Ras-related protein Rab-5A

Overview
NameRas-related protein Rab-5A
Smed IDSMED30014246
Length (bp)1135
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras-related protein Rab-5A (SMED30014246) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras-related protein Rab-5A (SMED30014246) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras-related protein Rab-5A (SMED30014246) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras-related protein Rab-5A (SMED30014246) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014246

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30014246h1SMcG0010192 Contig1099GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30014246h1SMcG0010192 Contig1099GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30014246h1SMcG0010192 Contig1099GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30014246h1SMcG0010192 dd_Smed_v4_796_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014246h1SMcG0010192 OX_Smed_1.0.21295ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras-related protein Rab-5A vs. Ensembl Human
Match: RAB5C (RAB5C, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9785])

HSP 1 Score: 278.485 bits (711), Expect = 8.615e-93
Identity = 130/186 (69.89%), Postives = 152/186 (81.72%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQ 604
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+ D+F RAKNW++EL  +A+   VIALAGNK+DL+++R V   +   YA +N LLFMETSAKT+ NVNEIF+ IAKKLP++E        G+
Sbjct:   11 NGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGR 196          
BLAST of Ras-related protein Rab-5A vs. Ensembl Human
Match: RAB5C (RAB5C, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9785])

HSP 1 Score: 278.485 bits (711), Expect = 8.615e-93
Identity = 130/186 (69.89%), Postives = 152/186 (81.72%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQ 604
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+ D+F RAKNW++EL  +A+   VIALAGNK+DL+++R V   +   YA +N LLFMETSAKT+ NVNEIF+ IAKKLP++E        G+
Sbjct:   11 NGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGR 196          
BLAST of Ras-related protein Rab-5A vs. Ensembl Human
Match: RAB5A (RAB5A, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9783])

HSP 1 Score: 277.33 bits (708), Expect = 2.055e-92
Identity = 131/184 (71.20%), Postives = 155/184 (84.24%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGS 598
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHE+QEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+++SF RAKNW++EL  +A+   VIAL+GNK+DL+ +R V   +  +YA +N LLFMETSAKTS NVNEIF+ IAKKLP++E   QN G+
Sbjct:   10 NGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNE--PQNPGA 191          
BLAST of Ras-related protein Rab-5A vs. Ensembl Human
Match: RAB5C (RAB5C, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9785])

HSP 1 Score: 278.1 bits (710), Expect = 3.556e-92
Identity = 130/186 (69.89%), Postives = 152/186 (81.72%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQ 604
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+ D+F RAKNW++EL  +A+   VIALAGNK+DL+++R V   +   YA +N LLFMETSAKT+ NVNEIF+ IAKKLP++E        G+
Sbjct:   44 NGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGR 229          
BLAST of Ras-related protein Rab-5A vs. Ensembl Human
Match: RAB5B (RAB5B, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9784])

HSP 1 Score: 269.24 bits (687), Expect = 3.461e-89
Identity = 127/174 (72.99%), Postives = 148/174 (85.06%), Query Frame = 2
Query:   74 VQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAG 595
             QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQ+V ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+Q++F RAK W++EL  +A+   VIALAGNK+DL+ +R V   +   YA +N LLFMETSAKT+ NVN++FL IAKKLP+ E   QN G
Sbjct:   19 CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSE--PQNLG 190          
BLAST of Ras-related protein Rab-5A vs. Ensembl Celegans
Match: rab-5 (RAB family [Source:UniProtKB/TrEMBL;Acc:P91857])

HSP 1 Score: 271.552 bits (693), Expect = 1.504e-90
Identity = 124/167 (74.25%), Postives = 147/167 (88.02%), Query Frame = 2
Query:   65 NRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLP 565
            NR  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++D T+KFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+Q+SF +AKNW++EL  +A+   V+ALAGNK+D++ +R V   + + YA++N LLFMETSAKTS NVN+IF+ IAKKLP
Sbjct:   15 NRTCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDATIKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQESFQKAKNWVKELQRQASPNIVMALAGNKADVANKRTVEYEEANAYAEDNALLFMETSAKTSMNVNDIFMAIAKKLP 181          
BLAST of Ras-related protein Rab-5A vs. Ensembl Celegans
Match: rab-6.2 (Ras-related protein Rab-6.2 [Source:UniProtKB/Swiss-Prot;Acc:Q22782])

