFRGKYI I P+G  HL F+ S  HYVW +   T+HNIIVG++WID  G+++I+N  T D+C L + PYS FS +  ++VTG ++D       VL+G+WDE++E   V+ ++ +      K +T   T  S+ LLW++YPLP N +  YYFS  A+TLNE EE +APTDSR RPDQ+LME+G+WDEAN EK RLEE+QR  R   L+  G         ++    Y PLWF+   DP        + G YWE K K+DW MC  IF
Sbjct:   33 SADNVLDGASLVPKGSSKVKRRVRIPNKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQT-LSAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDWHMCPNIF 460          
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBP2 (oxysterol binding protein 2 [Source:HGNC Symbol;Acc:HGNC:8504])

HSP 1 Score: 436.417 bits (1121), Expect = 7.204e-143
Identity = 211/429 (49.18%), Postives = 284/429 (66.20%), Query Frame = 3
Query: 1269 NTSNIATFSEVIPIRSKRT-RRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETV-----KGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDG--------TKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +  N+   + ++P  S +  RR +IP KPN ++NLWS++KNCIG++LS+IPMPVNF+EP+SMLQRL ED EY  +LDKA  C + +EQ+  VAAF+VSSY+ T +RI KPFNP+LGET+ELDR DD G R   EQ+ HHPPS A +  S   W  W + ++S+KFRGKYI I P+G  HL F+ S  HYVW +   T+HNIIVG++WID  G+++I+N  T D+C L + PYS FS +  ++VTG ++D       VL+G+WDE++E   V+ ++ +      K +T   T  S+ LLW++YPLP N +  YYFS  A+TLNE EE +APTDSR RPDQ+LME+G+WDEAN EK RLEE+QR  R   L+  G         ++    Y PLWF+   DP        + G YWE K K+DW MC  IF
Sbjct:  122 SADNVLDGASLVPKGSSKVKRRVRIPNKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQT-LSAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDWHMCPNIF 549          
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBP2 (oxysterol binding protein 2 [Source:HGNC Symbol;Acc:HGNC:8504])

HSP 1 Score: 438.728 bits (1127), Expect = 1.372e-142
Identity = 211/426 (49.53%), Postives = 283/426 (66.43%), Query Frame = 3
Query: 1278 NIATFSEVIPIRSKRT-RRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETV-----KGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDG--------TKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            N+   + ++P  S +  RR +IP KPN ++NLWS++KNCIG++LS+IPMPVNF+EP+SMLQRL ED EY  +LDKA  C + +EQ+  VAAF+VSSY+ T +RI KPFNP+LGET+ELDR DD G R   EQ+ HHPPS A +  S   W  W + ++S+KFRGKYI I P+G  HL F+ S  HYVW +   T+HNIIVG++WID  G+++I+N  T D+C L + PYS FS +  ++VTG ++D       VL+G+WDE++E   V+ ++ +      K +T   T  S+ LLW++YPLP N +  YYFS  A+TLNE EE +APTDSR RPDQ+LME+G+WDEAN EK RLEE+QR  R   L+  G         ++    Y PLWF+   DP        + G YWE K K+DW MC  IF
Sbjct:  212 NVLDGASLVPKGSSKVKRRVRIPNKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQT-LSAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDWHMCPNIF 636          

HSP 2 Score: 71.2478 bits (173), Expect = 5.560e-12
Identity = 43/134 (32.09%), Postives = 75/134 (55.97%), Query Frame = 3
Query:  411 DNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSS 812
            D   +  D +EL +  +  L+  L+D+    D++ +    LQ+S+ +LD  K  +  GE   KLK + ERAT+FR+++ +++ +C  + E     + KW++ +  E+EQR  +E  +E LAKQH  LE    S+
Sbjct:   12 DEATTPADKSEL-HHTLKNLSLKLDDLSTCNDLIAKHGAALQRSLTELDGLKIPSESGE---KLKVVNERATLFRITSNAMINACRDFLELAEIHSRKWQRALQYEQEQRVHLEETIEQLAKQHNSLERAFHSA 141          
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBP2 (oxysterol binding protein 2 [Source:HGNC Symbol;Acc:HGNC:8504])

HSP 1 Score: 437.187 bits (1123), Expect = 1.375e-142
Identity = 211/429 (49.18%), Postives = 284/429 (66.20%), Query Frame = 3
Query: 1269 NTSNIATFSEVIPIRSKRT-RRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETV-----KGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDG--------TKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +  N+   + ++P  S +  RR +IP KPN ++NLWS++KNCIG++LS+IPMPVNF+EP+SMLQRL ED EY  +LDKA  C + +EQ+  VAAF+VSSY+ T +RI KPFNP+LGET+ELDR DD G R   EQ+ HHPPS A +  S   W  W + ++S+KFRGKYI I P+G  HL F+ S  HYVW +   T+HNIIVG++WID  G+++I+N  T D+C L + PYS FS +  ++VTG ++D       VL+G+WDE++E   V+ ++ +      K +T   T  S+ LLW++YPLP N +  YYFS  A+TLNE EE +APTDSR RPDQ+LME+G+WDEAN EK RLEE+QR  R   L+  G         ++    Y PLWF+   DP        + G YWE K K+DW MC  IF
Sbjct:  161 SADNVLDGASLVPKGSSKVKRRVRIPNKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQT-LSAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDWHMCPNIF 588          
BLAST of Oxysterol-binding protein vs. Ensembl Human
Match: OSBP2 (oxysterol binding protein 2 [Source:HGNC Symbol;Acc:HGNC:8504])

HSP 1 Score: 438.343 bits (1126), Expect = 3.791e-142
Identity = 212/427 (49.65%), Postives = 283/427 (66.28%), Query Frame = 3
Query: 1278 NIATFSEVIPI-RSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETV-----KGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDG---------TKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            N+   + ++P   SK  RR +IP KPN ++NLWS++KNCIG++LS+IPMPVNF+EP+SMLQRL ED EY  +LDKA  C + +EQ+  VAAF+VSSY+ T +RI KPFNP+LGET+ELDR DD G R   EQ+ HHPPS A +  S   W  W + ++S+KFRGKYI I P+G  HL F+ S  HYVW +   T+HNIIVG++WID  G+++I+N  T D+C L + PYS FS +  ++VTG ++D       VL+G+WDE++E   V+ ++ +      K +T   T  S+ LLW++YPLP N +  YYFS  A+TLNE EE +APTDSR RPDQ+LME+G+WDEAN EK RLEE+QR  R   L+  G          ++    Y PLWF+   DP        + G YWE K K+DW MC  IF
Sbjct:  234 NVLDGASLVPKGSSKVKRRVRIPNKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQT-LSAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEAEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDWHMCPNIF 659          

HSP 2 Score: 71.2478 bits (173), Expect = 6.291e-12
Identity = 43/134 (32.09%), Postives = 75/134 (55.97%), Query Frame = 3
Query:  411 DNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSS 812
            D   +  D +EL +  +  L+  L+D+    D++ +    LQ+S+ +LD  K  +  GE   KLK + ERAT+FR+++ +++ +C  + E     + KW++ +  E+EQR  +E  +E LAKQH  LE    S+
Sbjct:   33 DEATTPADKSEL-HHTLKNLSLKLDDLSTCNDLIAKHGAALQRSLTELDGLKIPSESGE---KLKVVNERATLFRITSNAMINACRDFLELAEIHSRKWQRALQYEQEQRVHLEETIEQLAKQHNSLERAFHSA 162          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-1 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7DTF2])

HSP 1 Score: 382.874 bits (982), Expect = 5.411e-124
Identity = 198/410 (48.29%), Postives = 271/410 (66.10%), Query Frame = 3
Query: 1311 RSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVIS---NTETVKGRTYLATEESSI-LLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRV------EILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +  R RRT +P +PN+ +NLWS++KNCIGK+LSKIPMPVNFSEPIS+LQR+ ED EY+++L+  A     +EQ+ YVAA+  S+Y+ T +R NKPFNPLLGET+E DR DD GWR   EQ+ HHPP+ A H E N W  + DF+M+++FRGKY+ + PIG  H++F  +K H+ + +I  T+HNIIVG++WIDNHG+M+I N  T +KC L + PYS FS + P++V G + D       V+ GTWD+ ++   V S   N E  K    L  +E+S+  +W   PLP N +K + F+  AI LNE EE +APTDSR RPDQ+LME G+WDEAN++K  +EE+QR  R       E+    G K    EY+P WF  V D    +  ++F G YWE K +++W  C  IF
Sbjct:   47 KGGRQRRTTVPERPNLPINLWSIMKNCIGKELSKIPMPVNFSEPISVLQRVTEDLEYANLLETGAKLST-LEQMCYVAAYAASNYSTTCHRTNKPFNPLLGETFEFDRMDDLGWRSVTEQVSHHPPAAAHHAEGNGWTMYQDFTMTSRFRGKYLSVIPIGFTHVVFPATKSHFSYRKITTTVHNIIVGKLWIDNHGDMEITNHETNEKCLLKFVPYSYFSREQPRKVYGIVRDAEGIPKYVVQGTWDKSIDMLKVSSWNGNHEKPK----LEVDETSLKRIWTANPLPKNAEKMHNFTKLAIELNEPEEGVAPTDSRLRPDQRLMENGEWDEANRKKLEIEEKQRVVRRRREAEKELAMKKGDK--YEEYEPTWFVRVQDESNGALIHQFKGGYWEAKEQQNWEKCPDIF 449          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-1 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7DTF2])

HSP 1 Score: 388.652 bits (997), Expect = 6.737e-124
Identity = 198/410 (48.29%), Postives = 271/410 (66.10%), Query Frame = 3
Query: 1311 RSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVIS---NTETVKGRTYLATEESSI-LLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRV------EILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +  R RRT +P +PN+ +NLWS++KNCIGK+LSKIPMPVNFSEPIS+LQR+ ED EY+++L+  A     +EQ+ YVAA+  S+Y+ T +R NKPFNPLLGET+E DR DD GWR   EQ+ HHPP+ A H E N W  + DF+M+++FRGKY+ + PIG  H++F  +K H+ + +I  T+HNIIVG++WIDNHG+M+I N  T +KC L + PYS FS + P++V G + D       V+ GTWD+ ++   V S   N E  K    L  +E+S+  +W   PLP N +K + F+  AI LNE EE +APTDSR RPDQ+LME G+WDEAN++K  +EE+QR  R       E+    G K    EY+P WF  V D    +  ++F G YWE K +++W  C  IF
Sbjct:  225 KGGRQRRTTVPERPNLPINLWSIMKNCIGKELSKIPMPVNFSEPISVLQRVTEDLEYANLLETGAKLST-LEQMCYVAAYAASNYSTTCHRTNKPFNPLLGETFEFDRMDDLGWRSVTEQVSHHPPAAAHHAEGNGWTMYQDFTMTSRFRGKYLSVIPIGFTHVVFPATKSHFSYRKITTTVHNIIVGKLWIDNHGDMEITNHETNEKCLLKFVPYSYFSREQPRKVYGIVRDAEGIPKYVVQGTWDKSIDMLKVSSWNGNHEKPK----LEVDETSLKRIWTANPLPKNAEKMHNFTKLAIELNEPEEGVAPTDSRLRPDQRLMENGEWDEANRKKLEIEEKQRVVRRRREAEKELAMKKGDK--YEEYEPTWFVRVQDESNGALIHQFKGGYWEAKEQQNWEKCPDIF 627          

HSP 2 Score: 55.0694 bits (131), Expect = 2.156e-7
Identity = 39/169 (23.08%), Postives = 89/169 (52.66%), Query Frame = 3
Query:  411 DNNDSELDSNELVNGFIL---KLNGHLEDIKKSQDVLYRKLDDLQKSIHD-LDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFE 905
            D   ++ DSN   +  IL   +++G L D++ + +++ ++ D+L ++++  ++ DKNS            + ERA + +++ +++L +   + E     A++  K++  E++++  ++  +E LAKQH  LE   S   +    +++  +QE        D++F+DA E
Sbjct:   28 DAQMAKTDSNR-SDALILANRQMSGKLCDLRTAANMMNKQGDELMRALNGTVETDKNS------------LAERADLLKMTTSAVLQAAEEFVELSEQSAKRLNKIVAVEQKEKALLQEQLEALAKQHSSLERAASKCARGAAPVSVYSDQE--------DDEFHDAEE 175          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-1 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7DTF2])

HSP 1 Score: 389.423 bits (999), Expect = 7.389e-123
Identity = 198/410 (48.29%), Postives = 271/410 (66.10%), Query Frame = 3
Query: 1311 RSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVIS---NTETVKGRTYLATEESSI-LLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRV------EILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +  R RRT +P +PN+ +NLWS++KNCIGK+LSKIPMPVNFSEPIS+LQR+ ED EY+++L+  A     +EQ+ YVAA+  S+Y+ T +R NKPFNPLLGET+E DR DD GWR   EQ+ HHPP+ A H E N W  + DF+M+++FRGKY+ + PIG  H++F  +K H+ + +I  T+HNIIVG++WIDNHG+M+I N  T +KC L + PYS FS + P++V G + D       V+ GTWD+ ++   V S   N E  K    L  +E+S+  +W   PLP N +K + F+  AI LNE EE +APTDSR RPDQ+LME G+WDEAN++K  +EE+QR  R       E+    G K    EY+P WF  V D    +  ++F G YWE K +++W  C  IF
Sbjct:  330 KGGRQRRTTVPERPNLPINLWSIMKNCIGKELSKIPMPVNFSEPISVLQRVTEDLEYANLLETGAKLST-LEQMCYVAAYAASNYSTTCHRTNKPFNPLLGETFEFDRMDDLGWRSVTEQVSHHPPAAAHHAEGNGWTMYQDFTMTSRFRGKYLSVIPIGFTHVVFPATKSHFSYRKITTTVHNIIVGKLWIDNHGDMEITNHETNEKCLLKFVPYSYFSREQPRKVYGIVRDAEGIPKYVVQGTWDKSIDMLKVSSWNGNHEKPK----LEVDETSLKRIWTANPLPKNAEKMHNFTKLAIELNEPEEGVAPTDSRLRPDQRLMENGEWDEANRKKLEIEEKQRVVRRRREAEKELAMKKGDK--YEEYEPTWFVRVQDESNGALIHQFKGGYWEAKEQQNWEKCPDIF 732          

HSP 2 Score: 140.198 bits (352), Expect = 5.588e-34
Identity = 85/271 (31.37%), Postives = 158/271 (58.30%), Query Frame = 3
Query:  117 GYLYKWTNYLKGYQKRWFVL-QNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSEL---DSNELVNGFIL---KLNGHLEDIKKSQDVLYRKLDDLQKSIHD-LDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFE 905
            G+L KWTNYLKGY++RWFVL  N  LSYYRN SE+   CRG+IN+  A+++   +TS ++     QTFH+K QNE + ++WT++L   + KA    +  ++ D+++   DSN   +  IL   +++G L D++ + +++ ++ D+L ++++  ++ DKNS            + ERA + +++ +++L +   + E     A++  K++  E++++  ++  +E LAKQH  LE   S   +    +++  +QE        D++F+DA E
Sbjct:   31 GWLNKWTNYLKGYRQRWFVLDSNATLSYYRNPSEVGHTCRGSINLQEARVHTDKTTSCIVISGQSQTFHVKPQNEMDRQQWTNSLEYMRHKAITRAESEEDEDAQMAKTDSNR-SDALILANRQMSGKLCDLRTAANMMNKQGDELMRALNGTVETDKNS------------LAERADLLKMTTSAVLQAAEEFVELSEQSAKRLNKIVAVEQKEKALLQEQLEALAKQHSSLERAASKCARGAAPVSVYSDQE--------DDEFHDAEE 280          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-1 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7DTF2])

HSP 1 Score: 389.037 bits (998), Expect = 1.895e-122
Identity = 198/410 (48.29%), Postives = 271/410 (66.10%), Query Frame = 3
Query: 1311 RSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVIS---NTETVKGRTYLATEESSI-LLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRV------EILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +  R RRT +P +PN+ +NLWS++KNCIGK+LSKIPMPVNFSEPIS+LQR+ ED EY+++L+  A     +EQ+ YVAA+  S+Y+ T +R NKPFNPLLGET+E DR DD GWR   EQ+ HHPP+ A H E N W  + DF+M+++FRGKY+ + PIG  H++F  +K H+ + +I  T+HNIIVG++WIDNHG+M+I N  T +KC L + PYS FS + P++V G + D       V+ GTWD+ ++   V S   N E  K    L  +E+S+  +W   PLP N +K + F+  AI LNE EE +APTDSR RPDQ+LME G+WDEAN++K  +EE+QR  R       E+    G K    EY+P WF  V D    +  ++F G YWE K +++W  C  IF
Sbjct:  364 KGGRQRRTTVPERPNLPINLWSIMKNCIGKELSKIPMPVNFSEPISVLQRVTEDLEYANLLETGAKLST-LEQMCYVAAYAASNYSTTCHRTNKPFNPLLGETFEFDRMDDLGWRSVTEQVSHHPPAAAHHAEGNGWTMYQDFTMTSRFRGKYLSVIPIGFTHVVFPATKSHFSYRKITTTVHNIIVGKLWIDNHGDMEITNHETNEKCLLKFVPYSYFSREQPRKVYGIVRDAEGIPKYVVQGTWDKSIDMLKVSSWNGNHEKPK----LEVDETSLKRIWTANPLPKNAEKMHNFTKLAIELNEPEEGVAPTDSRLRPDQRLMENGEWDEANRKKLEIEEKQRVVRRRREAEKELAMKKGDK--YEEYEPTWFVRVQDESNGALIHQFKGGYWEAKEQQNWEKCPDIF 766          

HSP 2 Score: 140.584 bits (353), Expect = 4.852e-34
Identity = 85/271 (31.37%), Postives = 158/271 (58.30%), Query Frame = 3
Query:  117 GYLYKWTNYLKGYQKRWFVL-QNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSEL---DSNELVNGFIL---KLNGHLEDIKKSQDVLYRKLDDLQKSIHD-LDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFE 905
            G+L KWTNYLKGY++RWFVL  N  LSYYRN SE+   CRG+IN+  A+++   +TS ++     QTFH+K QNE + ++WT++L   + KA    +  ++ D+++   DSN   +  IL   +++G L D++ + +++ ++ D+L ++++  ++ DKNS            + ERA + +++ +++L +   + E     A++  K++  E++++  ++  +E LAKQH  LE   S   +    +++  +QE        D++F+DA E
Sbjct:   65 GWLNKWTNYLKGYRQRWFVLDSNATLSYYRNPSEVGHTCRGSINLQEARVHTDKTTSCIVISGQSQTFHVKPQNEMDRQQWTNSLEYMRHKAITRAESEEDEDAQMAKTDSNR-SDALILANRQMSGKLCDLRTAANMMNKQGDELMRALNGTVETDKNS------------LAERADLLKMTTSAVLQAAEEFVELSEQSAKRLNKIVAVEQKEKALLQEQLEALAKQHSSLERAASKCARGAAPVSVYSDQE--------DDEFHDAEE 314          
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Match: obr-1 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7DTF2])

HSP 1 Score: 389.423 bits (999), Expect = 1.049e-121
Identity = 198/410 (48.29%), Postives = 271/410 (66.10%), Query Frame = 3
Query: 1311 RSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVIS---NTETVKGRTYLATEESSI-LLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRV------EILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +  R RRT +P +PN+ +NLWS++KNCIGK+LSKIPMPVNFSEPIS+LQR+ ED EY+++L+  A     +EQ+ YVAA+  S+Y+ T +R NKPFNPLLGET+E DR DD GWR   EQ+ HHPP+ A H E N W  + DF+M+++FRGKY+ + PIG  H++F  +K H+ + +I  T+HNIIVG++WIDNHG+M+I N  T +KC L + PYS FS + P++V G + D       V+ GTWD+ ++   V S   N E  K    L  +E+S+  +W   PLP N +K + F+  AI LNE EE +APTDSR RPDQ+LME G+WDEAN++K  +EE+QR  R       E+    G K    EY+P WF  V D    +  ++F G YWE K +++W  C  IF
Sbjct:  440 KGGRQRRTTVPERPNLPINLWSIMKNCIGKELSKIPMPVNFSEPISVLQRVTEDLEYANLLETGAKLST-LEQMCYVAAYAASNYSTTCHRTNKPFNPLLGETFEFDRMDDLGWRSVTEQVSHHPPAAAHHAEGNGWTMYQDFTMTSRFRGKYLSVIPIGFTHVVFPATKSHFSYRKITTTVHNIIVGKLWIDNHGDMEITNHETNEKCLLKFVPYSYFSREQPRKVYGIVRDAEGIPKYVVQGTWDKSIDMLKVSSWNGNHEKPK----LEVDETSLKRIWTANPLPKNAEKMHNFTKLAIELNEPEEGVAPTDSRLRPDQRLMENGEWDEANRKKLEIEEKQRVVRRRREAEKELAMKKGDK--YEEYEPTWFVRVQDESNGALIHQFKGGYWEAKEQQNWEKCPDIF 842          

HSP 2 Score: 95.9005 bits (237), Expect = 6.069e-20
Identity = 73/285 (25.61%), Postives = 148/285 (51.93%), Query Frame = 3
Query:  150 GYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSEL---DSNELVNGFIL---KLNGHLEDIKKSQDVLYRKLDDLQKSIHD-LDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVTLP-----SPEINLGVSL 968
            G  ++ F LQ       RN SE+   CRG+IN+  A+++   +TS ++     QTFH+K QNE + ++WT++L   + KA    +  ++ D+++   DSN   +  IL   +++G L D++ + +++ ++ D+L ++++  ++ DKNS            + ERA + +++ +++L +   + E     A++  K++  E++++  ++  +E LAKQH  LE   S   +    +++  +QE        D++F+DA E      ++ +P      P    GV L
Sbjct:  159 GDSEKLFGLQE------RNPSEVGHTCRGSINLQEARVHTDKTTSCIVISGQSQTFHVKPQNEMDRQQWTNSLEYMRHKAITRAESEEDEDAQMAKTDSNR-SDALILANRQMSGKLCDLRTAANMMNKQGDELMRALNGTVETDKNS------------LAERADLLKMTTSAVLQAAEEFVELSEQSAKRLNKIVAVEQKEKALLQEQLEALAKQHSSLERAASKCARGAAPVSVYSDQE--------DDEFHDAEE------DLAMPCSNSNGPPATAGVHL 410          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: Osbp (gene:FBgn0020626 transcript:FBtr0084801)

HSP 1 Score: 573.163 bits (1476), Expect = 0.000e+0
Identity = 313/809 (38.69%), Postives = 471/809 (58.22%), Query Frame = 3
Query:  111 IKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXX---XXGCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVTLPSPEINLGVSLPSRCXXXXXXXXXXXXXXXXXXXXXXXXXNCSRNYTDNFFIGDSSTRGFEEVSNKRSLQRLKEARVISAKQSNQLKNRQKLITASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTED--KCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYE----YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +KG+L KWTNY+KGYQ+RWFVL  G+LSYYRNQSE+   CRGTI++  A I+ VDS +FVIS+ G QTFH+K+  E E + W +AL  A+ KA       +  +   + +  ++ ++  +  L   LE ++   D++ +    LQ++++DL+ ++  ++      + K + ERAT+FR+++ +++ +   Y  +   +  KW K++  EREQRQR+E ++E +AKQ   +E Q +  V+    ++       +     SDE+  + F+++E  ++ +  SPE        S C   +   +                 + S +  +    G SS    E    KR++Q +++  ++SA +          + +            +L    S  + +         + RR ++P KPN  ++LW ++KNCIGKDLSKIPMP+NF+EP+SMLQRL ED+EY+ ILD AA+CQ+  EQ++Y+AAFTVS+YA T  R  KPFNPLLGETYE DR DD+GWR  AEQ+ HHPP  A+HCES  W CW +FSM++KFRGKY+QI+P+G  ++ F  S   Y W ++  T++NIIVG++W+D HGEM+I      +  KC L++ PYS FS D  + V G + +K N V  V+ GTWD K+E   V+  + +V   TY   E    L W+R P PP+ DK+Y F++ A  LNE EE +APTDSR RPDQ+LME+G WDE+NKEK RLEE+QR+ R                   Y+P+WF    +  ++   + F   YWE KA +++  C  I+
Sbjct:   17 MKGWLLKWTNYIKGYQRRWFVLSKGVLSYYRNQSEINHTCRGTISLHGALIHTVDSCTFVISNGGTQTFHIKAGTEVERQSWVTALELAKAKAIRAIECEEEEETETAHVVPSQEISSVVRDLTDRLESMRTCYDLITKHGAALQRALNDLETNEEESL----GSRTKIVNERATLFRITSNAMINAGNDYLHTAEAQGHKWSKMLHHEREQRQRLEEIIEQMAKQQSQME-QAAVLVRQNKPVSSTSGAGTAGSLVTSDEEM-EFFDAEEHGYSGSGRSPE-------SSDCERGTFILKMHKRR------------SSSEDQVEGHLEGSSS----ESDEQKRTVQTVQQVCLVSAPR----------VASGGQGDDDDDVDKALPAKESTDSIYGRNWNPDLIKKRRDRVPDKPNHPISLWGIMKNCIGKDLSKIPMPINFNEPLSMLQRLVEDYEYTEILDYAATCQDECEQLAYIAAFTVSAYATTTNRTGKPFNPLLGETYECDRMDDYGWRCLAEQVSHHPPVAALHCESKNWTCWQEFSMTSKFRGKYVQINPLGGVYVQFPNSGRRYSWRKVTTTVNNIIVGKLWVDQHGEMEIRGSQAAEGHKCILNFIPYSYFSRDVQRSVKGVVMNKDNEVKWVVRGTWDMKIEIAPVLKTSGSVSSPTYTTGEFK--LAWRRRPAPPDSDKFYNFTTLACQLNEEEEGVAPTDSRLRPDQRLMEQGDWDESNKEKLRLEEKQRTERRRRENEAEEAAAEGRPYPAYEPMWFKREKEEGSEEYVHVFKNTYWEAKAAQNFEGCPDIY 784          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: CG3860 (gene:FBgn0034951 transcript:FBtr0072201)