HSP 1 Score: 165.622 bits (418), Expect = 2.415e-49
Identity = 78/164 (47.56%), Postives = 115/164 (70.12%), Query Frame = 2
Query:   77 QFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQEL-TEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLP 565
            +FKLV LGE +VGK+SL+ RF+   F    ++T+G  FL++T+ +ED TV+ ++WDTAGQER+ SL P Y R +  A+VVYDIT+ +SFH+   WI ++ TE+ + V +I L GNK+DLS +R+V+  +G   A+E  ++F+ETSAK   NV ++F  IA  LP
Sbjct:   10 KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNSNSFHQTSKWIDDVRTERGSDV-IIMLVGNKTDLSDKRQVTTDEGERKAKELNVMFIETSAKAGYNVKQLFRRIAGALP 172          
BLAST of Ras-related protein Rab-5A vs. Ensembl Celegans
Match: rab-6.1 (Ras-related protein Rab-6.1 [Source:UniProtKB/Swiss-Prot;Acc:P34213])

HSP 1 Score: 163.31 bits (412), Expect = 1.741e-48
Identity = 72/163 (44.17%), Postives = 112/163 (68.71%), Query Frame = 2
Query:   77 QFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLP 565
            +FKLV LGE +VGK+S++ RF+   F    ++T+G  FL++T+ +ED T++ ++WDTAGQER+ SL P Y R +  A+VVYDIT+ +SFH+   W+ ++  +     +I L GNK+DL+ +R+VS  DG   A++  ++F+ETSAK   NV ++F +IA  LP
Sbjct:   11 KFKLVFLGEQSVGKTSIITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDITNANSFHQTTKWVDDVRNERGCDVIIVLVGNKTDLADKRQVSTEDGEKKARDLNVMFIETSAKAGYNVKQLFRKIATALP 173          
BLAST of Ras-related protein Rab-5A vs. Ensembl Celegans
Match: rab-21 (RAB family [Source:UniProtKB/TrEMBL;Acc:Q22045])

HSP 1 Score: 162.155 bits (409), Expect = 4.482e-48
Identity = 74/168 (44.05%), Postives = 108/168 (64.29%), Query Frame = 2
Query:   68 RQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRH 571
            +  +FK+VLLGE  VGKSSLV+RFV+ +F     ST+ A+F  +TV VED      IWDTAGQE+YH+L P+YYRG+   ++V+DIT + SF + KNW+ E+     +   I + GNK DL  +R+V+  D   YA+  G L+METSA+ +  +++ F  +  K+  H
Sbjct:    9 KSFKFKIVLLGEGCVGKSSLVLRFVENKFSCKHLSTIQASFQNKTVNVEDCQADLHIWDTAGQEKYHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTCLGNTAEILIVGNKIDLEEERQVTRQDAEAYAESEGALYMETSAQDNVGISDAFESLTAKMIEH 176          
BLAST of Ras-related protein Rab-5A vs. Ensembl Celegans
Match: unc-108 (pep chromosome:WBcel235:I:3824947:3826514:1 gene:WBGene00006833.1 transcript:F53F10.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-108)

HSP 1 Score: 161.384 bits (407), Expect = 1.440e-47
Identity = 72/163 (44.17%), Postives = 113/163 (69.33%), Query Frame = 2
Query:   80 FKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPR 568
            FK +++G++ VGKS L+++F   +F    + T+G  F  + V ++   +K +IWDTAGQE + S+   YYRGA  A++VYDIT +D+F+   +W+++  + + S  VI L GNKSDL A+REV   +G  +A+E+GL+FMETSAKT++NV E F++ AK++ R
Sbjct:    7 FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNMVIMLIGNKSDLEARREVKREEGEAFAREHGLVFMETSAKTAANVEEAFIDTAKEIYR 169          
BLAST of Ras-related protein Rab-5A vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0330670)

HSP 1 Score: 280.026 bits (715), Expect = 1.135e-93
Identity = 131/173 (75.72%), Postives = 149/173 (86.13%), Query Frame = 2
Query:   56 TMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
            T QN+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQT+ +EDT VKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDI +QDSF RAK W++EL ++A+   VIALAGNK+DLS  R V   +   YA+ENGLLFMETSAKT  NVN+IFL IAKKLP+++
Sbjct:   22 TSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKND 194          
BLAST of Ras-related protein Rab-5A vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0077796)

HSP 1 Score: 280.026 bits (715), Expect = 1.135e-93
Identity = 131/173 (75.72%), Postives = 149/173 (86.13%), Query Frame = 2
Query:   56 TMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
            T QN+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQT+ +EDT VKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDI +QDSF RAK W++EL ++A+   VIALAGNK+DLS  R V   +   YA+ENGLLFMETSAKT  NVN+IFL IAKKLP+++
Sbjct:   22 TSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKND 194          
BLAST of Ras-related protein Rab-5A vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0077793)

HSP 1 Score: 280.026 bits (715), Expect = 1.135e-93
Identity = 131/173 (75.72%), Postives = 149/173 (86.13%), Query Frame = 2
Query:   56 TMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
            T QN+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQT+ +EDT VKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDI +QDSF RAK W++EL ++A+   VIALAGNK+DLS  R V   +   YA+ENGLLFMETSAKT  NVN+IFL IAKKLP+++
Sbjct:   22 TSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKND 194          
BLAST of Ras-related protein Rab-5A vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0077797)

HSP 1 Score: 280.026 bits (715), Expect = 1.135e-93
Identity = 131/173 (75.72%), Postives = 149/173 (86.13%), Query Frame = 2
Query:   56 TMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
            T QN+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQT+ +EDT VKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDI +QDSF RAK W++EL ++A+   VIALAGNK+DLS  R V   +   YA+ENGLLFMETSAKT  NVN+IFL IAKKLP+++
Sbjct:   22 TSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKND 194          
BLAST of Ras-related protein Rab-5A vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0077795)

HSP 1 Score: 280.026 bits (715), Expect = 1.135e-93
Identity = 131/173 (75.72%), Postives = 149/173 (86.13%), Query Frame = 2
Query:   56 TMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
            T QN+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQT+ +EDT VKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDI +QDSF RAK W++EL ++A+   VIALAGNK+DLS  R V   +   YA+ENGLLFMETSAKT  NVN+IFL IAKKLP+++
Sbjct:   22 TSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKND 194          
BLAST of Ras-related protein Rab-5A vs. Ensembl Zebrafish
Match: rab5aa (RAB5A, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-030131-139])

HSP 1 Score: 280.026 bits (715), Expect = 1.437e-93
Identity = 130/180 (72.22%), Postives = 153/180 (85.00%), Query Frame = 2
Query:   65 NRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQ 604
            N+  QFKLVLLGESAVGKSSLV+RFVKGQFHE+QEST+GAAFLTQT+ ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+++SF RAKNW++EL  +A+   VIAL+GNK+DL+ +R V   D  +YA +N LLFMETSAKTS NVNEIF+ IAKKLP+ E     A SG+
Sbjct:   17 NKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKSEPQAAGANSGR 196          
BLAST of Ras-related protein Rab-5A vs. Ensembl Zebrafish
Match: rab5aa (RAB5A, member RAS oncogene family, a [Source:ZFIN;Acc:ZDB-GENE-030131-139])

HSP 1 Score: 280.026 bits (715), Expect = 1.437e-93
Identity = 130/180 (72.22%), Postives = 153/180 (85.00%), Query Frame = 2
Query:   65 NRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQ 604
            N+  QFKLVLLGESAVGKSSLV+RFVKGQFHE+QEST+GAAFLTQT+ ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+++SF RAKNW++EL  +A+   VIAL+GNK+DL+ +R V   D  +YA +N LLFMETSAKTS NVNEIF+ IAKKLP+ E     A SG+
Sbjct:   17 NKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKSEPQAAGANSGR 196          
BLAST of Ras-related protein Rab-5A vs. Ensembl Zebrafish
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 275.404 bits (703), Expect = 1.041e-91
Identity = 128/177 (72.32%), Postives = 150/177 (84.75%), Query Frame = 2
Query:   44 NNSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
            N +  + N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQT+ ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+ D+F RAKNW++EL  +A+   VIALAGNK+DL+ +R V   +   YA +N LLFMETSAKT+ NVNEIF+ IAKKLP+ E
Sbjct:   11 NGAAPVGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFTRAKNWVKELQRQASPNIVIALAGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKSE 187          
BLAST of Ras-related protein Rab-5A vs. Ensembl Zebrafish
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 275.404 bits (703), Expect = 1.041e-91
Identity = 128/177 (72.32%), Postives = 150/177 (84.75%), Query Frame = 2
Query:   44 NNSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
            N +  + N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQT+ ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+ D+F RAKNW++EL  +A+   VIALAGNK+DL+ +R V   +   YA +N LLFMETSAKT+ NVNEIF+ IAKKLP+ E
Sbjct:   11 NGAAPVGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFTRAKNWVKELQRQASPNIVIALAGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKSE 187          
BLAST of Ras-related protein Rab-5A vs. Ensembl Zebrafish
Match: rab5ab (RAB5A, member RAS oncogene family, b [Source:ZFIN;Acc:ZDB-GENE-040122-3])