HSP 1 Score: 225.713 bits (574), Expect = 6.498e-65
Identity = 148/453 (32.67%), Postives = 223/453 (49.23%), Query Frame = 3
Query: 1314 SKRTRRTQIPPK--PNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWID--------NHGEMDIINLT---------------------TEDKCHLSYKPYSMF--------------------------SNDTPKRVTGAITD-KLNNV--CCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEED------IAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECK 2474
            ++   RT++P        +++W+++KNCIGKDLSKI MPV  +EP+S LQRL E  EY+ +L +AA  ++P +++ YVAAF VS+ A+   R+ KPFNPLLGETYEL + D   +R+  EQ+ HHPP  A H ES ++      S   KF GK ++++P G   + F +    Y W  +   +HNIIVGR+WI+        NH    + +LT                     +E   +  Y  ++ F                           N TPK++   +   KLN+     + +      +E +  I  +++     Y      S  LW   P P N  +YY F+ FA+ LN ++ +      + PTDSR RPD   +EEG  D A+KEK RLEE+QR  R +    +       ++ P WF   T+P  K   + ++G YW+ K
Sbjct:    7 AEHVERTELPATMISRKEVSIWAILKNCIGKDLSKITMPVMLNEPLSFLQRLCEYMEYAQLLTEAAQQEHPADRMKYVAAFAVSALASNWERLGKPFNPLLGETYELQKGD---YRIVCEQVSHHPPVSAFHAESKDFKFHGTISPKIKFWGKSVEVNPKGTVTVEFPKWNESYSWTNVNCCVHNIIVGRLWIEQYGKMEITNHATGHVASLTFKSAGSGAKNLHRVEGFVKDASETNLYFLYGKWTEFIKCCSAESYVQFLKQGTRKNDDYDGSPNGTPKKMFSKLNSFKLNSFRSLSIQDSDSYPPMEQEGDIPKSDSA----YSLDIPDSTTLWSCKPRPSNCSEYYQFTHFALQLNAMDSNMKPPLTLCPTDSRLRPDILHLEEGNLDGASKEKTRLEEKQRHTRKQRKSTNSD-----DWSPRWFKYATNPHTKIDDWLYSGGYWDRK 447          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: CG3860 (gene:FBgn0034951 transcript:FBtr0343288)

HSP 1 Score: 192.586 bits (488), Expect = 5.457e-53
Identity = 103/267 (38.58%), Postives = 155/267 (58.05%), Query Frame = 3
Query: 1314 SKRTRRTQIPPK--PNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRT 2108
            ++   RT++P        +++W+++KNCIGKDLSKI MPV  +EP+S LQRL E  EY+ +L +AA  ++P +++ YVAAF VS+ A+   R+ KPFNPLLGETYEL + D   +R+  EQ+ HHPP  A H ES ++      S   KF GK ++++P G   + F +    Y W  +   +HNIIVGR+WI+ +G+M+I N  T     L++K     + +   RV G + D        L G W E ++  +  S  + +K  T
Sbjct:    7 AEHVERTELPATMISRKEVSIWAILKNCIGKDLSKITMPVMLNEPLSFLQRLCEYMEYAQLLTEAAQQEHPADRMKYVAAFAVSALASNWERLGKPFNPLLGETYELQKGD---YRIVCEQVSHHPPVSAFHAESKDFKFHGTISPKIKFWGKSVEVNPKGTVTVEFPKWNESYSWTNVNCCVHNIIVGRLWIEQYGKMEITNHATGHVASLTFKSAGSGAKNL-HRVEGFVKDASETNLYFLYGKWTEFIKCCSAESYVQFLKQGT 269          

HSP 2 Score: 80.8777 bits (198), Expect = 1.714e-15
Identity = 46/121 (38.02%), Postives = 65/121 (53.72%), Query Frame = 3
Query: 2130 SILLWQRYPLPPNFDKYYYFSSFAITLNEIEED------IAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECK 2474
            S  LW   P P N  +YY F+ FA+ LN ++ +      + PTDSR RPD   +EEG  D A+KEK RLEE+QR  R +    +       ++ P WF   T+P  K   + ++G YW+ K
Sbjct:  334 STTLWSCKPRPSNCSEYYQFTHFALQLNAMDSNMKPPLTLCPTDSRLRPDILHLEEGNLDGASKEKTRLEEKQRHTRKQRKSTNSD-----DWSPRWFKYATNPHTKIDDWLYSGGYWDRK 449          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: cert (gene:FBgn0027569 transcript:FBtr0345035)

HSP 1 Score: 84.7297 bits (208), Expect = 1.715e-16
Identity = 68/287 (23.69%), Postives = 136/287 (47.39%), Query Frame = 3
Query:  102 SSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINL--VDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGC---DNNDSELDSN--ELVNGFILK-----LNGHLEDIKKSQDVLYRKLDDLQK---SIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENM---VEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFES 908
            S  ++GYL KWTNY+ G+Q R+ VL++G LSYY+++SE    CRG I++  A I     D   F +  + +  + L+++   +   W   L   +  +            +   L SN   L +G  LK     L   + +++  +D+L+ +++ LQ+   +  +++K+    +     LK  + K  +  FR + + +LT+     E +    E W++ ++ E ++R+R E+    ++D  ++ + L Y               P+ E      + +++F+DA E+
Sbjct:   39 SIELRGYLSKWTNYIYGWQPRYIVLKDGTLSYYKSESESDFGCRGAISLTKATIKAHESDELRFDVVVNNLNNWCLRAETSEDRMHWVDVLQLYKADSGSTDTTSLRRHGSTMSLQSNTISLTSGGSLKKTQRNLREKVGELETFKDILFGQIETLQRYFDACSEVNKNNAQPLDLGDGLKSIDFKGESITFRATTSGVLTTLQHCLEIIAESDESWKRKLEREIDKRRRSEDQSKKLKDEVEKMKRLSYP-------------GPDFEEGPHSTLPEDEFFDAVET 312          
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Match: cert (gene:FBgn0027569 transcript:FBtr0076717)

HSP 1 Score: 84.7297 bits (208), Expect = 1.715e-16
Identity = 68/287 (23.69%), Postives = 136/287 (47.39%), Query Frame = 3
Query:  102 SSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINL--VDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGC---DNNDSELDSN--ELVNGFILK-----LNGHLEDIKKSQDVLYRKLDDLQK---SIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENM---VEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFES 908
            S  ++GYL KWTNY+ G+Q R+ VL++G LSYY+++SE    CRG I++  A I     D   F +  + +  + L+++   +   W   L   +  +            +   L SN   L +G  LK     L   + +++  +D+L+ +++ LQ+   +  +++K+    +     LK  + K  +  FR + + +LT+     E +    E W++ ++ E ++R+R E+    ++D  ++ + L Y               P+ E      + +++F+DA E+
Sbjct:   39 SIELRGYLSKWTNYIYGWQPRYIVLKDGTLSYYKSESESDFGCRGAISLTKATIKAHESDELRFDVVVNNLNNWCLRAETSEDRMHWVDVLQLYKADSGSTDTTSLRRHGSTMSLQSNTISLTSGGSLKKTQRNLREKVGELETFKDILFGQIETLQRYFDACSEVNKNNAQPLDLGDGLKSIDFKGESITFRATTSGVLTTLQHCLEIIAESDESWKRKLEREIDKRRRSEDQSKKLKDEVEKMKRLSYP-------------GPDFEEGPHSTLPEDEFFDAVET 312          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: CR932437.1 (oxysterol binding protein 2 [Source:NCBI gene;Acc:794414])

HSP 1 Score: 448.743 bits (1153), Expect = 1.768e-149
Identity = 211/398 (53.02%), Postives = 277/398 (69.60%), Query Frame = 3
Query: 1338 IPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKG-----RTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYE-YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EYS +LD+AA C + +EQ+  VAAF+VSSY+ T +RI KPFNPLLGETYELDR +++G+R   EQ+ HHPP+ A H  S   W  W + ++ +KFRGKYI I P+G  HL F  S  HYVW ++  T+HNIIVG++WID  G++ I+N  ++D CHL + PYS FS D P++VTG +TD   +   +L+GTWD+K+E+  +I ++    G     +T   T     LLW++YPLP N +  YYFSS A+TLNE+E+ IAPTDSR RPDQ+LME G WDEAN EK RLEE+Q   R+E  K D       E Y+P+WF   TD E    ++ + G YWE K ++DWS C  IF
Sbjct:   39 IPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYSELLDRAARCDSSLEQMCLVAAFSVSSYSTTVHRIGKPFNPLLGETYELDRLEEYGYRSICEQISHHPPAAAHHVISQRGWTLWQEITIDSKFRGKYISIMPLGNIHLKFHTSGNHYVWSKVTSTVHNIIVGKLWIDQSGDIIIVNHRSKDTCHLKFSPYSYFSRDVPRKVTGVVTDGEGSAHYILSGTWDDKMESAKIIESSHACGGSEGKQKTVYQTLPPK-LLWKKYPLPENAENMYYFSSLALTLNELEDGIAPTDSRLRPDQRLMEAGLWDEANTEKQRLEERQ---RLERRKRDAQANLEVETYQPIWFMKRTDLETGESSFMYKGGYWEAKDRQDWSQCPAIF 432          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: CR932437.1 (oxysterol binding protein 2 [Source:NCBI gene;Acc:794414])

HSP 1 Score: 451.44 bits (1160), Expect = 1.933e-149
Identity = 211/398 (53.02%), Postives = 277/398 (69.60%), Query Frame = 3
Query: 1338 IPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKG-----RTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYE-YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EYS +LD+AA C + +EQ+  VAAF+VSSY+ T +RI KPFNPLLGETYELDR +++G+R   EQ+ HHPP+ A H  S   W  W + ++ +KFRGKYI I P+G  HL F  S  HYVW ++  T+HNIIVG++WID  G++ I+N  ++D CHL + PYS FS D P++VTG +TD   +   +L+GTWD+K+E+  +I ++    G     +T   T     LLW++YPLP N +  YYFSS A+TLNE+E+ IAPTDSR RPDQ+LME G WDEAN EK RLEE+Q   R+E  K D       E Y+P+WF   TD E    ++ + G YWE K ++DWS C  IF
Sbjct:  120 IPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYSELLDRAARCDSSLEQMCLVAAFSVSSYSTTVHRIGKPFNPLLGETYELDRLEEYGYRSICEQISHHPPAAAHHVISQRGWTLWQEITIDSKFRGKYISIMPLGNIHLKFHTSGNHYVWSKVTSTVHNIIVGKLWIDQSGDIIIVNHRSKDTCHLKFSPYSYFSRDVPRKVTGVVTDGEGSAHYILSGTWDDKMESAKIIESSHACGGSEGKQKTVYQTLPPK-LLWKKYPLPENAENMYYFSSLALTLNELEDGIAPTDSRLRPDQRLMEAGLWDEANTEKQRLEERQ---RLERRKRDAQANLEVETYQPIWFMKRTDLETGESSFMYKGGYWEAKDRQDWSQCPAIF 513          

HSP 2 Score: 52.7582 bits (125), Expect = 1.725e-6
Identity = 28/93 (30.11%), Postives = 45/93 (48.39%), Query Frame = 3
Query:  660 SCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLE--YQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVT 932
            +C  + +   G + +W++ +  EREQR  +E  +E LAKQH  LE  ++ S S  NQ        +    +ED+   +F+DA E       V 
Sbjct:    2 ACQDFVDLAEGHSRRWQRALQYEREQRHHLEETIEQLAKQHNSLERAWRESPSTHNQAAEGTLEGESSEENEDI---EFFDAMEDSPAFITVV 91          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: CR932437.1 (oxysterol binding protein 2 [Source:NCBI gene;Acc:794414])

HSP 1 Score: 448.743 bits (1153), Expect = 5.703e-149
Identity = 211/398 (53.02%), Postives = 277/398 (69.60%), Query Frame = 3
Query: 1338 IPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKG-----RTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYE-YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EYS +LD+AA C + +EQ+  VAAF+VSSY+ T +RI KPFNPLLGETYELDR +++G+R   EQ+ HHPP+ A H  S   W  W + ++ +KFRGKYI I P+G  HL F  S  HYVW ++  T+HNIIVG++WID  G++ I+N  ++D CHL + PYS FS D P++VTG +TD   +   +L+GTWD+K+E+  +I ++    G     +T   T     LLW++YPLP N +  YYFSS A+TLNE+E+ IAPTDSR RPDQ+LME G WDEAN EK RLEE+Q   R+E  K D       E Y+P+WF   TD E    ++ + G YWE K ++DWS C  IF
Sbjct:   78 IPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYSELLDRAARCDSSLEQMCLVAAFSVSSYSTTVHRIGKPFNPLLGETYELDRLEEYGYRSICEQISHHPPAAAHHVISQRGWTLWQEITIDSKFRGKYISIMPLGNIHLKFHTSGNHYVWSKVTSTVHNIIVGKLWIDQSGDIIIVNHRSKDTCHLKFSPYSYFSRDVPRKVTGVVTDGEGSAHYILSGTWDDKMESAKIIESSHACGGSEGKQKTVYQTLPPK-LLWKKYPLPENAENMYYFSSLALTLNELEDGIAPTDSRLRPDQRLMEAGLWDEANTEKQRLEERQ---RLERRKRDAQANLEVETYQPIWFMKRTDLETGESSFMYKGGYWEAKDRQDWSQCPAIF 471          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: osbp2 (oxysterol binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-091113-18])

HSP 1 Score: 455.677 bits (1171), Expect = 5.573e-148
Identity = 214/402 (53.23%), Postives = 280/402 (69.65%), Query Frame = 3
Query: 1338 IPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKG-----RTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEI-----LKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EYS +LD+AA C + +EQ+  VAAF+VSSY+ T +RI KPFNPLLGETYELDR +++G+R   EQ+ HHPP+ A H  S   W  W + ++ +KFRGKYI I P+G  HL F  S  HYVW ++  T+HNIIVG++WID  G++ I+N  ++D CHL + PYS FS D P++VTG +TD   +   +L+GTWDEK+E+  +I ++    G     +T   T     LLW++YPLP N +  YYFSS A+TLNE+E+ IAPTDSR RPDQ+LME G WDEAN EK RLEE+QR  R +      L L+  KE V  Y+P+WF   TD E    ++ + G YWE K ++DWS C  IF
Sbjct:  340 IPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYSELLDRAARCDSSLEQMCLVAAFSVSSYSTTVHRIGKPFNPLLGETYELDRLEEYGYRSICEQISHHPPAAAHHVISQRGWTLWQEITIDSKFRGKYISIMPLGNIHLKFHTSGNHYVWSKVTSTVHNIIVGKLWIDQSGDIIIVNHRSKDTCHLKFSPYSYFSRDVPRKVTGVVTDGEGSAHYILSGTWDEKMESAKIIESSHACGGSEGKQKTVYQTLPPK-LLWKKYPLPENAENMYYFSSLALTLNELEDGIAPTDSRLRPDQRLMEAGLWDEANTEKQRLEERQRLERRKRDAQANLALEEGKE-VETYQPIWFMKRTDLETGESSFMYKGGYWEAKDRQDWSQCPAIF 739          

HSP 2 Score: 182.956 bits (463), Expect = 1.168e-47
Identity = 104/278 (37.41%), Postives = 161/278 (57.91%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSE----LDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLE--YQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNV 929
            KG+L+KWTNYLKGYQ+RWFVL NGLLSYYR Q+EMA  CRGTI +    I + D+  FV++ SG +++HLK+ +E E +RW SAL  A+  A  ++   D++  E         L+ G +  L   LED+    +++ +    LQ+S+ +L+ D  +   G    KLK + ERAT+FR+++ +++ +C  + +   G + +W++ +  EREQR  +E  +E LAKQH  LE  ++ S S  NQ        +    +ED+   +F+DA E       V
Sbjct:   24 KGWLFKWTNYLKGYQRRWFVLSNGLLSYYRTQAEMAHTCRGTITLATVHIEVGDTCHFVLT-SGGRSYHLKAYSEGECQRWVSALQQAKANATHMMPHSDDSGDEGPLAQPDRALIQGALKTLVSKLEDLSTCNELIGKHGAALQRSLSELE-DLRAPTDG--TDKLKTVNERATLFRITSNAMINACQDFVDLAEGHSRRWQRALQYEREQRHHLEETIEQLAKQHNSLERAWRESPSTLNQAAEGTLEGESSEENEDI---EFFDAMEDSPAFITV 294          
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Match: osbp2 (oxysterol binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-091113-18])

HSP 1 Score: 456.062 bits (1172), Expect = 6.168e-148
Identity = 214/402 (53.23%), Postives = 280/402 (69.65%), Query Frame = 3
Query: 1338 IPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKG-----RTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEI-----LKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EYS +LD+AA C + +EQ+  VAAF+VSSY+ T +RI KPFNPLLGETYELDR +++G+R   EQ+ HHPP+ A H  S   W  W + ++ +KFRGKYI I P+G  HL F  S  HYVW ++  T+HNIIVG++WID  G++ I+N  ++D CHL + PYS FS D P++VTG +TD   +   +L+GTWDEK+E+  +I ++    G     +T   T     LLW++YPLP N +  YYFSS A+TLNE+E+ IAPTDSR RPDQ+LME G WDEAN EK RLEE+QR  R +      L L+  KE V  Y+P+WF   TD E    ++ + G YWE K ++DWS C  IF
Sbjct:  349 IPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYSELLDRAARCDSSLEQMCLVAAFSVSSYSTTVHRIGKPFNPLLGETYELDRLEEYGYRSICEQISHHPPAAAHHVISQRGWTLWQEITIDSKFRGKYISIMPLGNIHLKFHTSGNHYVWSKVTSTVHNIIVGKLWIDQSGDIIIVNHRSKDTCHLKFSPYSYFSRDVPRKVTGVVTDGEGSAHYILSGTWDEKMESAKIIESSHACGGSEGKQKTVYQTLPPK-LLWKKYPLPENAENMYYFSSLALTLNELEDGIAPTDSRLRPDQRLMEAGLWDEANTEKQRLEERQRLERRKRDAQANLALEEGKE-VETYQPIWFMKRTDLETGESSFMYKGGYWEAKDRQDWSQCPAIF 748          

HSP 2 Score: 182.956 bits (463), Expect = 1.216e-47
Identity = 104/278 (37.41%), Postives = 161/278 (57.91%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSE----LDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLE--YQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNV 929
            KG+L+KWTNYLKGYQ+RWFVL NGLLSYYR Q+EMA  CRGTI +    I + D+  FV++ SG +++HLK+ +E E +RW SAL  A+  A  ++   D++  E         L+ G +  L   LED+    +++ +    LQ+S+ +L+ D  +   G    KLK + ERAT+FR+++ +++ +C  + +   G + +W++ +  EREQR  +E  +E LAKQH  LE  ++ S S  NQ        +    +ED+   +F+DA E       V
Sbjct:   24 KGWLFKWTNYLKGYQRRWFVLSNGLLSYYRTQAEMAHTCRGTITLATVHIEVGDTCHFVLT-SGGRSYHLKAYSEGECQRWVSALQQAKANATHMMPHSDDSGDEGPLAQPDRALIQGALKTLVSKLEDLSTCNELIGKHGAALQRSLSELE-DLRAPTDG--TDKLKTVNERATLFRITSNAMINACQDFVDLAEGHSRRWQRALQYEREQRHHLEETIEQLAKQHNSLERAWRESPSTLNQAAEGTLEGESSEENEDI---EFFDAMEDSPAFITV 294          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: ccdc6 (coiled-coil domain containing 6 [Source:Xenbase;Acc:XB-GENE-978266])

HSP 1 Score: 452.21 bits (1162), Expect = 3.398e-146
Identity = 213/421 (50.59%), Postives = 286/421 (67.93%), Query Frame = 3
Query: 1296 EVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCES-NEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSI-------LLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQ--------RSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            E+IP   K+ RRT+IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EY  +LDKA  C++ IEQ+ ++AAF+VSSY+ T +R  KPFNPLLGET+ELDR DD G+R   EQ+ HHPP+ A +  S N W  W + ++++KFRGKY+ I P+G  HL F  S  HYVW ++  T+HNIIVG++WID  G+++IIN  T+DKC L + PYS FS D  ++VTG +TD       VL+GTWDEK+E   ++ ++    G +    ++ ++       LLW++YPLP N +  Y+FS FA+TLNE +E +APTDSRNRPDQ+LME GKWDEAN EK RLEE+Q              + +++   E    Y+PLWF+   DP        + G YWECK ++DWS C  IF
Sbjct:  347 ELIP---KKRRRTRIPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDKAVKCESSIEQMCFIAAFSVSSYSTTVHRTAKPFNPLLGETFELDRLDDLGFRSICEQVSHHPPAAAHYVHSKNGWKLWQEITIASKFRGKYLSIMPLGDIHLEFHSSGNHYVWRKVTSTVHNIIVGKLWIDQSGDIEIINYKTKDKCQLKFSPYSYFSRDIARKVTGVVTDANGKAHYVLSGTWDEKMECAKIVQSSH---GNSCAEGKQKTVYQTLPPKLLWKKYPLPENAENMYFFSEFALTLNESDESVAPTDSRNRPDQRLMENGKWDEANVEKQRLEEKQRAVRRRREAEAVEALEEVNQRSESPNRYQPLWFERKVDPYTGELICNYKGGYWECKERQDWSCCPDIF 761          

HSP 2 Score: 182.956 bits (463), Expect = 2.459e-47
Identity = 109/288 (37.85%), Postives = 168/288 (58.33%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXX------XXXXXGCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQI---------SSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVT 932
            KG+L+KWTNYLKGYQ+RWFVL NGLLSYYR Q+EMA  CRGTIN+  A I+  DS + V+++ G +T+HLK+  E E +RW +AL  A+ KA      Q    G +   S+ D +EL +  +  L   L+D+    D++ +    LQ+S+ +L+   N  +  E   K+K++ ERAT+FR+++ +++ +C  + +     + KW + +  EREQR R+E  +E LAKQH  LE            ++ V N  K N+   +  ++DED  + +++DA E       VT
Sbjct:   21 KGWLFKWTNYLKGYQRRWFVLSNGLLSYYRTQAEMAHTCRGTINLSTAHIDTEDSCNIVLTNGG-RTYHLKASCEVERQRWVTALELAKAKAIRMMNNQSDDSGDEEPSSQSDKSEL-HSSLKALTSKLDDLSTCNDLIAKHGAALQRSLSELE---NLKLPAESGEKIKSVNERATLFRITSNAMINACRDFLDLAETHSRKWHRALQYEREQRVRLEETIEQLAKQHNSLERACRGAPGLTSNTTGVLNTPKGNVPAIKGEASDED-EETEYFDAMEDAPAFITVT 302          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: ccdc6 (coiled-coil domain containing 6 [Source:Xenbase;Acc:XB-GENE-978266])

HSP 1 Score: 452.595 bits (1163), Expect = 3.893e-146
Identity = 216/417 (51.80%), Postives = 286/417 (68.59%), Query Frame = 3
Query: 1296 EVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCES-NEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSI-------LLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFV---YE-YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            E+IP   K+ RRT+IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EY  +LDKA  C++ IEQ+ ++AAF+VSSY+ T +R  KPFNPLLGET+ELDR DD G+R   EQ+ HHPP+ A +  S N W  W + ++++KFRGKY+ I P+G  HL F  S  HYVW ++  T+HNIIVG++WID  G+++IIN  T+DKC L + PYS FS D  ++VTG +TD       VL+GTWDEK+E   ++ ++    G +    ++ ++       LLW++YPLP N +  Y+FS FA+TLNE +E +APTDSRNRPDQ+LME GKWDEAN EK RLEE+QR+ R                YE Y+PLWF+   DP        + G YWECK ++DWS C  IF
Sbjct:  367 ELIP---KKRRRTRIPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDKAVKCESSIEQMCFIAAFSVSSYSTTVHRTAKPFNPLLGETFELDRLDDLGFRSICEQVSHHPPAAAHYVHSKNGWKLWQEITIASKFRGKYLSIMPLGDIHLEFHSSGNHYVWRKVTSTVHNIIVGKLWIDQSGDIEIINYKTKDKCQLKFSPYSYFSRDIARKVTGVVTDANGKAHYVLSGTWDEKMECAKIVQSSH---GNSCAEGKQKTVYQTLPPKLLWKKYPLPENAENMYFFSEFALTLNESDESVAPTDSRNRPDQRLMENGKWDEANVEKQRLEEKQRAVRRRREAEAVEALEEGNDYEGYQPLWFERKVDPYTGELICNYKGGYWECKERQDWSCCPDIF 777          

HSP 2 Score: 186.808 bits (473), Expect = 1.311e-48
Identity = 111/295 (37.63%), Postives = 170/295 (57.63%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRW-TSXXXXXXXXXXXXXXGCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQI---------SSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVTL-----PSPEIN 953
            KG+L+KWTNYLKGYQ+RWFVL NGLLSYYR Q+EMA  CRGTIN+  A I+  DS + V+++ G +T+HLK+  E E +RW T+  LA  K   +   G +   S+ D +EL +  +  L   L+D+    D++ +    LQ+S+ +L+   N  +  E   K+K++ ERAT+FR+++ +++ +C  + +     + KW + +  EREQR R+E  +E LAKQH  LE            ++ V N  K N+   +  ++DED  + +++DA E       VT       SPE N
Sbjct:   72 KGWLFKWTNYLKGYQRRWFVLSNGLLSYYRTQAEMAHTCRGTINLSTAHIDTEDSCNIVLTNGG-RTYHLKASCEVERQRWVTALELAKAKLLAENDSGDEEPSSQSDKSEL-HSSLKALTSKLDDLSTCNDLIAKHGAALQRSLSELE---NLKLPAESGEKIKSVNERATLFRITSNAMINACRDFLDLAETHSRKWHRALQYEREQRVRLEETIEQLAKQHNSLERACRGAPGLTSNTTGVLNTPKGNVPAIKGEASDED-EETEYFDAMEDAPAFITVTADPKQHSSPESN 360          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: OSBP (oxysterol binding protein [Source:NCBI gene;Acc:100488223])

HSP 1 Score: 422.55 bits (1085), Expect = 1.120e-135
Identity = 209/405 (51.60%), Postives = 277/405 (68.40%), Query Frame = 3
Query: 1317 KRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRV------EILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            ++ RRT+IP KPN ++NLWSV+KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EY ++LD+ A C++ +EQ+  VAAFTVSSY+ T +R +KPFNPLLGET+ELDR ++ G+R   EQ+ HHPP+ A H ES   W    + ++++KFRGKY+ I P+G  H +F  S  HY W+++  T+HNIIVG++WID   E+DI+N  T D+C L + PYS FS D  ++V+G + D    V   L GTWDE++E   V S   TV         ++ ILLW+R PLP N +  YYF+ FA+TLN  EE  AP+DSR+RPDQ+LME G WDEAN EK RLEE+QR+ R       E    DG+   V  YKP+WF+   DP +K  T+   G YWECK ++DW+ C  IF
Sbjct:  290 RKERRTRIPYKPNYSLNLWSVMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHTLLDRGAQCESALEQLCLVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRMEESGYRSLCEQVSHHPPAAAHHAESRHGWTLRQEITVTSKFRGKYLSIMPLGTIHCVFHNSGNHYTWKKVTTTVHNIIVGKLWIDQEREIDIVNHKTGDRCKLKFAPYSYFSRDVARKVSGEVMDATGRVHYTLMGTWDERMECIPVYS-VSTVSENGGDKAADNKILLWKRNPLPKNAEYMYYFTEFALTLNAPEEGTAPSDSRHRPDQRLMENGNWDEANSEKQRLEEKQRNTRKKREAERERAGEDGSP--VDTYKPMWFERKMDPVSKEMTHICRGIYWECKERQDWASCPDIF 691          

HSP 2 Score: 129.028 bits (323), Expect = 4.310e-30
Identity = 70/202 (34.65%), Postives = 125/202 (61.88%), Query Frame = 3
Query:  201 RNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSELDSNEL----VNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLE 794
            R+++EM   CRGTIN+  A I++ DS +FVIS+ G QT+HLK+ +E E +RW +AL  A+ +A  +    D++  E  S++     V+  +  L+G +ED+    D++ +    LQ+S+ +L+  +   +  E + K+K + ERAT+FR+++ +++ +C  +       +++W++ +  ER+QR R+E  +E LAKQH HLE
Sbjct:    9 RSKAEMRHTCRGTINLATANISVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKARAVKMQAESDDSGDEDPSSQTDKAEVHSTLRALSGKVEDLGTCNDLIAKHGTALQRSLSELESLR---LPQESSEKIKQVNERATLFRITSNAMINACRDFMSLAESHSKRWQRALQYERDQRLRLEETLEQLAKQHNHLE 207          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: OSBP (oxysterol binding protein [Source:NCBI gene;Acc:100488223])

HSP 1 Score: 423.705 bits (1088), Expect = 1.347e-135
Identity = 209/405 (51.60%), Postives = 277/405 (68.40%), Query Frame = 3
Query: 1317 KRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRV------EILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            ++ RRT+IP KPN ++NLWSV+KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EY ++LD+ A C++ +EQ+  VAAFTVSSY+ T +R +KPFNPLLGET+ELDR ++ G+R   EQ+ HHPP+ A H ES   W    + ++++KFRGKY+ I P+G  H +F  S  HY W+++  T+HNIIVG++WID   E+DI+N  T D+C L + PYS FS D  ++V+G + D    V   L GTWDE++E   V S   TV         ++ ILLW+R PLP N +  YYF+ FA+TLN  EE  AP+DSR+RPDQ+LME G WDEAN EK RLEE+QR+ R       E    DG+   V  YKP+WF+   DP +K  T+   G YWECK ++DW+ C  IF
Sbjct:  339 RKERRTRIPYKPNYSLNLWSVMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHTLLDRGAQCESALEQLCLVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRMEESGYRSLCEQVSHHPPAAAHHAESRHGWTLRQEITVTSKFRGKYLSIMPLGTIHCVFHNSGNHYTWKKVTTTVHNIIVGKLWIDQEREIDIVNHKTGDRCKLKFAPYSYFSRDVARKVSGEVMDATGRVHYTLMGTWDERMECIPVYS-VSTVSENGGDKAADNKILLWKRNPLPKNAEYMYYFTEFALTLNAPEEGTAPSDSRHRPDQRLMENGNWDEANSEKQRLEEKQRNTRKKREAERERAGEDGSP--VDTYKPMWFERKMDPVSKEMTHICRGIYWECKERQDWASCPDIF 740          

HSP 2 Score: 126.331 bits (316), Expect = 3.498e-29
Identity = 69/201 (34.33%), Postives = 124/201 (61.69%), Query Frame = 3
Query:  204 NQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSELDSNEL----VNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLE 794
            +++EM   CRGTIN+  A I++ DS +FVIS+ G QT+HLK+ +E E +RW +AL  A+ +A  +    D++  E  S++     V+  +  L+G +ED+    D++ +    LQ+S+ +L+  +   +  E + K+K + ERAT+FR+++ +++ +C  +       +++W++ +  ER+QR R+E  +E LAKQH HLE
Sbjct:   66 SKAEMRHTCRGTINLATANISVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKARAVKMQAESDDSGDEDPSSQTDKAEVHSTLRALSGKVEDLGTCNDLIAKHGTALQRSLSELESLR---LPQESSEKIKQVNERATLFRITSNAMINACRDFMSLAESHSKRWQRALQYERDQRLRLEETLEQLAKQHNHLE 263          
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Match: OSBP (oxysterol binding protein [Source:NCBI gene;Acc:100488223])

HSP 1 Score: 423.32 bits (1087), Expect = 2.244e-135
Identity = 209/405 (51.60%), Postives = 277/405 (68.40%), Query Frame = 3
Query: 1317 KRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRR------VEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            ++ RRT+IP KPN ++NLWSV+KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EY ++LD+ A C++ +EQ+  VAAFTVSSY+ T +R +KPFNPLLGET+ELDR ++ G+R   EQ+ HHPP+ A H ES   W    + ++++KFRGKY+ I P+G  H +F  S  HY W+++  T+HNIIVG++WID   E+DI+N  T D+C L + PYS FS D  ++V+G + D    V   L GTWDE++E   V S   TV         ++ ILLW+R PLP N +  YYF+ FA+TLN  EE  AP+DSR+RPDQ+LME G WDEAN EK RLEE+QR+ R       E    DG+   V  YKP+WF+   DP +K  T+   G YWECK ++DW+ C  IF
Sbjct:  336 RKERRTRIPYKPNYSLNLWSVMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHTLLDRGAQCESALEQLCLVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRMEESGYRSLCEQVSHHPPAAAHHAESRHGWTLRQEITVTSKFRGKYLSIMPLGTIHCVFHNSGNHYTWKKVTTTVHNIIVGKLWIDQEREIDIVNHKTGDRCKLKFAPYSYFSRDVARKVSGEVMDATGRVHYTLMGTWDERMECIPVYS-VSTVSENGGDKAADNKILLWKRNPLPKNAEYMYYFTEFALTLNAPEEGTAPSDSRHRPDQRLMENGNWDEANSEKQRLEEKQRNTRKKREAERERAGEDGSP--VDTYKPMWFERKMDPVSKEMTHICRGIYWECKERQDWASCPDIF 737          

HSP 2 Score: 132.109 bits (331), Expect = 5.363e-31
Identity = 74/224 (33.04%), Postives = 131/224 (58.48%), Query Frame = 3
Query:  135 TNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSELDSNEL----VNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLE 794
            + +L+G  +    L+ G     R Q  M   CRGTIN+  A I++ DS +FVIS+ G QT+HLK+ +E E +RW +AL  A+ +A  +    D++  E  S++     V+  +  L+G +ED+    D++ +    LQ+S+ +L+  +   +  E + K+K + ERAT+FR+++ +++ +C  +       +++W++ +  ER+QR R+E  +E LAKQH HLE
Sbjct:   32 STFLRGGSEFLAFLREGGAGESREQKAMRHTCRGTINLATANISVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKARAVKMQAESDDSGDEDPSSQTDKAEVHSTLRALSGKVEDLGTCNDLIAKHGTALQRSLSELESLR---LPQESSEKIKQVNERATLFRITSNAMINACRDFMSLAESHSKRWQRALQYERDQRLRLEETLEQLAKQHNHLE 252          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbp2 (oxysterol binding protein 2 [Source:MGI Symbol;Acc:MGI:1921559])

HSP 1 Score: 430.639 bits (1106), Expect = 4.426e-142
Identity = 207/423 (48.94%), Postives = 281/423 (66.43%), Query Frame = 3
Query: 1269 NTSNIATFSEVIPIRS-KRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEE-SSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVE-----ILKLDGTKEFVYE-YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +  N+   +  +P  S K  RR +IP KPN ++NLWS++KNCIG++LS+IPMPVNF+EP+SMLQRL ED EY  +LDKA +C + +EQ+  VAAF+VSSY+ T +RI KPFNP+LGET+ELDR +D G R   EQ+ HHPPS A H  S   W  W + ++++KFRGKYI I P+G  HL F+ S  HYVW +   T+HNIIVG++WID  G+++I+N  T+D+C L + PYS FS +  ++VTG ++D       VL+G+WD+++E   ++ ++ +  GR     +   + LLW++YPLP N +  YYFS  A+TLNE E+ +APTDSR RPDQ+LME G+WDEAN EK RLEE+QR  R            G +E   + Y PLWF+   DP        + G YWE K KKDW MC  IF
Sbjct:   33 SADNVLDGASFMPKNSCKVKRRVRIPDKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVNCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRMEDMGLRSLCEQVSHHPPSAAHHVFSKHGWSLWQEITIASKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTKDRCQLKFVPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDDQMECSKIVHSSPSSDGRQKTVYQTLPAKLLWRKYPLPENAENMYYFSELALTLNEQEDGVAPTDSRLRPDQRLMERGRWDEANTEKQRLEEKQRLSRRRRLESCTAGCGGEEEKESDGYVPLWFEKRLDPLTGEMACMYKGGYWEAKEKKDWHMCPNIF 455          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbp2 (oxysterol binding protein 2 [Source:MGI Symbol;Acc:MGI:1921559])

HSP 1 Score: 430.639 bits (1106), Expect = 1.797e-141
Identity = 207/423 (48.94%), Postives = 281/423 (66.43%), Query Frame = 3
Query: 1269 NTSNIATFSEVIPIRS-KRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEE-SSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVE-----ILKLDGTKEFVYE-YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +  N+   +  +P  S K  RR +IP KPN ++NLWS++KNCIG++LS+IPMPVNF+EP+SMLQRL ED EY  +LDKA +C + +EQ+  VAAF+VSSY+ T +RI KPFNP+LGET+ELDR +D G R   EQ+ HHPPS A H  S   W  W + ++++KFRGKYI I P+G  HL F+ S  HYVW +   T+HNIIVG++WID  G+++I+N  T+D+C L + PYS FS +  ++VTG ++D       VL+G+WD+++E   ++ ++ +  GR     +   + LLW++YPLP N +  YYFS  A+TLNE E+ +APTDSR RPDQ+LME G+WDEAN EK RLEE+QR  R            G +E   + Y PLWF+   DP        + G YWE K KKDW MC  IF
Sbjct:   75 SADNVLDGASFMPKNSCKVKRRVRIPDKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVNCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRMEDMGLRSLCEQVSHHPPSAAHHVFSKHGWSLWQEITIASKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTKDRCQLKFVPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDDQMECSKIVHSSPSSDGRQKTVYQTLPAKLLWRKYPLPENAENMYYFSELALTLNEQEDGVAPTDSRLRPDQRLMERGRWDEANTEKQRLEEKQRLSRRRRLESCTAGCGGEEEKESDGYVPLWFEKRLDPLTGEMACMYKGGYWEAKEKKDWHMCPNIF 497          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbp (oxysterol binding protein [Source:MGI Symbol;Acc:MGI:97447])

HSP 1 Score: 432.95 bits (1112), Expect = 2.271e-138
Identity = 216/410 (52.68%), Postives = 284/410 (69.27%), Query Frame = 3
Query: 1314 SKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCES-NEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVIS----NTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQR----SRRVEILKL--DGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +K+ +RT+IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EY  +LD+AA C+N +EQ+ YVAAFTVSSY+ T +R +KPFNPLLGET+ELDR ++ G+R   EQ+ HHPP+ A H ES N W    +  +++KFRGKY+ I P+G  H +F  + +HY W+++  T+HNIIVG++WID  GE+DI+N  T DKC+L + PYS FS D  ++VTG +TD    V   L GTWDEK++   V +    N    + R + A E+S ++LW+R PLP N +  YYFS  A+TLN  E   APTDSR RPDQ+LME G+WDEAN EK RLEE+QR     R  E  K   DGT      YK LWF+   DP  +  T+ ++G+YWECK K+DW  C  IF
Sbjct:  399 TKKEKRTRIPYKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRLEENGYRSICEQVSHHPPAAAHHAESKNGWTLRQEIKITSKFRGKYLSIMPLGTIHCIFHSTGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMDCFKVQAASGENGGDARQRGHEA-EDSRVMLWKRNPLPKNAENMYYFSELALTLNAWEGGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKKREAEAAKATEDGTPH--DPYKALWFERKKDPVTRELTHIYSGEYWECKEKQDWGSCPDIF 805          

HSP 2 Score: 186.037 bits (471), Expect = 2.500e-48
Identity = 116/299 (38.80%), Postives = 175/299 (58.53%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNND-----SELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINP--------NQEPSADEDVSDED----FYDAFESQEGVFNVTLPSPEINLG 959
            +G+L+KWTNY+KGYQ+RWFVL NGLLSYYR+++EM   CRGTIN+  A I + DS +F+IS+ G QT+HLK+ +E E +RW +AL  A+ KA  +L   D++      S+ D  EL    +  L+  +ED+    D++ +    LQ+S+ +L+  K   +  E   K+K + ERAT+FR+++ +++ +C  +       ++KW+K +  ER+QR R+E  +E LAKQH HLE     +      L  NP        +Q  S   D+SDED    F+DA E       +T+P    NLG
Sbjct:   90 EGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVKMLAESDDSGDEESVSQTDKTEL-QSTLRTLSSKVEDLSTCNDLIAKHGTALQRSLSELESLK---LPAESNEKIKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLEETLEQLAKQHNHLERAFRGATV----LPANPPGSAGSGKDQCCSGKGDMSDEDDENEFFDAPEI------ITMPE---NLG 371          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbp2 (oxysterol binding protein 2 [Source:MGI Symbol;Acc:MGI:1921559])

HSP 1 Score: 434.491 bits (1116), Expect = 7.855e-138
Identity = 207/420 (49.29%), Postives = 280/420 (66.67%), Query Frame = 3
Query: 1278 NIATFSEVIPIRS-KRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEE-SSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVE-----ILKLDGTKEFVYE-YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            N+   +  +P  S K  RR +IP KPN ++NLWS++KNCIG++LS+IPMPVNF+EP+SMLQRL ED EY  +LDKA +C + +EQ+  VAAF+VSSY+ T +RI KPFNP+LGET+ELDR +D G R   EQ+ HHPPS A H  S   W  W + ++++KFRGKYI I P+G  HL F+ S  HYVW +   T+HNIIVG++WID  G+++I+N  T+D+C L + PYS FS +  ++VTG ++D       VL+G+WD+++E   ++ ++ +  GR     +   + LLW++YPLP N +  YYFS  A+TLNE E+ +APTDSR RPDQ+LME G+WDEAN EK RLEE+QR  R            G +E   + Y PLWF+   DP        + G YWE K KKDW MC  IF
Sbjct:  489 NVLDGASFMPKNSCKVKRRVRIPDKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVNCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRMEDMGLRSLCEQVSHHPPSAAHHVFSKHGWSLWQEITIASKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTKDRCQLKFVPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDDQMECSKIVHSSPSSDGRQKTVYQTLPAKLLWRKYPLPENAENMYYFSELALTLNEQEDGVAPTDSRLRPDQRLMERGRWDEANTEKQRLEEKQRLSRRRRLESCTAGCGGEEEKESDGYVPLWFEKRLDPLTGEMACMYKGGYWEAKEKKDWHMCPNIF 908          

HSP 2 Score: 157.918 bits (398), Expect = 4.116e-39
Identity = 94/240 (39.17%), Postives = 142/240 (59.17%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXX-------------GCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLE 794
            KG+L KWTNYLKGYQ+RWFVL NGLLSYYRNQ EMA  CR TIN+ +      DS   ++ + G +T+HLK+ +E + + W +AL  A+ KA  ++K                 ++SEL  +  +    LKLN    D+    D++ +    LQ+S+++LD  K  +  GE   KLK + ERAT+FR+++ +++ +C  + E     + KW++ ++ E+EQR  +E  +E LAKQH  LE
Sbjct:  183 KGWLLKWTNYLKGYQRRWFVLGNGLLSYYRNQGEMAHTCRATINLASTHFETEDSCGILLCN-GARTYHLKASSEVDRQHWITALELAKAKAIRVMKTQSDDSGDDDEEPAAPADNSEL--HHTLKTLSLKLN----DLSTCNDLIAKHGAALQRSLNELDSLKIPSECGE---KLKVVNERATLFRITSNAMINACRDFLELAETHSRKWQRALNYEQEQRVHLEETIEQLAKQHNSLE 412          
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Match: Osbpl3 (oxysterol binding protein-like 3 [Source:MGI Symbol;Acc:MGI:1918970])

HSP 1 Score: 280.026 bits (715), Expect = 4.564e-81
Identity = 155/396 (39.14%), Postives = 234/396 (59.09%), Query Frame = 3
Query: 1314 SKRTRRTQIP-PKPNIN-MNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRIN-KPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCH--LSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIE----EDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECK 2474
            ++  RRT +P P PN + ++LWS+++N IGKDLSK+ MPV  +EP++ LQRL E+ EYS +LDKA+   +P+E++ YVAAF +S+YA++ +R   KPFNP+LGETYE  R D  G++ FAEQ+ HHPP  A H ES  +V W D    NKF GK ++I PIG  H+       H+ W ++   IHNI+ G+ WI+++GE+DI NL  +D CH  +++     +S +    + G + D+       L G W E +                Y     SS  +W+  P+P  +++YY F+ FA+ LNE++      + PTD+R RPDQ+L+EEG  +EA  +K R+E+ QR RR  +L+ +G      E++P +F   +D       +  NG Y E +
Sbjct:  440 ARSKRRTSLPAPGPNTSSVSLWSILRNNIGKDLSKVAMPVELNEPLNTLQRLCEELEYSELLDKASRIPSPLERMVYVAAFAISAYASSYFRAGSKPFNPVLGETYECIRQDK-GFQFFAEQVSHHPPISACHAESGNFVFWQDVRWKNKFWGKSMEIVPIGTTHVTLPAFGDHFEWNKVTSCIHNILSGQRWIEHYGEIDIKNL-NDDSCHCKVNFIKAKYWSTNA-HEIEGTVFDRSGKAVHRLFGKWHESI----------------YCGGASSSTCVWRANPMPKGYEQYYGFTQFALELNEMDPLSRSLLPPTDTRFRPDQRLLEEGNIEEAEVQKQRIEKLQRERR-RVLEENGV-----EHQPRFFRKSSD-----DAWVSNGTYLELR 805          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|P22059|OSBP1_HUMAN (Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1)

HSP 1 Score: 439.113 bits (1128), Expect = 7.851e-140
Identity = 233/463 (50.32%), Postives = 305/463 (65.87%), Query Frame = 3
Query: 1185 NQLKNRQKLITASSNNMHKPINLVSLTYNTSNIATFSEVIPI---------RSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCES-NEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLE---AKNVIS-NTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQR----SRRVEILKL--DGTKEFVYE-YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            N+  +  ++IT   N  HK           SNI+  S  I +          +K+ +RT+IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EY  +LD+AA C+N +EQ+ YVAAFTVSSY+ T +R +KPFNPLLGET+ELDR ++ G+R   EQ+ HHPP+ A H ES N W    +  +++KFRGKY+ I P+G  H +F  + +HY W+++  T+HNIIVG++WID  GE+DI+N  T DKC+L + PYS FS D  ++VTG +TD    V   L GTWDEK+E    + VI  N    + R + A EES ++LW+R PLP N +  YYFS  A+TLN  E   APTDSR RPDQ+LME G+WDEAN EK RLEE+QR     R  E +K   DGT    Y+ YK LWF+   DP  K  T+ + G+YWECK K+DWS C  IF
Sbjct:  357 NEFFDAPEIITMPENLGHKRTG--------SNISGASSDISLDEQYKHQLEETKKEKRTRIPYKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTLRQEIKITSKFRGKYLSIMPLGTIHCIFHATGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMECFKVQPVIGENGGDARQRGHEA-EESRVMLWKRNPLPKNAENMYYFSELALTLNAWESGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKKREAEAMKATEDGTP---YDPYKALWFERKKDPVTKELTHIYRGEYWECKEKQDWSSCPDIF 807          

HSP 2 Score: 187.578 bits (475), Expect = 5.753e-48
Identity = 114/295 (38.64%), Postives = 178/295 (60.34%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNND-----SELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLE--YQISSSVQNQLKLNINPNQEP--SADEDVSDED----FYDAFESQEGVFNVTLPSPEINLG 959
            +G+L+KWTNY+KGYQ+RWFVL NGLLSYYR+++EM   CRGTIN+  A I + DS +F+IS+ G QT+HLK+ +E E +RW +AL  A+ KA  +L   D +      S+ D  EL N  +  L+  +ED+    D++ +    LQ+S+ +L+  K   +  E   K+K + ERAT+FR+++ +++ +C  +       ++KW+K +  ER+QR R+E  +E LAKQH HLE  ++ ++ +      N+   ++   S   D+SDED    F+DA E       +T+P    NLG
Sbjct:   92 EGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVKMLAESDESGDEESVSQTDKTELQN-TLRTLSSKVEDLSTCNDLIAKHGTALQRSLSELESLK---LPAESNEKIKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLEETLEQLAKQHNHLERAFRGATVLPANTPGNVGSGKDQCCSGKGDMSDEDDENEFFDAPEI------ITMPE---NLG 373          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|Q969R2|OSBP2_HUMAN (Oxysterol-binding protein 2 OS=Homo sapiens OX=9606 GN=OSBP2 PE=1 SV=2)