HSP 1 Score: 275.018 bits (702), Expect = 1.141e-91
Identity = 130/184 (70.65%), Postives = 155/184 (84.24%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGS 598
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHE+QEST+GAAFLTQT+ ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+++SF RAKNW++EL  +A+   VIALAGNK+DL+ +R +   D  +YA +N LLFMETSAKTS NV+EIF+ IAKKLP++E   Q AG+
Sbjct:   11 NGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTLCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKADLANKRALDFQDAQSYADDNSLLFMETSAKTSMNVSEIFMAIAKKLPKNE--PQPAGA 192          
BLAST of Ras-related protein Rab-5A vs. Ensembl Xenopus
Match: rab5a (RAB5A, member RAS oncogene family [Source:NCBI gene;Acc:493430])

HSP 1 Score: 274.248 bits (700), Expect = 3.225e-91
Identity = 128/176 (72.73%), Postives = 150/176 (85.23%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHE+QEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+++SF RAKNW++EL  +A+   VIAL+GNK+DL+++R V   +   YA +N LLFMETSAKTS NVNEIF+ IAKKLP+ E
Sbjct:   11 NGPNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLASKRAVDFQEAQAYADDNSLLFMETSAKTSVNVNEIFMAIAKKLPKTE 186          
BLAST of Ras-related protein Rab-5A vs. Ensembl Xenopus
Match: rab5b (RAB5B, member RAS oncogene family [Source:NCBI gene;Acc:448258])

HSP 1 Score: 266.929 bits (681), Expect = 2.701e-88
Identity = 124/186 (66.67%), Postives = 153/186 (82.26%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQ 604
            N  +  ++  QFKLVLLGESAVGKSSLV+RFVKGQFHE+QEST+GAAFLTQ+V ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+Q++F RAK W++EL  +A+   VIAL+GNK+DL+++R V   +   YA +N LLFMETSAKT+ NVN++FL IAKKLP+ E    +   G+
Sbjct:   10 NGQSQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPNIVIALSGNKADLTSKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKTEPQNTSGAPGR 195          
BLAST of Ras-related protein Rab-5A vs. Ensembl Xenopus
Match: rab5d (RAB5D, member RAS oncogene family [Source:NCBI gene;Acc:594964])

HSP 1 Score: 253.832 bits (647), Expect = 3.120e-83
Identity = 117/171 (68.42%), Postives = 143/171 (83.63%), Query Frame = 2
Query:   62 QNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
            Q +  QFKLVLLG+ AVGKSSLV+RFVKGQF E+QE+T+GAAFL Q+V ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVV+DIT  ++F RAK W++EL  +A+   VIALAGNKSDL+ +R V   +   YA++ GLLFMETSAKT+ NVNE+FL IAKK+P+ +
Sbjct:   14 QTKICQFKLVLLGDMAVGKSSLVLRFVKGQFDEFQETTIGAAFLAQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVFDITKPETFDRAKAWVKELQRQASPNIVIALAGNKSDLAEKRMVEYEEAQAYAEDTGLLFMETSAKTAMNVNELFLAIAKKMPKSD 184          
BLAST of Ras-related protein Rab-5A vs. Ensembl Xenopus
Match: ncapd2 (non-SMC condensin I complex subunit D2 [Source:Xenbase;Acc:XB-GENE-5854776])