HSP 1 Score: 440.654 bits (1132), Expect = 3.291e-139
Identity = 211/426 (49.53%), Postives = 281/426 (65.96%), Query Frame = 3
Query: 1278 NIATFSEVIPIRSKRT-RRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETV-----KGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVY--------EYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            N+   + ++P  S +  RR +IP KPN ++NLWS++KNCIG++LS+IPMPVNF+EP+SMLQRL ED EY  +LDKA  C + +EQ+  VAAF+VSSY+ T +RI KPFNP+LGET+ELDR DD G R   EQ+ HHPPS A +  S   W  W + ++S+KFRGKYI I P+G  HL F+ S  HYVW +   T+HNIIVG++WID  G+++I+N  T D+C L + PYS FS +  ++VTG ++D       VL+G+WDE++E   V+ ++ +      K +T   T  S+ LLW++YPLP N +  YYFS  A+TLNE EE +APTDSR RPDQ+LME+G+WDEAN EK RLEE+QR  R   L+  G               Y PLWF+   DP        + G YWE K K+DW MC  IF
Sbjct:  492 NVLDGASLVPKGSSKVKRRVRIPNKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQT-LSAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTEKQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGYWEAKEKQDWHMCPNIF 916          

HSP 2 Score: 164.851 bits (416), Expect = 2.234e-40
Identity = 93/241 (38.59%), Postives = 147/241 (61.00%), Query Frame = 3
Query:  108 NIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXX------XGCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSS 812
            + +G+L KWTNYLKGYQ+RWFVL NGLLSYYRNQ EMA  CRGTIN+  A I+  DS   +++ SG +++HLK+ +E + ++W +AL  A+ KA  ++       G D+  +       ++  +  L+  L+D+    D++ +    LQ+S+ +LD  K  +  GE   KLK + ERAT+FR+++ +++ +C  + E     + KW++ +  E+EQR  +E  +E LAKQH  LE    S+
Sbjct:  184 SFEGWLLKWTNYLKGYQRRWFVLGNGLLSYYRNQGEMAHTCRGTINLSTAHIDTEDSCGILLT-SGARSYHLKASSEVDRQQWITALELAKAKAVRVMNTHSDDSGDDDEATTPADKSELHHTLKNLSLKLDDLSTCNDLIAKHGAALQRSLTELDGLKIPSESGE---KLKVVNERATLFRITSNAMINACRDFLELAEIHSRKWQRALQYEQEQRVHLEETIEQLAKQHNSLERAFHSA 420          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|P16258|OSBP1_RABIT (Oxysterol-binding protein 1 OS=Oryctolagus cuniculus OX=9986 GN=OSBP PE=1 SV=1)

HSP 1 Score: 435.647 bits (1119), Expect = 1.377e-138
Identity = 230/463 (49.68%), Postives = 303/463 (65.44%), Query Frame = 3
Query: 1185 NQLKNRQKLITASSNNMHKPINLVSLTYNTSNIATFSEVIPI---------RSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCES-NEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVI----SNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQR----SRRVEILKL--DGTKEFVYE-YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            N+  +  ++IT   N  HK           SNI+  S  I +          +K+ +RT+IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EY  +LD+AA C+N +EQ+ YVAAFTVSSY+ T +R +KPFNPLLGET+ELDR ++ G+R   EQ+ HHPP+ A H ES N W    +  +++KFRGKY+ I P+G  H +F  + +HY W+++  T+HNIIVG++WID  GE+DI+N  T DKC+L + PYS FS D  ++VTG +TD    V   L GTWDEK++   V      N    + R + A EES ++LW+R PLP N +  YYFS  A+TLN  E   APTDSR RPDQ+LME G+WDEAN EK RLEE+QR     R  E +K   DGT    Y+ YK LWF+   DP  K  T+ + G+YWECK K+DW+ C  IF
Sbjct:  359 NEFFDAPEIITMPENLGHKRTG--------SNISGASSDISLDEQYKHQLEETKKEKRTRIPYKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRLEENGYRSLCEQVSHHPPAAAHHAESKNGWTLRQEIKITSKFRGKYLSIMPLGTIHCIFHATGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMDCFKVQPVSGENGGDARQRGHEA-EESRVMLWKRNPLPKNAENMYYFSELALTLNAWEGGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKKREAEAMKATEDGTP---YDPYKALWFERKKDPVTKELTHIYRGEYWECKEKQDWNSCPDIF 809          

HSP 2 Score: 186.422 bits (472), Expect = 1.371e-47
Identity = 114/295 (38.64%), Postives = 172/295 (58.31%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNND-----SELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSS----VQNQLKLNINPNQEPSADEDVSDED----FYDAFESQEGVFNVTLPSPEINLG 959
            +G+L+KWTNY+KGYQ+RWFVL NGLLSYYR+++EM   CRGTIN+  A I + DS +F+IS+ G QT+HLK+ +E E +RW +AL  A+ KA  +L   D +      S+ D  EL N  +  L+  +ED+    D++ +    LQ+S+ +L+  K   +  E   K+K + ERAT+FR+++ +++ +C  +       ++KW+K +  ER+QR R+E  +E LAKQH HLE     +               +Q  S   D+SDED    F+DA E       +T+P    NLG
Sbjct:   94 EGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVKMLAESDESGDEESVSQTDKTELQN-TLRTLSSKVEDLSTCNDLIAKHGTALQRSLSELESLK---LPAESNEKIKQVNERATLFRITSNAMINACRDFLVLAQTHSKKWQKSLQYERDQRIRLEETLEQLAKQHNHLERAFRGATVLPAHTSGSAGSGKDQCCSGKGDMSDEDDENEFFDAPEI------ITMPE---NLG 375          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|Q3B7Z2|OSBP1_MOUSE (Oxysterol-binding protein 1 OS=Mus musculus OX=10090 GN=Osbp PE=1 SV=3)

HSP 1 Score: 432.95 bits (1112), Expect = 1.588e-137
Identity = 216/410 (52.68%), Postives = 284/410 (69.27%), Query Frame = 3
Query: 1314 SKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCES-NEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVIS----NTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQR----SRRVEILKL--DGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +K+ +RT+IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EY  +LD+AA C+N +EQ+ YVAAFTVSSY+ T +R +KPFNPLLGET+ELDR ++ G+R   EQ+ HHPP+ A H ES N W    +  +++KFRGKY+ I P+G  H +F  + +HY W+++  T+HNIIVG++WID  GE+DI+N  T DKC+L + PYS FS D  ++VTG +TD    V   L GTWDEK++   V +    N    + R + A E+S ++LW+R PLP N +  YYFS  A+TLN  E   APTDSR RPDQ+LME G+WDEAN EK RLEE+QR     R  E  K   DGT      YK LWF+   DP  +  T+ ++G+YWECK K+DW  C  IF
Sbjct:  399 TKKEKRTRIPYKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDRAAKCENSLEQLCYVAAFTVSSYSTTVFRTSKPFNPLLGETFELDRLEENGYRSICEQVSHHPPAAAHHAESKNGWTLRQEIKITSKFRGKYLSIMPLGTIHCIFHSTGHHYTWKKVTTTVHNIIVGKLWIDQSGEIDIVNHKTGDKCNLKFVPYSYFSRDVARKVTGEVTDPSGKVHFALLGTWDEKMDCFKVQAASGENGGDARQRGHEA-EDSRVMLWKRNPLPKNAENMYYFSELALTLNAWEGGTAPTDSRLRPDQRLMENGRWDEANAEKQRLEEKQRLSRKKREAEAAKATEDGTPH--DPYKALWFERKKDPVTRELTHIYSGEYWECKEKQDWGSCPDIF 805          

HSP 2 Score: 186.037 bits (471), Expect = 1.749e-47
Identity = 116/299 (38.80%), Postives = 175/299 (58.53%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNND-----SELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINP--------NQEPSADEDVSDED----FYDAFESQEGVFNVTLPSPEINLG 959
            +G+L+KWTNY+KGYQ+RWFVL NGLLSYYR+++EM   CRGTIN+  A I + DS +F+IS+ G QT+HLK+ +E E +RW +AL  A+ KA  +L   D++      S+ D  EL    +  L+  +ED+    D++ +    LQ+S+ +L+  K   +  E   K+K + ERAT+FR+++ +++ +C  +       ++KW+K +  ER+QR R+E  +E LAKQH HLE     +      L  NP        +Q  S   D+SDED    F+DA E       +T+P    NLG
Sbjct:   90 EGWLFKWTNYIKGYQRRWFVLSNGLLSYYRSKAEMRHTCRGTINLATANITVEDSCNFIISNGGAQTYHLKASSEVERQRWVTALELAKAKAVKMLAESDDSGDEESVSQTDKTEL-QSTLRTLSSKVEDLSTCNDLIAKHGTALQRSLSELESLK---LPAESNEKIKQVNERATLFRITSNAMINACRDFLMLAQTHSKKWQKSLQYERDQRIRLEETLEQLAKQHNHLERAFRGATV----LPANPPGSAGSGKDQCCSGKGDMSDEDDENEFFDAPEI------ITMPE---NLG 371          
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Match: sp|Q5QNQ6|OSBP2_MOUSE (Oxysterol-binding protein 2 OS=Mus musculus OX=10090 GN=Osbp2 PE=1 SV=1)

HSP 1 Score: 434.491 bits (1116), Expect = 5.494e-137
Identity = 207/420 (49.29%), Postives = 280/420 (66.67%), Query Frame = 3
Query: 1278 NIATFSEVIPIRS-KRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEE-SSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVE-----ILKLDGTKEFVYE-YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            N+   +  +P  S K  RR +IP KPN ++NLWS++KNCIG++LS+IPMPVNF+EP+SMLQRL ED EY  +LDKA +C + +EQ+  VAAF+VSSY+ T +RI KPFNP+LGET+ELDR +D G R   EQ+ HHPPS A H  S   W  W + ++++KFRGKYI I P+G  HL F+ S  HYVW +   T+HNIIVG++WID  G+++I+N  T+D+C L + PYS FS +  ++VTG ++D       VL+G+WD+++E   ++ ++ +  GR     +   + LLW++YPLP N +  YYFS  A+TLNE E+ +APTDSR RPDQ+LME G+WDEAN EK RLEE+QR  R            G +E   + Y PLWF+   DP        + G YWE K KKDW MC  IF
Sbjct:  489 NVLDGASFMPKNSCKVKRRVRIPDKPNYSLNLWSIMKNCIGRELSRIPMPVNFNEPLSMLQRLTEDLEYHHLLDKAVNCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFNPMLGETFELDRMEDMGLRSLCEQVSHHPPSAAHHVFSKHGWSLWQEITIASKFRGKYISIMPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTKDRCQLKFVPYSYFSKEAARKVTGVVSDSQGKAHYVLSGSWDDQMECSKIVHSSPSSDGRQKTVYQTLPAKLLWRKYPLPENAENMYYFSELALTLNEQEDGVAPTDSRLRPDQRLMERGRWDEANTEKQRLEEKQRLSRRRRLESCTAGCGGEEEKESDGYVPLWFEKRLDPLTGEMACMYKGGYWEAKEKKDWHMCPNIF 908          

HSP 2 Score: 157.918 bits (398), Expect = 2.879e-38
Identity = 94/240 (39.17%), Postives = 142/240 (59.17%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXX-------------GCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLE 794
            KG+L KWTNYLKGYQ+RWFVL NGLLSYYRNQ EMA  CR TIN+ +      DS   ++ + G +T+HLK+ +E + + W +AL  A+ KA  ++K                 ++SEL  +  +    LKLN    D+    D++ +    LQ+S+++LD  K  +  GE   KLK + ERAT+FR+++ +++ +C  + E     + KW++ ++ E+EQR  +E  +E LAKQH  LE
Sbjct:  183 KGWLLKWTNYLKGYQRRWFVLGNGLLSYYRNQGEMAHTCRATINLASTHFETEDSCGILLCN-GARTYHLKASSEVDRQHWITALELAKAKAIRVMKTQSDDSGDDDEEPAAPADNSEL--HHTLKTLSLKLN----DLSTCNDLIAKHGAALQRSLNELDSLKIPSECGE---KLKVVNERATLFRITSNAMINACRDFLELAETHSRKWQRALNYEQEQRVHLEETIEQLAKQHNSLE 412          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: A0A504XP16 (Oxysterol-binding protein OS=Fasciola gigantica OX=46835 GN=FGIG_00040 PE=3 SV=1)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 378/884 (42.76%), Postives = 522/884 (59.05%), Query Frame = 3
Query:  108 NIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXX-------------------------------XGCDNNDSEL--------DSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVTLPSPEINLGVSLPSRCXXXXXXXXXXXXXXXXXXXXXXXXXNCSRNYTDNFFIGDSSTRGFE-EVSNKRSLQRLKEARVISAKQSNQLKNRQKLITASSNNMHKPINLVSLTYNTSNIA--TFSEVIPIRS-KRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVY----------------------------------------EYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +++G+L+KWTNY+KGYQKRWF+LQNGLLSYYRNQ+EMA  CRGTIN+ NA +    ST+F+IS+S  QTFHLK+  ESE K W S LL A+ KA  L                                   D++D E         D+  LVN  + K+  HL D+++ Q+ L  K DDLQ+S+ DL+  ++     E   +   ++ER+T+F V++ +++ +CA +A S   +  +WR++ +S+RE+   +E M+E+LAKQ R LE  +    QN L  ++  +   ++D   S                          G++  S  +  S            + +   S  + +  Y  + +  D      E ++  +++ + L+EARVI  +          L+ +   +  +  +L S      N    T + ++P RS  R RRT IPP+PN ++NLWS++KNCIGK+L+KIPMPVNFSEP+SMLQRL EDFEYSS LD+AA CQ+ +EQ+++VAAFTVS+YA TA R+NKPFNPLLGETYE DRTDD GWR  AEQ+ HHPP CA+HCESN W CWF+FSM+ KFRGKY+QI+P+G CHL+F+ + +HY W++IP+T+HNIIVGR+WIDN GEMDIIN +T +KCHLSYK YS FS++TP+RVTGAITDK   V  VLNGTWDE +E   V++  +   G+  L T  + I  WQR PLPP+ ++ +YF+ FA+ LNE E  + PTD R RPDQ+LME GKWDEAN+EK  LEE+QR RR +I      K                                             ++P+WF+   D +     + FNGKYWE K  +DWSMC  I+
Sbjct:    8 SLRGFLFKWTNYIKGYQKRWFILQNGLLSYYRNQAEMAHTCRGTINLANATVASTGSTTFLISNSSTQTFHLKAACESEQKMWVSVLLTAKSKALALRKYGKLFCSFLRVIFRISVNLERRLSDDSDVYTEGDDDDVEYKNSSMSADDAMRLVNQLLAKMEQHLVDLQRHQETLGHKGDDLQRSLADLETARDPT---EATQRFSVVRERSTVFGVASLAMVNACAEFASSGRRQTHRWRRIFNSQRERCALLEQMIEELAKQLRQLETLVK---QNNLHTSLQLSTGGTSDRTES--------------------------GMASSSHLTGRSDSASMMSTSLGDENNGIPSVNDVAYEYESDVYGSDDDEDDAENQMKVQKTRKPLREARVIQPRMRRHDSRSATLVPSGDRSSDRKSDLNSELSQAQNETRNTDTTLVPTRSLSRPRRTTIPPRPNYSLNLWSIMKNCIGKELTKIPMPVNFSEPLSMLQRLTEDFEYSSCLDRAAQCQDTLEQMAHVAAFTVSAYATTAVRVNKPFNPLLGETYECDRTDDRGWRSLAEQVSHHPPKCALHCESNAWYCWFEFSMNTKFRGKYLQINPVGTCHLVFRNTGHHYTWQKIPLTVHNIIVGRLWIDNSGEMDIINHSTGEKCHLSYKAYSYFSSETPRRVTGAITDKSGAVRYVLNGTWDESMEYAPVVTTRQPRNGKPILETGPARI-AWQRNPLPPDSERMHYFTLFALQLNEEEPGVCPTDCRLRPDQRLMEVGKWDEANREKVVLEEKQRHRRRQIAASLAAKTLGLPDAASGHSDVNPSRRGSVAQSDISALTPSVVSSFLDQADSAHRPMWFERQFDQDTGEAIFAFNGKYWEKKVIQDWSMCPDIY 858          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: A0A564YHR5 (Oxysterol-binding protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS6057 PE=3 SV=1)

HSP 1 Score: 697.967 bits (1800), Expect = 0.000e+0
Identity = 396/893 (44.34%), Postives = 524/893 (58.68%), Query Frame = 3
Query:  102 SSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSEL-------------------DSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPS------------------------------------------ADEDVSDEDFYDAFE-SQEGVFNVTLPSPEINLGVSLPSRCXXXXXXXXXXXXXXXXXXXXXXXXXNCSRNYTDNFFIGDSSTRGFEEVSNKRSLQRLKEARVISAKQSNQLKNRQKLITASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLN---EIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEI-LKLDGTK------------------------EFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            S+N+KGYL KWTNYLKGYQKRWFVLQNGLLSYYRNQ+E+   CRGTIN+ NAKI      + VIS+S  QTFHLK+ NE E K+W +AL   +  A  L K  +++D                      D+ +LV G I      + D++  QD L RK D+LQK I+DL+    S+I  ++A K+  +++RAT+++V++ ++  SC+ + E    +  +WRK+ +++ ++R R+E MVE+LAKQ   LE Q+ S   N     I P Q  +                                          A ED  D DFYDA E +    F+V LPS         P   S+ + E E  V+   S  SD   G + +  Y  +    D+  +G  +  N+        A VI  K +     R    T SS+               S  A    +IP+R    RRT IPPKPNI++NLWS + NCIGK+L+KIPMPVNFSEP+SMLQRL+E+FEYS +LD+AA+C NP+EQ++YV+AF VSSYA+TA R+ KPFNPLL ETYE DRTDD GWR  AEQ+ HHPP  A HCES+ W  WFDFS+S KFRG+Y+QI   G CHL+F+++ YHY W +IP+T+HNIIVGR+WI+N GE+DIIN TT DKCHL++K YS FS++ P+RVTGA+TDK   V  ++ GTWDE +E   VI++      +  + T    + LW+  PLPP  DK Y F+ FA+ LN   E E ++ PTDSR RPDQ+LMEEG WDEAN EK RLEE+QR RR E+ LKL GT                              +KPLWF+ V D +   +T KFNGKYW+CK K DWS+C  ++
Sbjct:    6 SANLKGYLLKWTNYLKGYQKRWFVLQNGLLSYYRNQAEVTHTCRGTINLANAKIVSAGHLTLVISNSSTQTFHLKATNEMEQKKWMAALTMGKANALSLGKSGNDSDDWDEADDDESDLAWSAPRLMPEDAAKLVEGAISNFESRIGDLQHYQDTLKRKADELQKVINDLE---GSDISSDLAEKISIVQDRATVYKVASLAMANSCSDFLEFARSQMRRWRKIFNTQVDRRARLEQMVEELAKQINKLESQVRSKSMNPGNWGI-PGQAVAVRRTSAETARARGATLSSNHGNSVRLTTDGSSSGPPGISSAIASEDEED-DFYDAAEDAGADEFDVILPSTN---SCPYPGPLSQTAAEKEGMVDARQSQTSDVPVGADVNMEYESDIEDSDTDDQGKGQQENR--------AHVIQ-KHAWGKAGRSPKETGSSSYA-----------GPSRSAPEKRIIPVRKPVQRRTSIPPKPNISLNLWSFLSNCIGKELTKIPMPVNFSEPLSMLQRLSENFEYSYVLDRAAACTNPLEQLAYVSAFVVSSYASTALRVAKPFNPLLNETYECDRTDDLGWRSVAEQVSHHPPVAAFHCESDLWYTWFDFSISTKFRGRYLQIKVNGVCHLVFRKTGYHYTWTKIPLTVHNIIVGRLWIENSGEIDIINHTTGDKCHLTFKQYSYFSSEVPRRVTGAVTDKTGKVHGIIGGTWDEFIEYAPVITDNTGSSNKHVIETG-PPVQLWRVSPLPPGADKMYNFTQFAMQLNNRPEDEPNLCPTDSRLRPDQRLMEEGLWDEANAEKVRLEEKQRMRRREMALKLLGTDGADSAAAVGGSVASSTPLPAALMDTLDQTHKPLWFEKVVDEDTGLETLKFNGKYWKCKEKNDWSVCPDLY 869          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: A0A0R3X2E0 (Oxysterol-binding protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS7436 PE=3 SV=1)

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 374/878 (42.60%), Postives = 521/878 (59.34%), Query Frame = 3
Query:  102 SSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYY-RNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRW-TSXXXXXXXXXXXXXXGCDNNDSEL-----------------DSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNI-----NPNQE-----------------------------PSADEDVS------DEDFYDAFESQEGVFNVTLPSPEINLGVSLPSRCXXXXXXXXXXXXXXXXXXXXXXXXXNCSRNYTDNFFIGDSSTRGFEEVSNKRSLQRLKEARVISAKQSNQLKNRQKLITASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEI---EEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKL--------DGTKEFVYE-----YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            SSN+KGYL KWTNY+KGYQKRWFVLQNGLLSYY RNQSE+   CRGTIN+ NAKI      + VIS+S  QTFHLK+ NE E K+W T+  +           G D++D +                  D   LV   +      + D++  Q+ L RK D+LQ+SI++LD     N+  +    + N+ ++AT+++V++ +++ SC+ + +    + ++WR++  ++ ++R  +E MVE+LAKQ R LE Q  +   +   + I      P Q                              P A   VS      ++DFYDA + +   F+V LP+      ++  S  ++++L   S     +      +   + +    D+   GD+     EE    +   R K+A VI          R    +A   ++   I   S      ++A    +IP+R    RRT IPPKPNI++NLWS++ NCIGK+L+KIPMPVNFSEP+SMLQRL+E+FEYS +LD+AA+C +P+EQ++YV+AF VSSYA+TA R+NKPFNPLL ETYE DRTDD GWR  AEQ+ HHPP  A HCES+ W  WFDFS+S KFRG+Y+QI   G CHL+F+++ YHY W +IP+T+HNIIVG++WI+N GE+DI N  T DKCHL++KPYS FS+D P+RVTGA++DK   V  ++NGTWDE +E   V+++  +  G   +      + LW+  PLPP  DK Y F+ FAI LN+    E ++ PTDSR RPDQ+LMEEG WDEAN EK RLEE+QR RR ++  +        DG    V +     +KPLWF+   DP+   +T KF G+YWE KAK DWSMC  +F
Sbjct:    7 SSNLKGYLLKWTNYIKGYQKRWFVLQNGLLSYYSRNQSEVTHTCRGTINLANAKIVSTGHLTLVISNSSSQTFHLKAANEIEQKKWMTALTMGKANALALGKSGDDSDDWDDGEDDNDIAWSSPRLVPEDGARLVEHALSHFENRINDLQHYQETLKRKADELQRSINELDA---CNLPPDQIEIICNVMDKATVYKVASLAMVNSCSDFLDFARTQTKRWRRIFSAQVDRRAHLEQMVEELAKQIRKLEIQARNKSMHSGGVCILRSWAIPGQAVLVRRTSTETTRTRSTTLGACSGGGSGLPPCASTAVSSITSDDEDDFYDAQDVEGCEFDVILPTTS-TFAIAEKSSMTDIALPNSSTASIPVGSDLAMEYESDTA----DSDLGGDA-----EETEKGQQKFRGKQAHVIQ----KHAWGRAGRASAQPESLPAVIPGKSGAEAGVSVAADRRIIPVRKPVQRRTTIPPKPNISLNLWSILSNCIGKELTKIPMPVNFSEPLSMLQRLSENFEYSYVLDRAATCADPVEQLAYVSAFVVSSYASTALRVNKPFNPLLNETYECDRTDDLGWRSLAEQVSHHPPVAAFHCESDLWYTWFDFSISTKFRGRYLQIKVNGVCHLVFRKTGYHYTWTKIPLTVHNIIVGKLWIENSGEIDITNHKTGDKCHLTFKPYSYFSSDIPRRVTGAVSDKSGKVHGIINGTWDEFIEYAPVVTDKLSTGGEKPVLETGPPVQLWRVSPLPPEADKMYNFTQFAIQLNDKPNNEPNLCPTDSRLRPDQRLMEEGFWDEANVEKVRLEEKQRLRRRQMALMLINRESSSDGASSTVADTLDEAHKPLWFEKEVDPDTGLETMKFTGRYWEIKAKNDWSMCPDLF 867          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: W6UQH0 (Oxysterol-binding protein OS=Echinococcus granulosus OX=6210 GN=EGR_01540 PE=3 SV=1)

HSP 1 Score: 683.715 bits (1763), Expect = 0.000e+0
Identity = 377/884 (42.65%), Postives = 523/884 (59.16%), Query Frame = 3
Query:  102 SSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSEL------------------DSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQI--------SSSVQNQLKL--------------------NINPNQEPSADEDVS------DEDFYDAFESQEGVFNVTLPSPEINLGVSLPSRCXXXXXXXXXXXXXXXXXXXXXXXXXNCSRNYTDNFFIGDSSTRGFEEVSNKRSLQRLKEARVISAKQSNQLKNRQKLITASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEI---EEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEI-LKL-------DGTKEFVY------------------EYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            SSN++GYL KWTNY+KGYQ+RWFVLQNGLLSYYRNQSE+   CRGTIN+ NAKI      + VIS+S  QTFHLK+ NE E K+W +AL   +  A  L K  D++D                     D   LV   +      + D++  QD L RK DDLQ+SI++LD     N+  ++  K+ N+ ++AT+++V++ +++ SC+ +      + ++WR++ +++ ++R  +E M+E+LAKQ R LE Q         S ++  Q  L                           P A   VS      ++DFYDA + ++  F+V LP+   +     PS  +  S    + +        + +S      +  D+   GD+     +E    +   R K+A VI  K +     R      S  ++      V     TS +A    +IP+R    RRT IPPKPNI++NLWS++ NCIGK+L+KIPMPVNFSEP+SMLQRL+E+FEYS +LD+AA+C +P+EQ++YV+AF VSSYA+TA R+NKPFNPLL ETYE DRTDD GWR  AEQ+ HHPP  A HCES+ W  WFDFS+S KFRG+Y+QI   G CHL+F+++ YHY W +IP+T+HNIIVG++WI+N GE+DI N  T DKCHL++KPYS FS+D  +RVTGA++D+   V  ++NGTWDE +E   V++NT +  G   +      + LW+  PLPP  DK Y F+ FAI LN+    E ++ PTDSR RPDQ+LMEEG WDEAN EK RLEE+QR RR ++ LKL       DG                         +KPLWF+   DP+   +T +F G+YWE K K +WSMC  ++
Sbjct:    7 SSNLRGYLLKWTNYIKGYQRRWFVLQNGLLSYYRNQSEVTHTCRGTINLANAKIVSTGHLTLVISNSSSQTFHLKAANEIEQKKWMTALTMGKADALALGKSGDDSDDWDDGEDENDIAWSSPRLMPEDGARLVEHALSHFENRVNDLQHYQDTLKRKADDLQRSINELDA---CNLPPDLIEKICNVMDKATVYKVASLAMVNSCSDFLGFARTQTKRWRRIFNAQVDRRAHLEQMIEELAKQIRKLEIQARNKSVHSGSWAIPGQAVLVRRTSTETTRTRSTTLGTCSGGGAGLPPCASTAVSSITSDDEDDFYDAQDVEDCEFDVILPTTSTSAVTEKPSMINAASPSSTASIPVGTDLAMEYES------DTADSELEGDT-----DETEKGQQKFRGKQAHVIQ-KHTWGRAGRASAQPESPPSVAP--GKVGAEAGTS-VAPERRIIPVRKPVQRRTTIPPKPNISLNLWSILSNCIGKELTKIPMPVNFSEPLSMLQRLSENFEYSYVLDRAAACADPLEQLAYVSAFVVSSYASTALRVNKPFNPLLNETYECDRTDDLGWRSVAEQVSHHPPVAAFHCESDLWYTWFDFSISTKFRGRYLQIKVNGVCHLVFRKTGYHYTWTKIPLTVHNIIVGKLWIENSGEIDITNHKTGDKCHLTFKPYSYFSSDIARRVTGAVSDRSGKVHGIINGTWDEFIEYAPVVTNTLSTGGEKPILETGPPVQLWRVSPLPPEADKMYNFTQFAIQLNDRPDNEPNLCPTDSRLRPDQRLMEEGLWDEANVEKVRLEEKQRLRRRQMALKLINKESSSDGAPSTAGTSASSANVPASLMDTLDEAHKPLWFEKGVDPDTGLETMRFTGRYWESKEKNNWSMCPDLY 872          
BLAST of Oxysterol-binding protein vs. TrEMBL
Match: R7TZ29 (PH domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_179200 PE=4 SV=1)

HSP 1 Score: 679.863 bits (1753), Expect = 0.000e+0
Identity = 367/817 (44.92%), Postives = 501/817 (61.32%), Query Frame = 3
Query:  102 SSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNND---SELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVTLP---SPEINLGVSLPSRCXXXXXXXXXXXXXXXXXXXXXXXXXNCSRNYTDNFFIGDS--STRGFEEVSNKRSLQRLKEARVISAKQSNQLKNRQKLITASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESN--EWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKL---DGTKEFVYE-YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            S   KG++YKWTNY+KGYQKRWFVLQNGLLSYYRNQ+EM+  CRGTIN+ NA I+  DS SFVIS+ G QTFHLK+ +E E +RW +AL  A+ KA +LL+  D ++   ++ D NEL N  I  L+  LED+    D++ +    LQK++ +L++ + ++   E + K K++ ERAT+FR+++ +++ +C  Y E    + ++W+K++ SE EQ+ R+E MVE LAKQH+ +E Q   S+ +    +    Q     ED  D DF+DA +     F V LP         G+S+ S                                      IG++   T    + S+  S  R  EA+VIS K  ++  + +  +     +   P    SLT          +V    SKR RR  IP +PN ++NLWS++KNCIGK+LSKIPMPVNFSEP+S LQR+ EDFEYS  L KAA C +  EQ++Y+AAFT+SSYA T  R  KPFNPLLGET+E DR DD GWR FAEQ+ HHPP  A+H ES   +W  W +F+MS+KFRGKY+QI P+G  HLLF ++  HY W ++  T+HNIIVG++W+DNHGEMDI N    D CHL Y  YS F+ +TP++VTG ITD       VL GTWDE++EA  VI   E+ KG+    T E+ ++  +RYP     +K Y+F+  A+ LNEIEE +APTDSRNRPDQ++MEEG+WDEAN++K  LEE+QR+ R E  +        E  Y+ Y+P WF    DP   +  Y + G+YW+CK K DWS C  I+
Sbjct:    9 SDQYKGWVYKWTNYIKGYQKRWFVLQNGLLSYYRNQAEMSHTCRGTINLANAFIHTEDSCSFVISNGGTQTFHLKASSEVERQRWVTALELAKNKAINLLESDDEDEETHTQPDKNELQN-TIRTLSAKLEDLSTCNDLITKHGAALQKALGELEQIEAAS---EASAKFKSVNERATLFRITSNAMINACHDYLELAQTQGKRWQKLLQSEHEQKLRLEEMVEQLAKQHQSIEKQARKSLAHANHSSSGNTQGAEGSEDEED-DFFDAVDDHTEEFKVCLPPQTHKRTGSGISVDS--------------------------------------IGETLGPTADNYDSSDTDSESRGAEAKVISHKHGHKRTHSRDQMLKEGGSSSMPSTPNSLT----------KVAHPGSKRQRRMLIPERPNYSINLWSIMKNCIGKELSKIPMPVNFSEPLSFLQRITEDFEYSECLMKAAQCTDSCEQLAYIAAFTISSYANTTARTGKPFNPLLGETFECDRRDDMGWRSFAEQVSHHPPILAMHTESKDRDWSSWQEFTMSSKFRGKYLQIIPLGIAHLLFPKTGNHYTWRKVTTTVHNIIVGKLWVDNHGEMDITNHHNGDNCHLKYSAYSYFARETPRKVTGVITDASGQARWVLQGTWDERVEAAKVIKTVESGKGKIVYETAEAKVMWQRRYP-SKELEKCYFFTELAVQLNEIEEGVAPTDSRNRPDQRMMEEGRWDEANEKKVLLEEKQRTVRREREREASDAAANEAEYQGYEPKWFRKDIDPVTGNPAYVYTGEYWDCKEKGDWSRCPDIY 771          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbp (oxysterol binding protein [Source:NCBI gene;Acc:103044970])

HSP 1 Score: 444.891 bits (1143), Expect = 7.626e-145
Identity = 212/414 (51.21%), Postives = 279/414 (67.39%), Query Frame = 3
Query: 1296 EVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTE----TVKGRTYLATEE-SSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVY---EYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            EV+P+R +RTR   IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EPISMLQRL+ED EYS +LD+ A CQ+ +EQ+ YVAAFTVSSY+ T +R  KPFNPLLGET+ELDR  + G+R   EQ+ HHPP+ A H  S   W    + ++++KFRGKY+ I P+G  H +F +S  HY W+++  T+HNIIVG++WID  GE+D+IN  T D+CHL + PYS FS D  ++VTG +TDK      VL+GTWDEK+E   V+ ++       +GR     +   +  LW++ PLP   +  YYF+  A+TLNE E+ +APTDSR RPDQ+LME+G WDEAN EK RLEE+QRS R E  +    KE       Y  LWF+ V D      T+ + G YWE K +  W  C  IF
Sbjct:  255 EVVPVRKRRTR---IPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPISMLQRLSEDLEYSELLDRGAKCQSSLEQLCYVAAFTVSSYSTTVHRTGKPFNPLLGETFELDRLQESGYRSLCEQVSHHPPAAAHHVISERGWTLRQEITVASKFRGKYLSIMPLGSIHCIFDKSNNHYSWKKVTTTVHNIIVGKLWIDQSGEIDVINHRTGDRCHLKFAPYSYFSRDVARKVTGVVTDKDGKAHYVLSGTWDEKMECSRVMQSSRGGENGTEGRQKTVYQTLKARELWRKNPLPEGAENMYYFTQLALTLNEQEDGVAPTDSRRRPDQRLMEQGMWDEANAEKQRLEEKQRSVRREREREAWAKEHGAPQDNYTALWFEQVVDEATGEPTHIYKGGYWETKEQGTWENCPDIF 665          

HSP 2 Score: 137.502 bits (345), Expect = 4.309e-33
Identity = 79/242 (32.64%), Postives = 139/242 (57.44%), Query Frame = 3
Query:  216 MAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVTLPS 941
            M   CRGTIN+  A I + DS +FVIS+ G QT+HLK+ +E E +RW +AL  A+ KA  +    ++  S+L   E V   +  L   +ED+    D++ +    LQ+S+ +L+  K   + G+ + K++ + ERAT+FR+++ +++ +C  +       +++W+K + +ER+QR R+E  +E LAKQH HLE     +       +  P +  ++D+D  D +F+DA E  +    +T+P+
Sbjct:    1 MGHTCRGTINLATANIAVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKAKAVRMQ--AESGQSQLGFTEGVQSTLRTLGSKVEDLSTCNDLIAKHGSALQRSLSELEGVK---LGGDTSDKIRQVTERATLFRITSNAMINACRDFLALAQAHSKRWQKALQAERDQRVRLEETLEQLAKQHNHLERAFRGATVLPASPSSGPGKGDASDDD--DNEFFDACEDVQEF--ITIPA 233          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbp (oxysterol binding protein [Source:NCBI gene;Acc:103044970])

HSP 1 Score: 437.958 bits (1125), Expect = 5.351e-141
Identity = 211/418 (50.48%), Postives = 278/418 (66.51%), Query Frame = 3
Query: 1296 EVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTE----TVKGRTYLATEE-SSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYE-------YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            EV+P+R +RTR   IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EPISMLQRL+ED EYS +LD+ A CQ+ +EQ+ YVAAFTVSSY+ T +R  KPFNPLLGET+ELDR  + G+R   EQ+ HHPP+ A H  S   W    + ++++KFRGKY+ I P+G  H +F +S  HY W+++  T+HNIIVG++WID  GE+D+IN  T D+CHL + PYS FS D  ++VTG +TDK      VL+GTWDEK+E   V+ ++       +GR     +   +  LW++ PLP   +  YYF+  A+TLNE E+ +APTDSR RPDQ+LME+G WDEAN EK RLEE+QRS R E  +         E       Y  LWF+ V D      T+ + G YWE K +  W  C  IF
Sbjct:  347 EVVPVRKRRTR---IPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPISMLQRLSEDLEYSELLDRGAKCQSSLEQLCYVAAFTVSSYSTTVHRTGKPFNPLLGETFELDRLQESGYRSLCEQVSHHPPAAAHHVISERGWTLRQEITVASKFRGKYLSIMPLGSIHCIFDKSNNHYSWKKVTTTVHNIIVGKLWIDQSGEIDVINHRTGDRCHLKFAPYSYFSRDVARKVTGVVTDKDGKAHYVLSGTWDEKMECSRVMQSSRGGENGTEGRQKTVYQTLKARELWRKNPLPEGAENMYYFTQLALTLNEQEDGVAPTDSRRRPDQRLMEQGMWDEANAEKQRLEEKQRSVRREREREAVRLASTAEEGAPQDNYTALWFEQVVDEATGEPTHIYKGGYWETKEQGTWENCPDIF 761          

HSP 2 Score: 193.741 bits (491), Expect = 3.270e-51
Identity = 112/305 (36.72%), Postives = 176/305 (57.70%), Query Frame = 3
Query:   96 TLSSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSELDS------------NELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADE--------DVSDED---FYDAFESQEGVFNVTLPS 941
            T     KG+L+KWTNY+KGYQ+RWFVL NGLLSYYR Q+EM   CRGTIN+  A I + DS +FVIS+ G QT+HLK+ +E E +RW +AL  A+ KA  +    D++  E  +            N  V   +  L   +ED+    D++ +    LQ+S+ +L+  K   + G+ + K++ + ERAT+FR+++ +++ +C  +       +++W+K + +ER+QR R+E  +E LAKQH HLE     + +    L  +P+  P+AD         D SD+D   F+DA E  +    +T+P+
Sbjct:   10 TPGDTYKGWLFKWTNYIKGYQRRWFVLSNGLLSYYRTQAEMGHTCRGTINLATANIAVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKAKAVRMQAESDDSGDECSTSPPSAGQGLGARNSEVQSTLRTLGSKVEDLSTCNDLIAKHGSALQRSLSELEGVK---LGGDTSDKIRQVTERATLFRITSNAMINACRDFLALAQAHSKRWQKALQAERDQRVRLEETLEQLAKQHNHLE----RAFRGATVLPASPSN-PTADSKGSGPGKGDASDDDDNEFFDACEDVQEF--ITIPA 304          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbp (oxysterol binding protein [Source:NCBI gene;Acc:103044970])

HSP 1 Score: 435.261 bits (1118), Expect = 1.016e-139
Identity = 213/431 (49.42%), Postives = 281/431 (65.20%), Query Frame = 3
Query: 1296 EVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTE----TVKGRTYLATEE-SSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILK-----LDGTKEFVYE---------------YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            EV+P+R +RTR   IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EPISMLQRL+ED EYS +LD+ A CQ+ +EQ+ YVAAFTVSSY+ T +R  KPFNPLLGET+ELDR  + G+R   EQ+ HHPP+ A H  S   W    + ++++KFRGKY+ I P+G  H +F +S  HY W+++  T+HNIIVG++WID  GE+D+IN  T D+CHL + PYS FS D  ++VTG +TDK      VL+GTWDEK+E   V+ ++       +GR     +   +  LW++ PLP   +  YYF+  A+TLNE E+ +APTDSR RPDQ+LME+G WDEAN EK RLEE+QRS R E  +         +E V E               Y  LWF+ V D      T+ + G YWE K +  W  C  IF
Sbjct:  347 EVVPVRKRRTR---IPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPISMLQRLSEDLEYSELLDRGAKCQSSLEQLCYVAAFTVSSYSTTVHRTGKPFNPLLGETFELDRLQESGYRSLCEQVSHHPPAAAHHVISERGWTLRQEITVASKFRGKYLSIMPLGSIHCIFDKSNNHYSWKKVTTTVHNIIVGKLWIDQSGEIDVINHRTGDRCHLKFAPYSYFSRDVARKVTGVVTDKDGKAHYVLSGTWDEKMECSRVMQSSRGGENGTEGRQKTVYQTLKARELWRKNPLPEGAENMYYFTQLALTLNEQEDGVAPTDSRRRPDQRLMEQGMWDEANAEKQRLEEKQRSVRREREREAVRLASTAEEAVIEDSITDSPLKSAPQDNYTALWFEQVVDEATGEPTHIYKGGYWETKEQGTWENCPDIF 774          

HSP 2 Score: 193.741 bits (491), Expect = 3.731e-51
Identity = 112/305 (36.72%), Postives = 176/305 (57.70%), Query Frame = 3
Query:   96 TLSSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSELDS------------NELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADE--------DVSDED---FYDAFESQEGVFNVTLPS 941
            T     KG+L+KWTNY+KGYQ+RWFVL NGLLSYYR Q+EM   CRGTIN+  A I + DS +FVIS+ G QT+HLK+ +E E +RW +AL  A+ KA  +    D++  E  +            N  V   +  L   +ED+    D++ +    LQ+S+ +L+  K   + G+ + K++ + ERAT+FR+++ +++ +C  +       +++W+K + +ER+QR R+E  +E LAKQH HLE     + +    L  +P+  P+AD         D SD+D   F+DA E  +    +T+P+
Sbjct:   10 TPGDTYKGWLFKWTNYIKGYQRRWFVLSNGLLSYYRTQAEMGHTCRGTINLATANIAVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKAKAVRMQAESDDSGDECSTSPPSAGQGLGARNSEVQSTLRTLGSKVEDLSTCNDLIAKHGSALQRSLSELEGVK---LGGDTSDKIRQVTERATLFRITSNAMINACRDFLALAQAHSKRWQKALQAERDQRVRLEETLEQLAKQHNHLE----RAFRGATVLPASPSN-PTADSKGSGPGKGDASDDDDNEFFDACEDVQEF--ITIPA 304          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbp (oxysterol binding protein [Source:NCBI gene;Acc:103044970])

HSP 1 Score: 429.869 bits (1104), Expect = 1.925e-137
Identity = 215/448 (47.99%), Postives = 282/448 (62.95%), Query Frame = 3
Query: 1296 EVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTE----TVKGRTYLATEE-SSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEI------------------------LKLDGTKEFVYE-------------YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            EV+P+R +RTR   IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EPISMLQRL+ED EYS +LD+ A CQ+ +EQ+ YVAAFTVSSY+ T +R  KPFNPLLGET+ELDR  + G+R   EQ+ HHPP+ A H  S   W    + ++++KFRGKY+ I P+G  H +F +S  HY W+++  T+HNIIVG++WID  GE+D+IN  T D+CHL + PYS FS D  ++VTG +TDK      VL+GTWDEK+E   V+ ++       +GR     +   +  LW++ PLP   +  YYF+  A+TLNE E+ +APTDSR RPDQ+LME+G WDEAN EK RLEE+QRS R E                         LK D   EF  +             Y  LWF+ V D      T+ + G YWE K +  W  C  IF
Sbjct:  347 EVVPVRKRRTR---IPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPISMLQRLSEDLEYSELLDRGAKCQSSLEQLCYVAAFTVSSYSTTVHRTGKPFNPLLGETFELDRLQESGYRSLCEQVSHHPPAAAHHVISERGWTLRQEITVASKFRGKYLSIMPLGSIHCIFDKSNNHYSWKKVTTTVHNIIVGKLWIDQSGEIDVINHRTGDRCHLKFAPYSYFSRDVARKVTGVVTDKDGKAHYVLSGTWDEKMECSRVMQSSRGGENGTEGRQKTVYQTLKARELWRKNPLPEGAENMYYFTQLALTLNEQEDGVAPTDSRRRPDQRLMEQGMWDEANAEKQRLEEKQRSVRREREREAVRLASTAEEAVIEDSITDSPLKTDDV-EFSSDPSDSAFKSAPQDNYTALWFEQVVDEATGEPTHIYKGGYWETKEQGTWENCPDIF 790          

HSP 2 Score: 193.741 bits (491), Expect = 3.930e-51
Identity = 112/305 (36.72%), Postives = 176/305 (57.70%), Query Frame = 3
Query:   96 TLSSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSELDS------------NELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADE--------DVSDED---FYDAFESQEGVFNVTLPS 941
            T     KG+L+KWTNY+KGYQ+RWFVL NGLLSYYR Q+EM   CRGTIN+  A I + DS +FVIS+ G QT+HLK+ +E E +RW +AL  A+ KA  +    D++  E  +            N  V   +  L   +ED+    D++ +    LQ+S+ +L+  K   + G+ + K++ + ERAT+FR+++ +++ +C  +       +++W+K + +ER+QR R+E  +E LAKQH HLE     + +    L  +P+  P+AD         D SD+D   F+DA E  +    +T+P+
Sbjct:   10 TPGDTYKGWLFKWTNYIKGYQRRWFVLSNGLLSYYRTQAEMGHTCRGTINLATANIAVEDSCNFVISNGGAQTYHLKASSEVERQRWITALELAKAKAVRMQAESDDSGDECSTSPPSAGQGLGARNSEVQSTLRTLGSKVEDLSTCNDLIAKHGSALQRSLSELEGVK---LGGDTSDKIRQVTERATLFRITSNAMINACRDFLALAQAHSKRWQKALQAERDQRVRLEETLEQLAKQHNHLE----RAFRGATVLPASPSN-PTADSKGSGPGKGDASDDDDNEFFDACEDVQEF--ITIPA 304          
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Match: osbp2 (oxysterol binding protein 2 [Source:ZFIN;Acc:ZDB-GENE-091113-18])

HSP 1 Score: 426.402 bits (1095), Expect = 3.249e-136
Identity = 203/415 (48.92%), Postives = 282/415 (67.95%), Query Frame = 3
Query: 1308 IRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIG---KCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTET-----VKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQ----RSRRVEI-LKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            ++ +R RR++IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EYS +LD+AA C   +EQ+  VAAF+VSSY+ T +R  KPFNPLLGET+ELDR ++ G+R   EQ+ HHPP+ A H  S   W  W + ++ +KFRGKYI I P+G      + F  S    +  ++  T+HNIIVG++WID  G+++I+N  T+D CHL + PYS FS D P++VTG + +       +L+GTWD+K+E+  ++ ++       VK +T   T     LLW++YPLP N +  +YFSS A+TLNE EE +APTDSR RPDQ+LME G WDEAN +K RLEE+Q    R+R  +  + L+  +E V  Y+P+WF+   DP+    T+ + G YWE K K+DWS C  I+
Sbjct:  374 LQQRRGRRSRIPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYSELLDRAARCSCALEQMCLVAAFSVSSYSTTVHRTGKPFNPLLGETFELDRLEESGYRSICEQVSHHPPAAAHHVMSQRGWTLWQEITIDSKFRGKYISIMPLGFHISICIFFYISATGNIHLKVTSTVHNIIVGKLWIDQSGDIEIVNRRTKDTCHLKFSPYSYFSRDVPRKVTGVVAESDGLAHYILSGTWDDKMESAKIVESSRGCVGSEVKQKTVYQTLPPK-LLWKKYPLPENAENMHYFSSLALTLNEPEEGVAPTDSRLRPDQRLMEAGLWDEANAQKQRLEERQRLERRTREAQANIALEEGRE-VEGYRPMWFEKRMDPDNGESTFIYRGGYWESKEKQDWSQCPSIY 786          

HSP 2 Score: 173.326 bits (438), Expect = 2.134e-44
Identity = 103/293 (35.15%), Postives = 165/293 (56.31%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSEL----DSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLE--YQISSSVQNQLKLNINPNQEPSADEDVSDE----DFYDAFESQEGVFNVTLPSPEINLGV 962
            +G+L KWTNYLKGYQ+RWFVL NGLLSYYR Q+EMA  CR TI++    I L D+   V++ SG +++HLK+ +E+E +RW SAL  A+  A  ++   D++  E+        L    +  L   L+D+    D++ +    LQ+S+ +L+  +  +   +   KLK + ERAT+FR+++ +++ +C  + +     + +W+K +  EREQR  +E  +E LAKQH  LE  ++ + S   Q         E S + D SDE    +F+DA E       +T+P    + G+
Sbjct:   95 RGWLLKWTNYLKGYQRRWFVLSNGLLSYYRTQAEMAHTCRATISLATVHIELGDNCHLVLT-SGGRSYHLKASSEAESQRWVSALQQAKANATQMMHHSDDSGDEVLVAQPDRALTPAALKTLVSKLDDLSTCNDLIGKHGAALQRSLSELEDLRCPSDGND---KLKTVNERATLFRITSNAMINACRDFVDLAEAHSRRWQKALQYEREQRHHLEETIEQLAKQHNSLERAWREAPSTHTQ-------GSERSGEVDTSDENEDVEFFDAMEDSPAF--ITVPDTSGSYGL 374          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: osbp (oxysterol binding protein [Source:ZFIN;Acc:ZDB-GENE-090312-18])