HSP 1 Score: 185.652 bits (470), Expect = 7.813e-57
Identity = 86/178 (48.31%), Postives = 121/178 (67.98%), Query Frame = 2
Query:   77 QFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQRL 610
            + K+ LLG++ VGKSS+V RFV+  F      T+GA+F+T+TV   +   KF IWDTAGQER+HSLAPMYYRG+ AA++VYDIT QD+FH  K W++EL E      V+A+AGNK DLS  REV++ D   YA+  G + +ETSAK + NV E+F  I++++P  + +   +    +L
Sbjct:    5 ELKVCLLGDTGVGKSSIVSRFVQDHFDHNISPTIGASFMTKTVPSGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDTFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDTREVTMKDAREYAESIGAIVVETSAKNAINVEELFQGISRRIPPLDPHENGSNGAMKL 182          
BLAST of Ras-related protein Rab-5A vs. Ensembl Xenopus
Match: ncapd2 (non-SMC condensin I complex subunit D2 [Source:Xenbase;Acc:XB-GENE-5854776])

HSP 1 Score: 177.563 bits (449), Expect = 1.463e-53
Identity = 83/175 (47.43%), Postives = 116/175 (66.29%), Query Frame = 2
Query:   86 LVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQRL 610
            + L    +VGKSS+V RFV+  F      T+GA+F+T+TV   +   KF IWDTAGQER+HSLAPMYYRG+ AA++VYDIT QD+FH  K W++EL E      V+A+AGNK DLS  REV++ D   YA+  G + +ETSAK + NV E+F  I++++P  + +   +    +L
Sbjct:   20 MCLCLSPSVGKSSIVSRFVQDHFDHNISPTIGASFMTKTVPSGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDTFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDTREVTMKDAREYAESIGAIVVETSAKNAINVEELFQGISRRIPPLDPHENGSNGAMKL 194          
BLAST of Ras-related protein Rab-5A vs. Ensembl Mouse
Match: Rab5c (RAB5C, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105306])

HSP 1 Score: 278.485 bits (711), Expect = 5.190e-93
Identity = 132/182 (72.53%), Postives = 153/182 (84.07%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNA 592
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+ D+F RAKNW++EL  +A+   VIALAGNK+DL+++R V   +   YA +N LLFMETSAKT+ NVNEIF+ IAKKLP++E   QNA
Sbjct:   11 NGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNE--PQNA 190          
BLAST of Ras-related protein Rab-5A vs. Ensembl Mouse
Match: Rab5a (RAB5A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105926])

HSP 1 Score: 277.715 bits (709), Expect = 1.135e-92
Identity = 131/184 (71.20%), Postives = 155/184 (84.24%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGS 598
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHE+QEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+++SF RAKNW++EL  +A+   VIAL+GNK+DL+ +R V   +  +YA +N LLFMETSAKTS NVNEIF+ IAKKLP++E   QN G+
Sbjct:   10 NGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNE--PQNPGA 191          
BLAST of Ras-related protein Rab-5A vs. Ensembl Mouse
Match: Rab5b (RAB5B, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105938])

HSP 1 Score: 269.24 bits (687), Expect = 2.376e-89
Identity = 127/174 (72.99%), Postives = 148/174 (85.06%), Query Frame = 2
Query:   74 VQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAG 595
             QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQ+V ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+Q++F RAK W++EL  +A+   VIALAGNK+DL+ +R V   +   YA +N LLFMETSAKT+ NVN++FL IAKKLP+ E   QN G
Sbjct:   19 CQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQAYADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSE--PQNLG 190          
BLAST of Ras-related protein Rab-5A vs. Ensembl Mouse
Match: Rab5c (RAB5C, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105306])

HSP 1 Score: 268.47 bits (685), Expect = 1.062e-88
Identity = 132/200 (66.00%), Postives = 153/200 (76.50%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSI------------------SDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNA 592
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+ D+F RAKNW++EL  +A+   VIALAGNK+DL+++R V                     +   YA +N LLFMETSAKT+ NVNEIF+ IAKKLP++E   QNA
Sbjct:   11 NGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQPCHLPCSPPTLFLTCLSQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNE--PQNA 208          
BLAST of Ras-related protein Rab-5A vs. Ensembl Mouse
Match: Rab31 (RAB31, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1914603])