HSP 1 Score: 445.277 bits (1144), Expect = 9.164e-145
Identity = 216/445 (48.54%), Postives = 293/445 (65.84%), Query Frame = 3
Query: 1218 ASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVIS-----NTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQR-SRRVEILKLDGTKEFVYE-------YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            AS++   +  N   L + +S+ +   E++    K+ RR +IP KPN ++NLWS++KNCIGKDLSKIPMPVNF+EP+SMLQRL ED EY  +LDKAA C++ +EQ+ YVAAF+VSSY+ T YR  KPFNPLLGET+ELDR ++ G+R   EQ+ HHPP+ A H +S   W  W + ++S+KFRGKY+ I P+G  H  F  S  HY W+++  T+HNIIVGR+WID  G++DI+N  T DKC L +  YS FS D P++V+G + D   N   +L+GTWDEK+E   ++      +    + +T   T+ +   LW+RYPLP N D  YYF+  A+TLNE EE +APTDSR RPDQ+LME GKWDEAN EK RLEE+QR  RR    +L    E   +       Y+P+WF+   DP  +  +  + G YWE K K++W +   IF
Sbjct:  301 ASASGHLEDWNSEDLKHASSSSSLGQEMV---VKKQRRARIPDKPNYSLNLWSIMKNCIGKDLSKIPMPVNFNEPLSMLQRLTEDLEYFDLLDKAAKCESSLEQLCYVAAFSVSSYSTTVYRTGKPFNPLLGETFELDRLEECGYRSICEQVSHHPPAAAHHVDSRRGWRLWQEITVSSKFRGKYLSIIPLGTIHCEFPSSGNHYTWKKVTTTVHNIIVGRLWIDQSGDIDIVNHHTGDKCQLKFIAYSYFSRDIPRKVSGVVMDAEGNAHYILSGTWDEKMEYAKIVQSSKGSSGSEGRQKTVYQTQPAK-HLWKRYPLPENSDNMYYFTELALTLNETEEGVAPTDSRLRPDQRLMENGKWDEANAEKQRLEEKQRLVRRRREAELASAAEPNGDAGRKHQSYRPMWFERKEDPFTREVSCVYRGGYWETKEKQEWKISQDIF 741          

HSP 2 Score: 189.889 bits (481), Expect = 1.070e-50
Identity = 103/233 (44.21%), Postives = 149/233 (63.95%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRW-TSXXXXXXXXXXXXXXGCDNNDSE-----LDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLE 794
            KG+L+KWTNY+KGYQKRWFVL NGLLSYYR Q+EMA  CRGTIN+  A I+  DS + V+S+ G QT+HLK+ +E E +RW T+  LA  K  + +    D++D E      D  EL    +  L+  LED+    D++ +    LQ+S++DL+  K   +  E + KLK + ERAT+FR+++ +++ +C  + E    + +KW+K +  EREQR R+E  +E LAKQH  LE
Sbjct:    4 KGWLFKWTNYIKGYQKRWFVLSNGLLSYYRTQAEMAHTCRGTINLAGAYIDTEDSCNIVVSNGGTQTYHLKASSEVERQRWVTALELAKAKAIRMMQAESDDSDDEKSGAQADKTEL-QTTLRSLSSKLEDLSTCNDLIGKHGAALQRSLNDLETLK---LPPEGSEKLKAVNERATLFRITSNAMINACHDFLEQAQSQGKKWQKTVQYEREQRLRLEETLEQLAKQHNSLE 232          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: osbpl6 (oxysterol binding protein-like 6 [Source:ZFIN;Acc:ZDB-GENE-070912-206])

HSP 1 Score: 252.292 bits (643), Expect = 1.899e-71
Identity = 144/397 (36.27%), Postives = 227/397 (57.18%), Query Frame = 3
Query: 1326 RRTQIP-PKPNIN-MNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRIN-KPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTED-KCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIE----EDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWS 2492
            RR  +P P  + + + LW +++  IGKDLSK+ MPV  +EP+++LQRL E+ EYS +LD+AA   +P +++  VA F VS+YA+T  R   KPFNP+LGETYE  R +D G+R  AEQ+ HHPP    HC+S ++V W D  + NKF GK ++I P+G  ++   +    Y W ++   IHNI+ G+ WI+++GE+ I N  +   +C +++   S +S++   +V G + D+   V   L G W+E +                Y   + S+  +W+   LP + + YY F+ FAI LNE++      + PTD+R RPDQ+ +EEG  + A +EK R+EE QR +R    +L   K  +  Y P +F      +++ + +  N  YWE +    +S
Sbjct:  518 RRMHLPAPAADTSSIGLWDILRKNIGKDLSKVAMPVELNEPLNVLQRLCEEMEYSDLLDRAADTDDPAQRMVLVATFAVSTYASTISRAGGKPFNPVLGETYECIR-EDRGFRFIAEQVSHHPPISVCHCDSKKFVLWQDVRLKNKFWGKSMEIIPVGTVNVKLLKYGDEYEWNKVTSCIHNIMGGQRWIEHYGEVIIKNKKSNVCQCKINFIKASYWSSEA-NQVQGTVMDQNGRVLHRLFGKWNEGM----------------YCGAQRSARCIWRPGSLPQDHELYYGFTRFAIELNELDPVLRPHLPPTDTRFRPDQRFLEEGNMESAQREKLRIEEFQREKR----RLMEDKNIL--YTPRFFRKNITQDSREE-WLMNNTYWELRKDPGFS 889          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: osbpl1a (oxysterol binding protein-like 1A [Source:ZFIN;Acc:ZDB-GENE-050208-657])

HSP 1 Score: 212.231 bits (539), Expect = 5.915e-61
Identity = 155/428 (36.21%), Postives = 225/428 (52.57%), Query Frame = 3
Query: 1359 NMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCES--NEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYK-----------PYSMFSNDTPKRVTGAITDKLNNVCCVLN-GTWD----------EKLEAKNVISNTETVKGRTYLATEESSI----------------LLWQRYPLPPNFDKYYYFSSFAITLNEIEED----IAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            N ++WS ++ CIG +LSKI MPV F+EP+S LQRL E  E++ ++ KA +  + IE++  VAAF VS+ A+   R  KPFNPLLGETYE+ R +D G+RL +EQ+ HHPP  A   E    ++V         KF GK ++  P G   L   R    Y W      +HN+IVG++WI+ +G ++I N     K  LS++           P S F  D+ K+V+  I  K   V   ++ G ++          EKL AK V + +    G+   A E   I                LLW+ +P P N  + Y F+SFA+TLNE+E++    +APTD R RPD K ME+G  D A +EK RLEE+QR+ R +  K   T+E   E+   WF    +P   +  + + G Y++    + +  C  IF
Sbjct:   13 NFSIWSFLRRCIGMELSKITMPVIFNEPLSFLQRLCEYMEHTYLIHKANTSSSSIERMQCVAAFAVSAVASNWERTGKPFNPLLGETYEMVR-EDLGFRLVSEQVSHHPPISAFFAEGLNKDFVFHGSVYPKLKFWGKSVEAEPRGIITLELPRYGEAYTWTNPSCCVHNVIVGKLWIEQYGTVEITNHKRGFKASLSFRARNITKRKSRRPLSAFRIDSKKKVS-VIYGKWTEVLWSVDPGIYEVGKKNDKKSTEKL-AKLVAAESSGPSGQQAEADEADDIPTPEVPETVTVLPGSKLLWRVHPRPANSTQMYNFTSFALTLNEMEKEMEGLLAPTDCRLRPDMKAMEQGDIDLAGEEKNRLEEKQRAARKQRAK---TEE---EWHTRWFRQDLNPHTSTADWIYAGNYFD----RRYENCPNIF 427          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: osbpl6 (oxysterol binding protein-like 6 [Source:ZFIN;Acc:ZDB-GENE-070912-206])

HSP 1 Score: 127.872 bits (320), Expect = 2.703e-31
Identity = 80/165 (48.48%), Postives = 115/165 (69.70%), Query Frame = 3
Query: 1317 KRTRRTQIP-PKPNIN-MNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRI-NKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHL 1802
            +  RR+ +P P P+ + ++LW++++N IGKDL+K+ MPV  +EP++ LQRL E+ EYS +L++A+  ++P +++   AAF VS+YA T YR  NKPFNP+LGETYE  R +D G+R  AEQ+ HHPP  A HCES  +V W D    NKF GK ++I P+G   L
Sbjct:  340 RNGRRSFLPAPCPDTSGVSLWNILRNNIGKDLAKVSMPVELNEPLNTLQRLCEELEYSELLEQASDTEDPAQRMVLAAAFAVSAYAPTYYRSGNKPFNPVLGETYECIR-EDKGFRFVAEQVSHHPPISACHCESKTFVLWQDVRWKNKFWGKSMEILPLGTVSL 503          
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Match: OSBPL8 (oxysterol binding protein like 8 [Source:HGNC Symbol;Acc:HGNC:16396])

HSP 1 Score: 75.485 bits (184), Expect = 3.562e-14
Identity = 72/290 (24.83%), Postives = 130/290 (44.83%), Query Frame = 3
Query: 1218 ASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCI-GKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYE---LDRTDDFGWRLFAEQLCHHPPSCA--VHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSY--KPYSMFSNDTPKRVTGAITDKLNN-VCCVLNGTWDEKL 2060
            A+ +N   P  +V   Y       F EV         +T+   + N  + +W+++K    G DLSK+ +P    EP S L +L++ + ++ IL +AA  +N  ++I  V  + +S +      + KP+NP++GET+    +           +EQ+ HHPP  A  +    + +    +    +KF G  +     G+  L F      Y+          I+ G + ++  G++ I    T  K  + +  KP+ + S+D+  +V+G I  KL   V   L G WD ++
Sbjct:  293 AAVSNGSPPEPVVETGYVAELGEEFGEV-----GEAAQTETVSEENKGL-IWTLLKQLRPGMDLSKVVLPTFILEPRSFLDKLSDYYYHADILSQAAVEENAYDRIKQVVRWYLSGFYKKPKGLKKPYNPIIGETFRCMWIHPQTSSKTYYISEQVSHHPPISAFFISNRKDGFCISGNILARSKFYGNSLSAILDGEGKLTFLNRGEEYLMTMPYAHCKGILYGTMTLELGGKIIIDCEKTNYKAEIEFKLKPF-LGSSDSVNQVSGKI--KLGKEVLATLQGHWDREV 573          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: OSH2 (Member of an oxysterol-binding protein family with seven members; in S. cerevisiae, family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability; contains FFAT motif; interacts with ER anchor Scs2p at patches at the plasma membrane and at the nuclear envelope; regulated by sterol binding; OSH2 has a paralog, SWH1, that arose from the whole genome duplication [Source:SGD;Acc:S000002177])

HSP 1 Score: 275.018 bits (702), Expect = 5.884e-78
Identity = 148/399 (37.09%), Postives = 228/399 (57.14%), Query Frame = 3
Query: 1362 MNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFK----RSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLAT--------EESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEED----IAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            ++LW+V+K+ +GKD++++ +PV F+EP S+LQR+AED EYS +LD+AA+ ++   +  YVAAFT SSYA+T  R+ KPFNPLLGET+E  R D   +R F EQ+ HHPP  A   ES  W  W +  +  KF G+   +  +G  H+  +      +  Y W++   T+  I++G   +DNHGE++++N TT D C L +K     S+     +TG + +K      +L G W+E + AK V+ + +    +T  A         + +  L+W+    P   ++ +  + FAITLN  +      + PTD+R RPDQ+ ME+G++DEA  EK R+EE+QR+ R +       +E   EY P WF   T P  K+K +++ GKYW  +   D   C  IF
Sbjct:  896 ISLWAVLKSMVGKDMTRMTLPVTFNEPTSLLQRVAEDLEYSELLDQAATFEDSTLRTLYVAAFTASSYASTTKRVAKPFNPLLGETFEYSRPDK-QYRFFTEQVSHHPPISATWTESPRWDFWGESFVDTKFNGRSFNVKHLGLWHIKLRPNDNEKEELYTWKKPNNTVIGILIGNPQVDNHGEVNVVNHTTGDHCKLYFKARGWRSSGA-YEITGEVYNKKKQKVWILGGHWNEAIFAKKVVKDGDLSLEKTRTAASAGNGPTDDGTKFLIWKANDRP---EEPFNLTPFAITLNAPQPHLLPWLPPTDTRLRPDQRAMEDGRYDEAGDEKFRVEEKQRAARRK------REENNLEYHPQWFVRDTHPITKAKYWRYTGKYWVKRRDHDLKDCGDIF 1283          

HSP 2 Score: 56.6102 bits (135), Expect = 1.689e-8
Identity = 31/87 (35.63%), Postives = 51/87 (58.62%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQ-NGLLSYYRNQSEMAQICRGTINIVNAKINLVDST-----SFVISHSGMQTFHLKSQNESEMKRW 356
            KG+L KWTN+  GY+ RWF+L  +G LSYY++QS + +  RGT+ +   +++ +DS+       +   +G   + LK  +  E  RW
Sbjct:  293 KGFLKKWTNFAHGYKLRWFILSGDGNLSYYKDQSHVDR-PRGTLKVSTCRLH-IDSSEKLNFELLGGITGTTRWRLKGNHPIETTRW 377          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: SWH1 (Protein similar to mammalian oxysterol-binding protein; contains ankyrin repeats and FFAT motif; interacts with ER anchor Scs2p at the nucleus-vacuole junction; regulated by sterol binding; SWH1 has a paralog, OSH2, that arose from the whole genome duplication [Source:SGD;Acc:S000000081])

HSP 1 Score: 256.529 bits (654), Expect = 5.496e-72
Identity = 152/426 (35.68%), Postives = 237/426 (55.63%), Query Frame = 3
Query: 1305 PIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRS------KYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNV-----------ISNTETVKGRTYLATEESSILLW---QRYPLPPNFDKYYYFSSFAITLNEIEED----IAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            P+R+K        PK    + LWSV+K+ +G+DL+K+ +PV+F+EP S+LQR++ED EYS ILD+AA+ ++   ++ YVAAFT S YA+T  R++KPFNPLLGET+E  RTD   +R F EQ+ HHPP  A   ES +W  + + ++ + F G+   +  +G  ++  +        +  Y W++   T+  I++G+  +DN G++ + N TT D C L YK +  +++     V G + +K +    VL G W++ +  K V           I    +  G   L  + S  L+W   +R  +P      +  +SFA+TLN +       +APTDSR RPDQ+ ME G++D+A  EK R+E +QR+ + E       ++   EY+P WF     P  KS  +KFNG+YW  +   D+  C  IF
Sbjct:  783 PVRTKLALDEDNRPK----IGLWSVLKSMVGQDLTKLTLPVSFNEPTSLLQRVSEDIEYSHILDQAATFEDSSLRMLYVAAFTASMYASTTNRVSKPFNPLLGETFEYARTDG-QYRFFTEQVSHHPPISATWTESPKWDFYGECNVDSSFNGRTFAVQHLGLWYITIRPDHNISVPEETYSWKKPNNTVIGILMGKPQVDNSGDVKVTNHTTGDYCMLHYKAHG-WTSAGAYEVRGEVFNKDDKKLWVLGGHWNDSIYGKKVTARGGELTLDRIKTANSATGGPKL--DGSKFLIWKANERPSVP------FNLTSFALTLNALPPHLIPYLAPTDSRLRPDQRAMENGEYDKAAAEKHRVEVKQRAAKKE------REQKGEEYRPKWFVQEEHPVTKSLYWKFNGEYWNKRKNHDFKDCADIF 1188          

HSP 2 Score: 72.4034 bits (176), Expect = 2.190e-13
Identity = 37/104 (35.58%), Postives = 62/104 (59.62%), Query Frame = 3
Query:   60 QIIMETKNQNNVTLSSNIKGYLYKWTNYLKGYQKRWFVL-QNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSF----VISHSGMQTFHLKSQNESEMKRW 356
            Q +++  N NN+  +   KGYL KWTN+ +GY+ RWF+L  +G LSYY +Q++    CRG++N+ +  ++L  S       +  ++G+  +HLK  +  E  RW
Sbjct:  268 QSVIDVTN-NNLHEAPTYKGYLKKWTNFAQGYKLRWFILSSDGKLSYYIDQADTKNACRGSLNMSSCSLHLDSSEKLKFEIIGGNNGVIRWHLKGNHPIETNRW 370          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: OSH3 (Member of an oxysterol-binding protein family; this family has seven members in S. cerevisiae; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability; contains FFAT motif; interacts with ER anchor Scs2p at patches at the plasma membrane; regulated by sterol binding [Source:SGD;Acc:S000001115])

HSP 1 Score: 193.741 bits (491), Expect = 1.811e-51
Identity = 133/401 (33.17%), Postives = 199/401 (49.63%), Query Frame = 3
Query: 1323 TRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPK-RVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEE----DIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            TRR  IP       +L S ++  +GKDLS I MPV  +EPIS+LQ ++E FEY+ +L KA    +PI  +S  A   +S Y      + KPFNPLL ET+EL R +D G+RL +E++ H PP  A   E  +W C +  + S KF GK I+++  G   L FK +   + W +    + N+I G  +++   E + ++ +  DK H+ +    MFS  +   +V+       N     L G W +                   LA E +   +W+   L  N  K Y F+ F   LNEI E    ++ PTDSR RPD +  EEG  D+A + K +LE+ QR RR +            + +P +F+ V+  E K  T      YWE + K DWS  ++++
Sbjct:  628 TRRNDIPEAAASPPSLLSFLRKNVGKDLSSIAMPVTSNEPISILQLISETFEYAPLLTKATQRPDPITFVSAFAISFLSIYRDKTRTLRKPFNPLLAETFELIR-EDMGFRLISEKVSHRPPVFAFFAEHLDWECSYTVTPSQKFWGKSIELNNEGILRLKFKTTGELFEWTQPTTILKNLIAGERYMEPVNEFE-VHSSKGDKSHILFDKAGMFSGRSEGFKVSIIPPPSSNRKKETLAGKWTQS------------------LANETTHETIWEVGDLVSNPKKKYGFTKFTANLNEITEIEKGNLPPTDSRLRPDIRAYEEGNVDKAEEWKLKLEQLQRERRNK----------GQDVEPKYFEKVSKNEWKYITGP--KSYWERRKKHDWSDISQLW 996          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: OSH6 (Member of an oxysterol-binding protein family; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability; GFP-fusion protein localizes to the cell periphery; overexpression extends lifespan by promoting vacuolar fusion; OSH6 has a paralog, OSH7, that arose from the whole genome duplication [Source:SGD;Acc:S000001711])

HSP 1 Score: 70.0922 bits (170), Expect = 5.555e-13
Identity = 67/279 (24.01%), Postives = 119/279 (42.65%), Query Frame = 3
Query: 1353 NINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYEL--DRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSM--SNKFRGKYIQIHPIGKCHLLFKRSK------YHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPL 2159
            NI +N+ S ++   G DL++I +P    E  SML+R+    ++   L +A S ++P+++  YV  + ++ +      + KP NP+LGE +    D  +       +EQ  HHPP CA      E     D  +   ++F G        G   L F   K        YV  +  + +  I+ G++ I+    M I +   +       K Y   + D    + G + D   N    ++G W++ +  K++     + K   +L T + S L  +  PL
Sbjct:   49 NIILNIISQLRP--GCDLTRITLPTFILEKKSMLERVTNQLQFPEFLLQAHSEKDPLKRFLYVMKWYLAGWHIAPKAVKKPLNPVLGEYFTAYWDLPNKQQAYYISEQTSHHPPECAYFYMIPESSIRVDGVVIPKSRFLGNSSAAMMDGSTVLQFLDIKDGNGKPEKYVLTQPNVYVRGILFGKMRIELGDHMIIKSPNFQADIEFKTKGYVFGTYDA---IEGTVKDYDGNAYYEISGKWNDVMYLKDLKQPRSSPK--VFLDTHKESPLRPKVRPL 320          
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Match: OSH7 (Oxysterol-binding protein; part of family with seven members in S. cerevisiae; family members have overlapping, redundant functions in sterol metabolism and collectively perform a function essential for viability; OSH7 has a paralog, OSH6, that arose from the whole genome duplication [Source:SGD;Acc:S000001043])

HSP 1 Score: 58.5362 bits (140), Expect = 2.431e-9
Identity = 36/117 (30.77%), Postives = 61/117 (52.14%), Query Frame = 3
Query: 1353 NINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYEL--DRTDDFGWRLFAEQLCHHPPSCA 1697
            +I +N+ S +K   G DLS+I +P    E  SML+R+    ++  +L +A S ++ +++   V A+ ++ +      + KP NP+LGE +    D  +       AEQ  HHPP  A
Sbjct:   49 SILLNIISQLKP--GCDLSRITLPTFILEKKSMLERITNQLQFPDVLLEAHSNKDGLQRFVKVVAWYLAGWHIGPRAVKKPLNPILGEHFTAYWDLPNKQQAFYIAEQTSHHPPESA 163          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO44125 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7RWH9])

HSP 1 Score: 458.759 bits (1179), Expect = 1.070e-149
Identity = 215/410 (52.44%), Postives = 283/410 (69.02%), Query Frame = 3
Query: 1320 RTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVI---SNTETVKGRTYLATEESS---ILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRR-------VEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +T RT IPP+P+I++NLWS++KNCIGK+L+KIPMPVNF+EP+SMLQR+ E+ EYS +LDKAA+C + +EQ+ YVAAFTVSSY+ T+ R NKPFNPLLGET+E DR++D+GWR  AEQ+ HHPP+ A H E  +W+ W +FS ++KFRGKY+QI P G  HL F +S  HY W ++  T+HNIIVG++WID  GEMDI N TT + CHL Y  Y+ F  DTP++VTG +TD    V  V++GTWD K+EA  V+   S     +G +    +  +   ++LW+R   PP  +K Y  +SFAITLNE E+ +APTDSR RPDQ+LME   W+EAN+EK R+E+QQR+RR        E L  DG   F   Y P WF+ + D       + + G YWE K KKDW  C  IF
Sbjct:  324 KTYRTSIPPRPDISINLWSILKNCIGKELTKIPMPVNFNEPLSMLQRITEELEYSEVLDKAAACTSSLEQMCYVAAFTVSSYSTTSNRTNKPFNPLLGETFECDRSEDYGWRSLAEQVSHHPPASAFHAEHKDWIFWQEFSATSKFRGKYLQIIPQGIAHLKFIKSGNHYTWRKVTTTVHNIIVGKLWIDQSGEMDIANHTTNENCHLKYDAYNYFGRDTPRKVTGVVTDSTKTVRYVISGTWDNKIEAAKVVYLKSPGVKAQGSSSQKGQPQTLPPVVLWKRVLPPPENEKMYAMTSFAITLNEPEDHVAPTDSRFRPDQRLMENCHWEEANQEKLRIEDQQRTRRRKREQEAAEALS-DGI--FYEGYSPSWFEKIVDELTDMPMHVYKGGYWEAKEKKDWGSCPDIF 730          

HSP 2 Score: 176.792 bits (447), Expect = 4.047e-46
Identity = 94/229 (41.05%), Postives = 147/229 (64.19%), Query Frame = 3
Query:  108 NIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLE 794
            + +G+L KWTNY+KGYQ+RWFVL NGLLSYYRNQ+EMA  CRGTIN+  A I+  D+ SFVIS+ G Q FHL++  E E +RW +AL  A+ KA  +L+  +  +   D  E +      L+  L D++   D++ +    LQ++I +L + ++++ +     KLK + E+AT+FR+++ +++++CA + E    + +KW+K +  ER QR  +E  VE L +QH  LE
Sbjct:   10 HFRGWLLKWTNYIKGYQRRWFVLSNGLLSYYRNQAEMAHTCRGTINLAGAFIDTEDACSFVISNGGTQVFHLRASTEVERQRWVTALELAKAKAIKMLESDEEEEGASDHAENIK----PLSSKLSDLQTCNDLVGKHGSALQRAIGELQEIEDNHTLFN---KLKAVNEKATLFRITSNAMISACAEFLELAQAQEKKWQKSLQYERNQRINLEETVEVLGRQHYLLE 231          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO41441 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7S4A2])

HSP 1 Score: 288.115 bits (736), Expect = 1.049e-88
Identity = 154/387 (39.79%), Postives = 229/387 (59.17%), Query Frame = 3
Query: 1317 KRTRRTQIPP---KPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIA-PTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYW 2465
            +R RRT +P    + +I  +L S +K  +GKD++K+ MPV+F+EP+S LQRL+ED EY+ IL++A  C+N + ++++VAAF  S+YA    R  KPFNPLLGET+E    D+ G+ L AEQ+ HHPP  A+H ES+ WV W ++ +  KFRG++ ++ P G CHL FK + +H+ W++   TIHNI+VG +++D  G+M + N TT++ C + + P      D  K++ G + D    V  V+ G+WD+ LE   +  +T            + SI LW     P +  K Y F+ F I LN+ +  +  PTD RNRPD + +E GK D +  EK RLEE+QR+ R E           Y+ K  WF P  DP  ++  Y + G YW
Sbjct:   37 RRPRRTALPATRERSSIR-SLISFMKTVVGKDMTKVTMPVHFNEPVSFLQRLSEDLEYADILNRACVCKNNLVKLAHVAAFASSTYATVLSRFWKPFNPLLGETFEYIDNDN-GFALIAEQVSHHPPISALHAESSHWVFWQEYKLDTKFRGQFFKVIPTGHCHLKFKTNGHHFSWKKPVTTIHNILVGSLYVDQEGDMVVTNHTTKETCTVHFMPVRKV-QDNFKKLKGEVKDPEGKVRYVIEGSWDKSLEC--IPQDT---------GFNDDSIDLWTAVARPDDSYKMYAFTRFTIQLNDPDYGVTCPTDCRNRPDIRQLELGKIDSSAAEKHRLEEKQRASRRERDTKGEAWTPRYDKKDRWFVPKEDPYTRTFDYVYRGGYW 409          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO39767 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7S940])

HSP 1 Score: 239.58 bits (610), Expect = 3.666e-71
Identity = 139/401 (34.66%), Postives = 211/401 (52.62%), Query Frame = 3
Query: 1362 MNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKL---EAKNVISNTETVKGR-----------TYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEI----EEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
             ++W+V+K CIGKDLS+I MPV F+EP++ LQR+ E  EYS +L  AAS  +P  ++                ++ KPFNPLLGETYEL R    G+RL AEQ+ HHPP  A+ CES++++         KF GK +++ P G   L F +    Y W  +   +HNIIVG++WI+ +G+++I +L++ D+  + +KP   F  +  K        +       L G W +K+    ++  ++  ++ +G+                  S + LW     PP+  + Y F+SFA+ LNE+    +E + PTDSR RPD + +E G  D A  EK RLEE+QR+ R E  K D       E+ P WF    +P      + ++G YW+    +DW  C  IF
Sbjct:    7 FSVWTVLKQCIGKDLSRITMPVIFNEPLTFLQRITEYMEYSELLHTAASQDDPTRRL----------------QVGKPFNPLLGETYELVRP---GFRLVAEQVSHHPPITALQCESDDFIFHVTVQPKLKFWGKGVEVQPKGMVTLKFPKHNEVYTWNNVNSCVHNIIVGQLWIEQYGQIEISSLSSGDRATIHFKPAGWFGKELNKVEATIHCAQDKKKRYTLKGDWTDKITCYRSETHVTRKQSKRGKQDFEIASTSSSETSLELHSPVTLWTCSHRPPHSKEMYNFTSFAMQLNELLPRDKETLPPTDSRLRPDCRALENGDLDRATAEKIRLEEKQRAARRERQKSD------QEWAPRWFKEEMNPYTGQMDWLYSGGYWD----RDWQECPDIF 378          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO28432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6H1])

HSP 1 Score: 74.7146 bits (182), Expect = 3.223e-16
Identity = 46/114 (40.35%), Postives = 62/114 (54.39%), Query Frame = 3
Query: 2181 YYFSSFAITLNEI----EEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            Y F+SFA+ LNE+    +E + PTDSR RPD + +E G  D A  EK RLEE+QR+ R E  K D       E+ P WF    +P      + ++G YW+    +DW  C  IF
Sbjct:    2 YNFTSFAMQLNELLPRDKETLPPTDSRLRPDCRALENGDLDRATAEKIRLEEKQRAARRERQKSD------QEWAPRWFKEEMNPYTGQMDWLYSGGYWD----RDWQECPDIF 105          
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Match: EDO47800 (Oxysterol-binding protein [Source:UniProtKB/TrEMBL;Acc:A7RL46])

HSP 1 Score: 78.9518 bits (193), Expect = 2.228e-15
Identity = 74/282 (26.24%), Postives = 123/282 (43.62%), Query Frame = 3
Query: 1353 NINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSY--AATAYRINKPFNPLLGETYE------------LDRT------------DDFGWRLFAEQLCHHPPSCAVHCES-NEWVCW-FDFSMSNKFRGKYIQIHPIGKC--HLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSY--KPYSMFSNDTPKRVTGAITD-KLNNVCCVLNGTWDEKLEAKNVISNTETVK 2099
            ++ ++L S +K  +G DL+K+ +P    EP S+L+  A+ F +  +  + A      ++I  V  F ++S+          KP+NP+LGET+             ++R             DD G R  AEQ+ HHPP    + E   + +C        +KF G  I +  +G+    LL    +YH+ +   P      I+   W++  G++ I    T     +++  KP   F      RVTG + +     V C + G W+ K+E  N  SN E  K
Sbjct:   79 SVILHLLSQLK--LGMDLTKVVLPTFILEPRSLLEMYADFFAHPDMFIRIADGLTAEDRILAVLEFYLTSFHVGRKGSLAKKPYNPILGETFTCSWDVREECSTGMERNPLNLANDVSVMEDDRGLRFVAEQISHHPPVSGFYAECPRKKICLNAHIWTKSKFYGMSIGVANVGEAVITLLEHEEEYHFTF---PSAFCRSILTFPWVELGGKLHITCPKTGYNASVTFHTKP---FYGGKLHRVTGEVKNASTGKVICKVAGEWNGKIEF-NYTSNQEQAK 351          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: osbp2 (oxysterol-binding protein 2 [Source:NCBI gene;Acc:101170773])

HSP 1 Score: 454.907 bits (1169), Expect = 1.275e-147
Identity = 221/464 (47.63%), Postives = 303/464 (65.30%), Query Frame = 3
Query: 1212 ITASSNNMHKPI--NLVSLTYNTSNIATFSEVIP--IRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVI-----SNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVE-------------------ILK--LDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +TA+S+  HK +   + + T+  S    F +     ++ +RTRRT+IP KPN ++NLWS++KNCIGKDLS+IPMPVNF+EP+SMLQRL ED EYS +LD+AA C + +EQ+  VAAF+VSSY+ T +R  KPFNPLLGETYELDR  ++G+R  +EQ+ HHPP+ A H  S   W  W   ++ +KFRGKYI + P+G  HL F  S  HYVW ++  T+HNIIVG++WID  G++DI+N TT+D C L + PYS FS + P++VTG + D+      +L+GTWD+K+E+  ++           K +T   T +   LLW++YPLP N +  ++FSS A+TLNE EE +APTDSR RPDQ+LMEEG WDEAN +K RLEE+QR  R +                    LK  +  T + +  Y+PLWFD  TD      TY + G YWE K +++WS C +IF
Sbjct:  293 VTAASDIQHKQLASQVSAFTFTESLFVCFKDTSTNHMQLRRTRRTRIPDKPNYSLNLWSIMKNCIGKDLSRIPMPVNFNEPLSMLQRLTEDLEYSELLDRAARCDSSLEQMCLVAAFSVSSYSTTVHRTAKPFNPLLGETYELDRL-EYGYRSISEQISHHPPAAAHHVTSQRGWTLWQHITIDSKFRGKYISVVPLGNIHLQFHSSGNHYVWSKVTSTVHNIIVGKLWIDQSGDIDIVNTTTKDTCRLKFSPYSYFSREVPRKVTGVVEDREGTAHYILSGTWDDKMESAKIVESSHGGGGSEGKQKTVYQTLQPK-LLWKKYPLPENAENMHFFSSLALTLNEPEEGVAPTDSRLRPDQRLMEEGLWDEANIQKQRLEERQRQERKKREAQANQALEDGEFMDCQIFLKNYMCSTGQDIEGYQPLWFDRKTDENTGDATYFYKGGYWEAKERQNWSQCPRIF 754          

HSP 2 Score: 182.185 bits (461), Expect = 2.121e-47
Identity = 103/280 (36.79%), Postives = 162/280 (57.86%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSEL----DSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVTLPS 941
            KG+L+KWTNYLKGYQ+RWFVL NGLLSYYR Q+EMA  CRGTI +  A I + D+   V++ SG +++HLK+ +E+E +RW SAL  A+  A  L+   D++  E     +   L  G +  L   L+D+    +++ +    LQ+S+ +L++ + SN   +   K+K + ERAT+FR+++ ++L +C  + +     + +W+K +  EREQR  +E  +E LAKQH  LE    +  +N         Q+    +D  + +F+DA E       VT  S
Sbjct:   25 KGWLFKWTNYLKGYQRRWFVLSNGLLSYYRTQAEMAHTCRGTIPLATAHIGVGDACHLVLT-SGGRSYHLKATSEAECQRWVSALQQAKDNATVLMHHSDDSGDEAPIPHEERALTQGVLKTLASKLDDLSTCNELIGKHGAALQRSLSELEELRGSN---DNTDKVKAVNERATLFRITSNAMLNACRDFLDVAESHSRRWQKALHYEREQRHHLEETIEQLAKQHNSLE---RAWRENPSSYAGRRPQDGDVSDDNEEAEFFDAMEDSTAFITVTAAS 297          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: si:ch211-106a19.1 (oxysterol-binding protein 2 [Source:NCBI gene;Acc:101175572])

HSP 1 Score: 442.58 bits (1137), Expect = 9.676e-145
Identity = 208/404 (51.49%), Postives = 278/404 (68.81%), Query Frame = 3
Query: 1326 RRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVIS-----NTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRS--RRVEILKLDGTKEFVYE-YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            RRT++P KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EY  +LDKAA C++ +EQ+  VAAF+VSSY+ T +R  KPFNPLLGETYELDR ++FG+R   EQ+ HHPP+ A H  S   W  W + ++++KFRGKY+ I P+G  HL F  S  HYVW ++  T+HNIIVG++WID  G+++I+N  T++ C L + PYS FS D P++VTG + D       +L+GTWD+K+E+  ++      +    K +T   T  S  LLW++YPLP N +  YYFSS A+TLNE EE +A TDSR RPDQ+LME+G+WDEAN EK RLEE+QR+  RR E           YE Y+PLWF    D      ++ + G YWE K  +DW++C  IF
Sbjct:  203 RRTRVPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDKAARCESSLEQMCLVAAFSVSSYSTTVHRTAKPFNPLLGETYELDRLEEFGYRSLCEQVSHHPPAAAHHVISQRGWTLWQEITIASKFRGKYLSIMPLGTIHLQFHSSGNHYVWRKVTSTVHNIIVGKLWIDQSGDIEIVNHRTKEACQLKFSPYSYFSRDVPRKVTGVVADSSGQAHYILSGTWDDKMESAKILQSSRGGSGSEGKQKTVYQT-LSPKLLWKKYPLPENAENMYYFSSLALTLNEPEEGVAVTDSRLRPDQRLMEDGRWDEANAEKQRLEEKQRAVRRRREGCPGPLCCASEYEGYQPLWFHQRRDSLTGETSFVYKGGYWETKESQDWNICPDIF 605          

HSP 2 Score: 82.8037 bits (203), Expect = 6.459e-16
Identity = 55/182 (30.22%), Postives = 96/182 (52.75%), Query Frame = 3
Query:  405 GCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQ------ISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVT 932
            G +   S+ D +EL  G +  L   L+D+    D++ +    LQ+S+ +L+  K +   GE   K+K + ERAT+FR+++ +++ +C  + +     + +W++ +  EREQR  +E  +E LAKQH  LE        ++SS  +    N     EP++DED  D +++DA E       VT
Sbjct:    8 GDEEPTSQSDRSEL-QGTLKLLVSKLDDLSTCNDLIAKHGAALQRSLTELEGLKVTIEGGE---KIKAVNERATLFRITSNAMINACRDFLDLAETHSRRWQRALQYEREQRTHLEETIEQLAKQHNSLERAWREAPTLASSSPSAPTTN---KGEPASDED-EDTEYFDAMEDSPAFITVT 181          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: si:ch211-106a19.1 (oxysterol-binding protein 2 [Source:NCBI gene;Acc:101175572])

HSP 1 Score: 445.277 bits (1144), Expect = 2.539e-144
Identity = 213/441 (48.30%), Postives = 294/441 (66.67%), Query Frame = 3
Query: 1212 ITASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVIS-----NTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKL--DGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +TAS ++ H+ ++       + N  +  E+ P   +R RRT++P KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EY  +LDKAA C++ +EQ+  VAAF+VSSY+ T +R  KPFNPLLGETYELDR ++FG+R   EQ+ HHPP+ A H  S   W  W + ++++KFRGKY+ I P+G  HL F  S  HYVW ++  T+HNIIVG++WID  G+++I+N  T++ C L + PYS FS D P++VTG + D       +L+GTWD+K+E+  ++      +    K +T   T  S  LLW++YPLP N +  YYFSS A+TLNE EE +A TDSR RPDQ+LME+G+WDEAN EK RLEE+QR+ R        +   E    Y+PLWF    D      ++ + G YWE K  +DW++C  IF
Sbjct:  288 VTASESSQHRSMS------PSCNDVSGKELQP---RRERRTRVPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDKAARCESSLEQMCLVAAFSVSSYSTTVHRTAKPFNPLLGETYELDRLEEFGYRSLCEQVSHHPPAAAHHVISQRGWTLWQEITIASKFRGKYLSIMPLGTIHLQFHSSGNHYVWRKVTSTVHNIIVGKLWIDQSGDIEIVNHRTKEACQLKFSPYSYFSRDVPRKVTGVVADSSGQAHYILSGTWDDKMESAKILQSSRGGSGSEGKQKTVYQT-LSPKLLWKKYPLPENAENMYYFSSLALTLNEPEEGVAVTDSRLRPDQRLMEDGRWDEANAEKQRLEEKQRAVRRRREAEASEALDEEYEGYQPLWFHQRRDSLTGETSFVYKGGYWETKESQDWNICPDIF 718          

HSP 2 Score: 184.111 bits (466), Expect = 3.583e-48
Identity = 111/286 (38.81%), Postives = 170/286 (59.44%), Query Frame = 3
Query:  102 SSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXX---XXGCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQ------ISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVT 932
            S   KG+L+KWTNYLKGYQ+RWFVL NGLLSYYR Q+EMA  CRGTIN+  A I+  D+ + V+S SG +T+HLK+  E E +RW +AL  A+ KA  +     G +   S+ D +EL  G +  L   L+D+    D++ +    LQ+S+ +L+  K +   GE   K+K + ERAT+FR+++ +++ +C  + +     + +W++ +  EREQR  +E  +E LAKQH  LE        ++SS  ++       N+E ++DED  D +++DA E       VT
Sbjct:   15 SDTYKGWLFKWTNYLKGYQRRWFVLSNGLLSYYRTQAEMAHTCRGTINLATAHIDTEDACNIVLS-SGGRTYHLKASTEVERQRWVTALELAKAKAIRMMNDQSGDEEPTSQSDRSEL-QGTLKLLVSKLDDLSTCNDLIAKHGAALQRSLTELEGLKVTIEGGE---KIKAVNERATLFRITSNAMINACRDFLDLAETHSRRWQRALQYEREQRTHLEETIEQLAKQHNSLERAWREAPTLASSSPSE-----RSNKEEASDED-EDTEYFDAMEDSPAFITVT 289          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: si:ch211-106a19.1 (oxysterol-binding protein 2 [Source:NCBI gene;Acc:101175572])

HSP 1 Score: 441.039 bits (1133), Expect = 2.197e-142
Identity = 217/451 (48.12%), Postives = 297/451 (65.85%), Query Frame = 3
Query: 1212 ITASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVIS-----NTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRV-------EILKLDGT----KEFVYE-YKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            +TAS ++ H+ ++       + N  +  E+ P   +R RRT++P KPN ++NLWS++KNCIGK+LSKIPMPVNF+EP+SMLQRL ED EY  +LDKAA C++ +EQ+  VAAF+VSSY+ T +R  KPFNPLLGETYELDR ++FG+R   EQ+ HHPP+ A H  S   W  W + ++++KFRGKY+ I P+G  HL F  S  HYVW ++  T+HNIIVG++WID  G+++I+N  T++ C L + PYS FS D P++VTG + D       +L+GTWD+K+E+  ++      +    K +T   T  S  LLW++YPLP N +  YYFSS A+TLNE EE +A TDSR RPDQ+LME+G+WDEAN EK RLEE+QR+ R        E L    T        YE Y+PLWF    D      ++ + G YWE K  +DW++C  IF
Sbjct:  299 VTASESSQHRSMS------PSCNDVSGKELQP---RRERRTRVPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPLSMLQRLTEDLEYHELLDKAARCESSLEQMCLVAAFSVSSYSTTVHRTAKPFNPLLGETYELDRLEEFGYRSLCEQVSHHPPAAAHHVISQRGWTLWQEITIASKFRGKYLSIMPLGTIHLQFHSSGNHYVWRKVTSTVHNIIVGKLWIDQSGDIEIVNHRTKEACQLKFSPYSYFSRDVPRKVTGVVADSSGQAHYILSGTWDDKMESAKILQSSRGGSGSEGKQKTVYQT-LSPKLLWKKYPLPENAENMYYFSSLALTLNEPEEGVAVTDSRLRPDQRLMEDGRWDEANAEKQRLEEKQRAVRRRREAEASEALDEGNTCASSAGREYEGYQPLWFHQRRDSLTGETSFVYKGGYWETKESQDWNICPDIF 739          

HSP 2 Score: 184.111 bits (466), Expect = 3.943e-48
Identity = 112/287 (39.02%), Postives = 167/287 (58.19%), Query Frame = 3
Query:  102 SSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXX---XXGCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQ-------ISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVT 932
            S   KG+L+KWTNYLKGYQ+RWFVL NGLLSYYR Q+EMA  CRGTIN+  A I+  D+ + V+S SG +T+HLK+  E E +RW +AL  A+ KA  +     G +   S+ D +EL  G +  L   L+D+    D++ +    LQ+S+ +L+  K +   GE   K+K + ERAT+FR+++ +++ +C  + +     + +W++ +  EREQR  +E  +E LAKQH  LE          SSS           N+E ++DED  D +++DA E       VT
Sbjct:   20 SDTYKGWLFKWTNYLKGYQRRWFVLSNGLLSYYRTQAEMAHTCRGTINLATAHIDTEDACNIVLS-SGGRTYHLKASTEVERQRWVTALELAKAKAIRMMNDQSGDEEPTSQSDRSEL-QGTLKLLVSKLDDLSTCNDLIAKHGAALQRSLTELEGLKVTIEGGE---KIKAVNERATLFRITSNAMINACRDFLDLAETHSRRWQRALQYEREQRTHLEETIEQLAKQHNSLERAWREAPTLASSSPSAPTTNKGESNKEEASDED-EDTEYFDAMEDSPAFITVT 300          
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Match: ENSORLT00000007524.2 (oxysterol-binding protein 1 [Source:NCBI gene;Acc:101155887])

HSP 1 Score: 412.149 bits (1058), Expect = 5.379e-131
Identity = 207/416 (49.76%), Postives = 278/416 (66.83%), Query Frame = 3
Query: 1293 SEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE-WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTE----TVKGRTYLATEE-SSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRS----RRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            SE++P++ +RTR   IP KPN ++NLWS++KNCIGK+LSKIPMPVNF+EPISMLQRL+ED EY  +LDKAA   N +EQ+ YVAAF VS+Y+ T YR  KPFNPLLGETYELDR  + G+R   EQ+ HHPP+ A H  S+  W    + ++++KFRGKY+ I P+G  H +F++S  HY W+++  T+HNIIVG++WID  GE+D++N TT D+CHL + PYS FS D  ++VTG + DK      VL+GTWDEK+E   V+ ++       +GR     +   +  LW+R PLP   +  YYF++ A+TLNE E+ +APTDSR RPDQ+LME+G+WDEAN EK RLEE+QR+    R  E L    +      YK  WF+   D       + + G YWE K +  W  C  IF
Sbjct:  351 SELVPLKKRRTR---IPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPISMLQRLSEDLEYHELLDKAAKSHNSLEQMCYVAAFCVSAYSTTVYRTGKPFNPLLGETYELDRQRESGYRSLCEQVSHHPPAAAHHAISDRGWTLRQEITVASKFRGKYLSIMPLGTIHAIFEKSNNHYTWKKVTTTVHNIIVGKLWIDQSGEIDVVNHTTGDRCHLKFAPYSYFSRDVARKVTGVVMDKTGKAHYVLSGTWDEKMEFSRVMQSSRGGENGTEGRQKTVYQTLKAKELWRRNPLPDGAETMYYFTALALTLNEPEDGVAPTDSRLRPDQRLMEDGRWDEANAEKQRLEEKQRTARREREREALNQRSSSVPHENYKARWFEHTEDKITGEAVHVYKGGYWEAKDQGKWDDCPDIF 763          

HSP 2 Score: 193.356 bits (490), Expect = 4.307e-51
Identity = 106/290 (36.55%), Postives = 166/290 (57.24%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSEL-----------DSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDED---FYDAFESQEGVFNVTLPS 941
            KG+++KWTNY+KGYQ+RWFVL NGLLSYYR Q+EM   CRGTIN+  A I + D+ +F+I++ G QT+HLK+  E E ++W +AL  A+ KA  +    D++  +              N      +  L   +ED+    D++ +    LQ+S+ +LD   N  + GE   K++ + ERAT+FR+++ +++ +C  +       +++W+K + +EREQR R+E  +E LAKQH HLE     + Q     +      P   E VSD+D   F+DA E  E    +T+P+
Sbjct:   43 KGWVFKWTNYIKGYQRRWFVLSNGLLSYYRTQAEMGHTCRGTINLATATITVDDACNFMITNGGAQTYHLKASCEVERQKWITALELAKAKAARMQAESDDSGDDFSPSAAPGQGAGSQNAEFQSAMRMLGSKVEDLSTCNDLISKHGSALQRSLSELD---NLTLTGEAGEKIRQVTERATLFRITSNAMINACRDFLSMAQTHSKRWQKALQAEREQRVRLEETLEQLAKQHNHLERAFRGAAQANASADSKSISGPGKGE-VSDDDDNEFFDAME--EAPEFITVPA 326          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000008795.1 (SMESG000008795.1)

HSP 1 Score: 1620.14 bits (4194), Expect = 0.000e+0
Identity = 818/821 (99.63%), Postives = 821/821 (100.00%), Query Frame = 3
Query:   69 METKNQNNVTLSSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVTLPSPEINLGVSLPSRCXXXXXXXXXXXXXXXXXXXXXXXXXNCSRNYTDNFFIGDSSTRGFEEVSNKRSLQRLKEARVISAKQSNQLKNRQKLITASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIFDNQNHTV 2531
            METKNQNNVTLSSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSALLAAQKKAQDLLKGCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVTLPSPEINLGVSLPSRCSELSLEYESDVEDELSDLSDNDSGLNCSRN+TDNFFIGDSSTRGFEEVSNKRSLQRLKEARVISAKQ+NQLKNRQKLITASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETV+GRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIFDNQNHTV
Sbjct:    1 METKNQNNVTLSSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSALLAAQKKAQDLLKGCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYRKLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQNQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVTLPSPEINLGVSLPSRCSELSLEYESDVEDELSDLSDNDSGLNCSRNHTDNFFIGDSSTRGFEEVSNKRSLQRLKEARVISAKQNNQLKNRQKLITASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVQGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIFDNQNHTV 821          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000023068.1 (SMESG000023068.1)

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 368/892 (41.26%), Postives = 496/892 (55.61%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRW-TSXXXXXXXXXXXXXXGCDNNDSE--LDSNELVNGF-----------------------------------ILKLNGHLEDIKKSQDVLYRKLDDLQK-------SIHDLDKDKNSNI---------------------------VGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQI---SSSVQNQLKL--------NINPNQEPSADEDVSDEDFYDAFESQEGVFNVTLPSPEINLGVSLPSR--------CXXXXXXXXXXXXXXXXXXXXXXXXXNCSRNYTDNFF--IGDSSTRGFEEVSNKRSLQRLKEARVISAKQSNQLKNRQKLITASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCES-NEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRR------VEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDW 2489
            KGYLYKWTNY+KGYQKRWFVL NGLLSYYRN++E++  CRGTIN+  + I   DS S VIS+   QTFHLK+Q+ESE  +W T+  LA            D++DSE  L S  L N                                     +  LN  +  +KK+ + L   L D+ K       S + ++ D + ++                           +G +   +   KE+   F V+  + + SC+ +A   T    K++K++++EREQR R+E MVE+LAKQ   LE +    S SV     L        N+       A +D  DE FYDA E  E VFNV+LP P     V L  +        CS  S   + + +          S  N S++   N    IGDSS      VS+    Q L  +  + A + NQ  N  K +     N+   ++  S      ++ + S  +  +  R RRT+I P+PN+++NLW ++KNCIGK+LSKIP+PVNF+EP+SM+QRL EDFEYS  LD AA C + +EQ+S+VAAFTVSSY+ T  R  KPFNPLLGET+E DRTDD GWR  AEQ+ HHPP+ ++HCES   W CW +F+MS+KFRGKY+ I P+G  HL F++S  HY W ++  T+HNIIVG++WIDNHGEMDI N  T + CHL+YK YS FS +  +RVTG ITDK      VLNGTWD   +   V+   +    +    T  +  L  +R+P P    + Y F++FA+ LNE EE++APTDSR RPDQ+LME G WDEANKEK RLEE+QR +R      +E  K  G    + E+KP+WF PV D E K+ T+ ++G YWE KA   W
Sbjct:   10 KGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEAVLDDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDASDISLYYKEFEQRLFDLNTSVSLVKKTSESLLNVLKDVNKLNSPHIISNYSINSDSSVDMKAHDQSSLNSHSSVLLNIDHRAPSHSSIGPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIE-DEHVFNVSLPRPISQNNVKLEPKYTINEYESCSSDSEYEKDNSKGNSIARVIVRSTENKSKSNHKNKINNIGDSSQFHRRTVSSGFPSQSLCPSNSLKANK-NQCDNLGKDLY----NVSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFP-PEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEANKEKERLEEKQREKRRNREKEIEQRKSQGLPP-IEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 893          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000023068.1 (SMESG000023068.1)

HSP 1 Score: 613.609 bits (1581), Expect = 0.000e+0
Identity = 370/891 (41.53%), Postives = 500/891 (56.12%), Query Frame = 3
Query:  114 KGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEMAQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSXXXXXXXXXXXXXXGCDNNDSE--LDSNELVNGF-----------------------------------ILKLNGHLEDIKKSQDVLYRKLDDLQK-------SIHDLDKDKNSNI---------------------------VGEIALKLKNIKERATIFRVSAASILTSCAAYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQI---SSSVQNQLKL--------NINPNQEPSADEDVSDEDFYDAFESQEGVFNVTLPSPEINLGVSLPSR--------CXXXXXXXXXXXXXXXXXXXXXXXXXNCSRNYTDNFF--IGDSSTRGFEEVSNKRSLQRLKEARVISAKQSNQLKNRQKLITASSNNMHKPINLVSLTYNTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCES-NEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRR------VEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDW 2489
            KGYLYKWTNY+KGYQKRWFVL NGLLSYYRN++E++  CRGTIN+  + I   DS S VIS+   QTFHLK+Q+ESE  +W +AL  A+  A  L +  D++DSE  L S  L N                                     +  LN  +  +KK+ + L   L D+ K       S + ++ D + ++                           +G +   +   KE+   F V+  + + SC+ +A   T    K++K++++EREQR R+E MVE+LAKQ   LE +    S SV     L        N+       A +D  DE FYDA E  E VFNV+LP P     V L  +        CS  S   + + +          S  N S++   N    IGDSS      VS+    Q L  +  + A + NQ  N  K +     N+   ++  S      ++ + S  +  +  R RRT+I P+PN+++NLW ++KNCIGK+LSKIP+PVNF+EP+SM+QRL EDFEYS  LD AA C + +EQ+S+VAAFTVSSY+ T  R  KPFNPLLGET+E DRTDD GWR  AEQ+ HHPP+ ++HCES   W CW +F+MS+KFRGKY+ I P+G  HL F++S  HY W ++  T+HNIIVG++WIDNHGEMDI N  T + CHL+YK YS FS +  +RVTG ITDK      VLNGTWD   +   V+   +    +    T  +  L  +R+P P    + Y F++FA+ LNE EE++APTDSR RPDQ+LME G WDEANKEK RLEE+QR +R      +E  K  G    + E+KP+WF PV D E K+ T+ ++G YWE KA   W
Sbjct:   10 KGYLYKWTNYIKGYQKRWFVLSNGLLSYYRNKNEVSHTCRGTINLSTSIIRKQDSFSIVISNDSNQTFHLKAQSESETNQWLTALHLAKDTAISLSEA-DDSDSEAPLGSPYLGNSLTKPHHSHSQNILPIDRLHSSDASDISLYYKEFEQRLFDLNTSVSLVKKTSESLLNVLKDVNKLNSPHIISNYSINSDSSVDMKAHDQSSLNSHSSVLLNIDHRAPSHSSIGPVPDLMHKFKEKNKTFFVATQACVNSCSEFANRATCIFSKYQKLLNTEREQRLRLEKMVEELAKQLGALEKKAVKQSESVGLNTSLPQHSDDEKNVRVKNTDQASDDSDDEYFYDAIE-DEHVFNVSLPRPISQNNVKLEPKYTINEYESCSSDSEYEKDNSKGNSIARVIVRSTENKSKSNHKNKINNIGDSSQFHRRTVSSGFPSQSLCPSNSLKANK-NQCDNLGKDLY----NVSGDVSTFSELKTAQSVPSLSTKVEKKPARVRRTKITPRPNMSINLWGIMKNCIGKELSKIPVPVNFNEPLSMIQRLTEDFEYSDCLDAAAECADSLEQLSWVAAFTVSSYSTTTNRTGKPFNPLLGETFEFDRTDDLGWRSLAEQVSHHPPAASLHCESIKGWKCWQEFTMSSKFRGKYLAIIPMGIAHLTFEKSNNHYTWRKVTSTVHNIIVGKLWIDNHGEMDIYNHKTGETCHLNYKAYSYFSKEPARRVTGVITDKDGVTKYVLNGTWDSHFQRAKVLHIRKDKNNQQVFETGPAETLWSRRFP-PEYTSEMYNFTNFALELNEPEENVAPTDSRLRPDQRLMETGFWDEANKEKERLEEKQREKRRNREKEIEQRKSQGLPP-IEEHKPVWFAPVFDEETKTTTHIYSGNYWETKATGAW 891          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000065901.1 (SMESG000065901.1)

HSP 1 Score: 235.343 bits (599), Expect = 2.523e-68
Identity = 157/455 (34.51%), Postives = 228/455 (50.11%), Query Frame = 3
Query: 1323 TRRTQIP-PKPN-INMNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAI---TDKLNNVCCVLNGTWDEKL-------------EAKNVISNTETV----KGRTYLATEESSI---------------LLWQRYPLPPNFDKYYYFSSFAITLNEIEE----DIAPTDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRV------------------EILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECKAKKDWSMCNKIF 2510
            T RT +P P P+ +N ++W+ +K CIGK+LSKI MP+ F+EPIS LQRL E  EYS +LD+A +  +PI+++  + AF VS  A+   RI KPFNPLLGETYEL R +   ++  +EQ+CHHPP  A H ES  +  +        F GK + I P G   L        Y W+ +  T+HN+I+G++WI++ G M IIN +      L++     F  +   RV G I     K  +V   + G W E L              +K  +++T+ +    KG       +  +               L+W+  P P N   +Y F+SF + LN+I +    ++ PTDSR R D + MEEG  DEA   K  LEE+QR++RV                  EI  +   KE      P+WF    +       ++F G+YW     +DWS+C  IF
Sbjct:   26 TYRTGLPKPMPSKLNFSVWTFLKQCIGKELSKITMPIVFNEPISFLQRLTEYIEYSELLDQAVAEIDPIKRMEKICAFAVSGGASNWGRIGKPFNPLLGETYELHRPN---FKYVSEQICHHPPVSAFHVESPTFKFYGAIHPKLNFWGKSVVITPKGNITLELLPWNEVYTWQNVVCTVHNVIIGKIWIEHSGPMRIINHSNNCIADLTFHSVGWFGKNM-HRVDGDIYYGQRKSRHVERKVYGKWTEALFSVSPEVWNDDSSTSKRHVNSTDQIENDEKGDNNNNDIDDPLPQDNTPCDMKLLNQRLIWKAKPRPDNSAIFYNFTSFTMGLNQITDSFSRELPPTDSRFRQDMRYMEEGLLDEAANAKNYLEEKQRAKRVALKSSNSKKNMNKSSSSHEITDIRNQKE-----GPVWFAEKLNSYTNKMEWQFTGEYW----NRDWSVCPDIF 467          
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Match: SMESG000046022.1 (SMESG000046022.1)

HSP 1 Score: 233.417 bits (594), Expect = 2.421e-64
Identity = 144/396 (36.36%), Postives = 220/396 (55.56%), Query Frame = 3
Query: 1311 RSKRTRRTQIPP-KPNIN-MNLWSVVKNCIGKDLSKIPMPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYAATAYRIN-KPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNEWVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNIIVGRVWIDNHGEMDII-NLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLNNVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPNFDKYYYFSSFAITLNEIEEDIAP----TDSRNRPDQKLMEEGKWDEANKEKARLEEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWECK 2474
            + K  RR ++P  +P+I+  +L +++   IG+DLSK+ +PV  +EP+S+LQ L E+ EYS +LD AA   + +E+++Y+AAF VS+YA+T YR   KPFNP++GETYE  R D  GW+  AEQ+ HHPP    +CES  W  W +F + NKF GK I+  P G   +  K+      W ++   I+NI     +I+++G+M+   NL +  K    +K  S         VTG I+   ++    L G W E +                Y+   +++  +W+   +P + DKYY F+ FAI LN ++ D+A     TDSR RPDQ+ +E G   EA  EK ++EE Q   R+ + K+ G       +KPLWF       +KS++Y+F  +YW  K
Sbjct:  497 QEKTGRRDKLPAVQPDISQFSLINLLCKNIGRDLSKVRLPVILNEPLSVLQMLCEELEYSDLLDAAAKSSDSLERMNYIAAFAVSAYASTFYRAGTKPFNPIIGETYEYVRPDK-GWKFIAEQVSHHPPVSVCYCESENWSIWQEFRLKNKFWGKSIEAIPTGSLRVYLKKFNETVHWNKVTTCIYNIFGSNRYIEHYGDMNFTSNLNSSAKITF-HKSNSWVHQKF--EVTGTISCP-DSRKSQLFGKWTEGI----------------YVG--DNARCIWRPGAIPKDHDKYYGFTQFAIDLNNLDSDLAATLPKTDSRFRPDQRYLEMGLITEAEAEKTKIEELQ---RIALAKVKGD----VNWKPLWFK--KHESSKSESYEFTNEYWSAK 860          
The following BLAST results are available for this feature:
BLAST of Oxysterol-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
OSBP21.070e-14349.18oxysterol binding protein 2 [Source:HGNC Symbol;Ac... [more]
OSBP27.204e-14349.18oxysterol binding protein 2 [Source:HGNC Symbol;Ac... [more]
OSBP21.372e-14249.53oxysterol binding protein 2 [Source:HGNC Symbol;Ac... [more]
OSBP21.375e-14249.18oxysterol binding protein 2 [Source:HGNC Symbol;Ac... [more]
OSBP23.791e-14249.65oxysterol binding protein 2 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
obr-15.411e-12448.29Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
obr-16.737e-12448.29Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
obr-17.389e-12348.29Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
obr-11.895e-12248.29Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
obr-11.049e-12148.29Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Osbp0.000e+038.69gene:FBgn0020626 transcript:FBtr0084801[more]
CG38606.498e-6532.67gene:FBgn0034951 transcript:FBtr0072201[more]
CG38605.457e-5338.58gene:FBgn0034951 transcript:FBtr0343288[more]
cert1.715e-1623.69gene:FBgn0027569 transcript:FBtr0345035[more]
cert1.715e-1623.69gene:FBgn0027569 transcript:FBtr0076717[more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR932437.11.768e-14953.02oxysterol binding protein 2 [Source:NCBI gene;Acc:... [more]
CR932437.11.933e-14953.02oxysterol binding protein 2 [Source:NCBI gene;Acc:... [more]
CR932437.15.703e-14953.02oxysterol binding protein 2 [Source:NCBI gene;Acc:... [more]
osbp25.573e-14853.23oxysterol binding protein 2 [Source:ZFIN;Acc:ZDB-G... [more]
osbp26.168e-14853.23oxysterol binding protein 2 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc63.398e-14650.59coiled-coil domain containing 6 [Source:Xenbase;Ac... [more]
ccdc63.893e-14651.80coiled-coil domain containing 6 [Source:Xenbase;Ac... [more]
OSBP1.120e-13551.60oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
OSBP1.347e-13551.60oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
OSBP2.244e-13551.60oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Osbp24.426e-14248.94oxysterol binding protein 2 [Source:MGI Symbol;Acc... [more]
Osbp21.797e-14148.94oxysterol binding protein 2 [Source:MGI Symbol;Acc... [more]
Osbp2.271e-13852.68oxysterol binding protein [Source:MGI Symbol;Acc:M... [more]
Osbp27.855e-13849.29oxysterol binding protein 2 [Source:MGI Symbol;Acc... [more]
Osbpl34.564e-8139.14oxysterol binding protein-like 3 [Source:MGI Symbo... [more]
back to top
BLAST of Oxysterol-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22059|OSBP1_HUMAN7.851e-14050.32Oxysterol-binding protein 1 OS=Homo sapiens OX=960... [more]
sp|Q969R2|OSBP2_HUMAN3.291e-13949.53Oxysterol-binding protein 2 OS=Homo sapiens OX=960... [more]
sp|P16258|OSBP1_RABIT1.377e-13849.68Oxysterol-binding protein 1 OS=Oryctolagus cunicul... [more]
sp|Q3B7Z2|OSBP1_MOUSE1.588e-13752.68Oxysterol-binding protein 1 OS=Mus musculus OX=100... [more]
sp|Q5QNQ6|OSBP2_MOUSE5.494e-13749.29Oxysterol-binding protein 2 OS=Mus musculus OX=100... [more]
back to top
BLAST of Oxysterol-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504XP160.000e+042.76Oxysterol-binding protein OS=Fasciola gigantica OX... [more]
A0A564YHR50.000e+044.34Oxysterol-binding protein OS=Hymenolepis diminuta ... [more]
A0A0R3X2E00.000e+042.60Oxysterol-binding protein OS=Hydatigena taeniaefor... [more]
W6UQH00.000e+042.65Oxysterol-binding protein OS=Echinococcus granulos... [more]
R7TZ290.000e+044.92PH domain-containing protein OS=Capitella teleta O... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osbp7.626e-14551.21oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
osbp5.351e-14150.48oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
osbp1.016e-13949.42oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
osbp1.925e-13747.99oxysterol binding protein [Source:NCBI gene;Acc:10... [more]
osbp23.249e-13648.92oxysterol binding protein 2 [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osbp9.164e-14548.54oxysterol binding protein [Source:ZFIN;Acc:ZDB-GEN... [more]
osbpl61.899e-7136.27oxysterol binding protein-like 6 [Source:ZFIN;Acc:... [more]
osbpl1a5.915e-6136.21oxysterol binding protein-like 1A [Source:ZFIN;Acc... [more]
osbpl62.703e-3148.48oxysterol binding protein-like 6 [Source:ZFIN;Acc:... [more]
OSBPL83.562e-1424.83oxysterol binding protein like 8 [Source:HGNC Symb... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
OSH25.884e-7837.09Member of an oxysterol-binding protein family with... [more]
SWH15.496e-7235.68Protein similar to mammalian oxysterol-binding pro... [more]
OSH31.811e-5133.17Member of an oxysterol-binding protein family; thi... [more]
OSH65.555e-1324.01Member of an oxysterol-binding protein family; fam... [more]
OSH72.431e-930.77Oxysterol-binding protein; part of family with sev... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO441251.070e-14952.44Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
EDO414411.049e-8839.79Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
EDO397673.666e-7134.66Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
EDO284323.223e-1640.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478002.228e-1526.24Oxysterol-binding protein [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Oxysterol-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
osbp21.275e-14747.63oxysterol-binding protein 2 [Source:NCBI gene;Acc:... [more]
si:ch211-106a19.19.676e-14551.49oxysterol-binding protein 2 [Source:NCBI gene;Acc:... [more]
si:ch211-106a19.12.539e-14448.30oxysterol-binding protein 2 [Source:NCBI gene;Acc:... [more]
si:ch211-106a19.12.197e-14248.12oxysterol-binding protein 2 [Source:NCBI gene;Acc:... [more]
ENSORLT00000007524.25.379e-13149.76oxysterol-binding protein 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Oxysterol-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000008795.10.000e+099.63SMESG000008795.1[more]
SMESG000023068.10.000e+041.26SMESG000023068.1[more]
SMESG000023068.10.000e+041.53SMESG000023068.1[more]
SMESG000065901.12.523e-6834.51SMESG000065901.1[more]
SMESG000046022.12.421e-6436.36SMESG000046022.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014257 ID=SMED30014257|Name=Oxysterol-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2688bp
GTTTATTTTATTTAAATTATGATTAATTAATTATTGTATTTAACTAAAGT
TAATTTTAACAAATAATTATGGAGACTAAAAATCAAAATAATGTGACATT
ATCGAGCAATATAAAAGGTTATTTATATAAATGGACTAATTATTTAAAAG
GCTACCAAAAACGTTGGTTCGTTTTACAAAATGGATTATTATCATATTAT
CGAAATCAATCGGAAATGGCACAGATATGTCGAGGAACAATTAACATTGT
TAATGCCAAAATCAACTTAGTTGATTCTACATCATTTGTTATTAGTCATA
GTGGTATGCAAACTTTTCATTTAAAATCACAGAATGAATCAGAAATGAAG
CGATGGACATCAGCCCTGTTAGCTGCACAAAAAAAAGCACAGGATTTGCT
CAAAGGATGTGACAATAATGATTCTGAACTTGATTCTAATGAACTTGTCA
ATGGATTTATTTTGAAACTCAATGGACATCTTGAAGACATAAAAAAATCA
CAAGATGTTCTCTATCGCAAACTCGATGATCTACAAAAATCTATTCACGA
TCTCGACAAAGATAAAAATAGCAATATAGTTGGAGAAATAGCTCTTAAAC
TGAAAAATATCAAGGAACGAGCCACCATTTTCCGGGTTTCAGCTGCCAGC
ATATTAACTTCTTGTGCGGCTTATGCCGAATCTGTTACTGGAGAAGCTGA
AAAATGGAGAAAGGTTATTGACAGTGAACGCGAGCAACGTCAAAGAATGG
AGAATATGGTTGAAGATTTAGCGAAACAACATCGCCATTTAGAATATCAA
ATCAGTTCCTCAGTACAAAATCAATTGAAATTAAATATAAATCCAAATCA
AGAACCTTCTGCTGATGAAGATGTGTCTGATGAAGATTTTTATGATGCTT
TCGAAAGTCAGGAAGGGGTTTTTAATGTGACATTGCCAAGTCCAGAAATA
AATTTAGGTGTTTCATTACCCAGCAGGTGTAGTGAATTATCGCTCGAGTA
TGAGTCTGATGTTGAAGATGAACTGTCTGATCTTTCTGATAACGATTCTG
GATTAAATTGTAGTCGAAATTACACGGATAACTTTTTCATAGGTGATAGT
TCAACTAGAGGTTTTGAGGAAGTTTCAAACAAAAGAAGTCTTCAGCGTTT
AAAAGAAGCTAGAGTTATAAGTGCAAAGCAGAGTAATCAATTAAAAAATA
GGCAAAAATTAATAACAGCCTCGTCGAACAATATGCACAAGCCTATTAAT
TTAGTTTCATTGACATATAACACATCAAATATTGCTACTTTCTCCGAAGT
TATTCCTATTAGAAGTAAACGGACAAGAAGAACACAGATTCCTCCGAAAC
CAAATATTAATATGAATCTTTGGAGTGTAGTTAAAAATTGTATCGGAAAG
GATTTAAGCAAAATACCGATGCCGGTTAATTTCAGCGAACCAATTTCTAT
GTTACAGAGATTGGCTGAAGATTTTGAATACTCTAGTATTTTGGATAAGG
CAGCTAGTTGTCAAAACCCAATTGAGCAAATTTCATATGTGGCAGCATTT
ACTGTTTCATCATATGCTGCAACTGCCTATCGGATTAATAAACCTTTTAA
CCCATTGCTTGGAGAAACATACGAACTAGACCGCACCGATGATTTCGGGT
GGAGATTATTTGCCGAGCAATTGTGCCATCATCCCCCTTCATGTGCCGTC
CACTGTGAAAGCAATGAATGGGTGTGCTGGTTTGACTTTTCAATGAGTAA
CAAATTTAGAGGGAAATATATTCAAATACACCCAATTGGAAAATGTCATT
TGTTATTTAAGCGTTCTAAATATCATTATGTCTGGGAAAGGATTCCAATG
ACTATTCACAATATAATTGTTGGTCGTGTTTGGATTGATAATCATGGTGA
AATGGACATAATCAATTTAACAACAGAAGATAAATGCCATTTATCCTATA
AGCCTTACTCAATGTTTTCAAATGATACTCCGAAAAGAGTAACAGGAGCT
ATTACAGATAAACTGAATAATGTCTGCTGTGTTCTTAACGGTACATGGGA
CGAAAAATTAGAAGCAAAAAATGTAATTTCAAATACAGAAACTGTCAAAG
GTCGAACATATTTAGCAACTGAAGAATCATCTATTTTGTTATGGCAGAGA
TATCCTTTACCTCCAAATTTTGATAAATATTACTATTTTAGTTCCTTTGC
TATTACGTTAAATGAAATTGAAGAGGATATTGCACCGACTGATAGTCGCA
ATAGACCAGATCAAAAATTGATGGAAGAAGGAAAATGGGATGAAGCTAAT
AAAGAAAAAGCAAGATTAGAAGAACAACAAAGAAGTCGCCGGGTTGAAAT
TCTTAAATTAGATGGAACAAAAGAATTCGTGTACGAGTATAAACCTTTAT
GGTTTGATCCAGTCACAGATCCTGAAGCCAAATCAAAAACATACAAATTC
AACGGGAAATATTGGGAATGCAAAGCCAAGAAAGACTGGTCTATGTGCAA
TAAAATATTTGATAATCAAAATCATACAGTTTGAGATTTTTATCGCCGTA
TCCAGATAGATAAGTACTGGATTTTATTTACGCTCTGTCTAGTTGCATTT
TCGATAAAGAGAAATAAATTCTATTTATTAGTATCATGGCTTTGATTTGA
GATTTTTAATGTTATTCATATTTTGAATAAAGTCTTCC
back to top

protein sequence of SMED30014257-orf-1

>SMED30014257-orf-1 ID=SMED30014257-orf-1|Name=SMED30014257-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=822bp
METKNQNNVTLSSNIKGYLYKWTNYLKGYQKRWFVLQNGLLSYYRNQSEM
AQICRGTINIVNAKINLVDSTSFVISHSGMQTFHLKSQNESEMKRWTSAL
LAAQKKAQDLLKGCDNNDSELDSNELVNGFILKLNGHLEDIKKSQDVLYR
KLDDLQKSIHDLDKDKNSNIVGEIALKLKNIKERATIFRVSAASILTSCA
AYAESVTGEAEKWRKVIDSEREQRQRMENMVEDLAKQHRHLEYQISSSVQ
NQLKLNINPNQEPSADEDVSDEDFYDAFESQEGVFNVTLPSPEINLGVSL
PSRCSELSLEYESDVEDELSDLSDNDSGLNCSRNYTDNFFIGDSSTRGFE
EVSNKRSLQRLKEARVISAKQSNQLKNRQKLITASSNNMHKPINLVSLTY
NTSNIATFSEVIPIRSKRTRRTQIPPKPNINMNLWSVVKNCIGKDLSKIP
MPVNFSEPISMLQRLAEDFEYSSILDKAASCQNPIEQISYVAAFTVSSYA
ATAYRINKPFNPLLGETYELDRTDDFGWRLFAEQLCHHPPSCAVHCESNE
WVCWFDFSMSNKFRGKYIQIHPIGKCHLLFKRSKYHYVWERIPMTIHNII
VGRVWIDNHGEMDIINLTTEDKCHLSYKPYSMFSNDTPKRVTGAITDKLN
NVCCVLNGTWDEKLEAKNVISNTETVKGRTYLATEESSILLWQRYPLPPN
FDKYYYFSSFAITLNEIEEDIAPTDSRNRPDQKLMEEGKWDEANKEKARL
EEQQRSRRVEILKLDGTKEFVYEYKPLWFDPVTDPEAKSKTYKFNGKYWE
CKAKKDWSMCNKIFDNQNHTV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR037239OSBP_sf
IPR015155PFU
IPR001849PH_domain
IPR011993PH-like_dom_sf
IPR000648Oxysterol-bd
IPR018494Oxysterol-bd_CS
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006869lipid transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 210..244
NoneNo IPR availableCOILSCoilCoilcoord: 358..378
NoneNo IPR availableGENE3DG3DSA:2.40.160.120coord: 515..687
e-value: 6.2E-20
score: 73.3
NoneNo IPR availablePANTHERPTHR10972:SF103OXYSTEROL-BINDING PROTEINcoord: 12..812
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 15..112
IPR001849Pleckstrin homology domainSMARTSM00233PH_updatecoord: 13..107
e-value: 9.8E-18
score: 74.9
IPR001849Pleckstrin homology domainPFAMPF00169PHcoord: 15..104
e-value: 2.4E-12
score: 47.3
IPR001849Pleckstrin homology domainPROSITEPS50003PH_DOMAINcoord: 12..105
score: 15.049
IPR000648Oxysterol-binding proteinPFAMPF01237Oxysterol_BPcoord: 433..800
e-value: 1.9E-135
score: 451.5
IPR000648Oxysterol-binding proteinPANTHERPTHR10972OXYSTEROL-BINDING PROTEIN-RELATEDcoord: 12..812
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 9..110
e-value: 7.9E-26
score: 92.1
IPR018494Oxysterol-binding protein, conserved sitePROSITEPS01013OSBPcoord: 533..543
IPR037239Oxysterol-binding protein superfamilySUPERFAMILYSSF144000Oxysterol-binding protein-likecoord: 428..815