HSP 1 Score: 187.193 bits (474), Expect = 1.509e-57
Identity = 85/163 (52.15%), Postives = 115/163 (70.55%), Query Frame = 2
Query:   77 QFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLP 565
            + K+ LLG++ VGKSS+V RFV+  F      T+GA+F+T+TV   +   KF IWDTAGQER+HSLAPMYYRG+ AA++VYDIT QDSFH  K W++EL E      V+A+AGNK DLS  REV + D   YA+  G + +ETSAK + N+ E+F  I++++P
Sbjct:    6 ELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIP 168          
BLAST of Ras-related protein Rab-5A vs. UniProt/SwissProt
Match: sp|Q98932|RAB5C_CHICK (Ras-related protein Rab-5C OS=Gallus gallus OX=9031 GN=RAB5C PE=1 SV=1)

HSP 1 Score: 283.878 bits (725), Expect = 3.636e-94
Identity = 133/186 (71.51%), Postives = 153/186 (82.26%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQ 604
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+ D+F RAKNW++EL  +A+   VIALAGNK+DL+ +R V   D  TYA +N LLFMETSAKT+ NVNEIF+ IAKKLP++E      G G+
Sbjct:   11 NGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFVRAKNWVKELQRQASPNIVIALAGNKADLATKRAVDFQDAQTYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNAPGGPGR 196          
BLAST of Ras-related protein Rab-5A vs. UniProt/SwissProt
Match: sp|Q58DS9|RAB5C_BOVIN (Ras-related protein Rab-5C OS=Bos taurus OX=9913 GN=RAB5C PE=2 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 2.017e-92
Identity = 132/182 (72.53%), Postives = 154/182 (84.62%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNA 592
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+ D+F RAKNW++EL  +A+   VIALAGNK+DL+++R V   +   YA++N LLFMETSAKT+ NVNEIF+ IAKKLP++E   QNA
Sbjct:   11 NGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYAEDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNE--PQNA 190          
BLAST of Ras-related protein Rab-5A vs. UniProt/SwissProt
Match: sp|P51147|RAB5C_CANLF (Ras-related protein Rab-5C OS=Canis lupus familiaris OX=9615 GN=RAB5C PE=2 SV=1)

HSP 1 Score: 278.87 bits (712), Expect = 2.952e-92
Identity = 132/182 (72.53%), Postives = 153/182 (84.07%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNA 592
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+ D+F RAKNW++EL  +A+   VIALAGNK+DL+++R V   +   YA +N LLFMETSAKT+ NVNEIF+ IAKKLP++E   QNA
Sbjct:   11 NGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNE--PQNA 190          
BLAST of Ras-related protein Rab-5A vs. UniProt/SwissProt
Match: sp|P35278|RAB5C_MOUSE (Ras-related protein Rab-5C OS=Mus musculus OX=10090 GN=Rab5c PE=1 SV=2)

HSP 1 Score: 278.485 bits (711), Expect = 3.631e-92
Identity = 132/182 (72.53%), Postives = 153/182 (84.07%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNA 592
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+ D+F RAKNW++EL  +A+   VIALAGNK+DL+++R V   +   YA +N LLFMETSAKT+ NVNEIF+ IAKKLP++E   QNA
Sbjct:   11 NGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNE--PQNA 190          
BLAST of Ras-related protein Rab-5A vs. UniProt/SwissProt
Match: sp|Q5R7L7|RAB5C_PONAB (Ras-related protein Rab-5C OS=Pongo abelii OX=9601 GN=RAB5C PE=2 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 4.137e-92
Identity = 130/186 (69.89%), Postives = 152/186 (81.72%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQ 604
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+ D+F RAKNW++EL  +A+   VIALAGNK+DL+++R V   +   YA +N LLFMETSAKT+ NVNEIF+ IAKKLP++E        G+
Sbjct:   11 NGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGR 196          
BLAST of Ras-related protein Rab-5A vs. TrEMBL
Match: A0A0L0CCQ3 (Uncharacterized protein OS=Lucilia cuprina OX=7375 GN=FF38_05511 PE=4 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 5.763e-94
Identity = 138/186 (74.19%), Postives = 158/186 (84.95%), Query Frame = 2
Query:   56 TMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE-VNTQNAGSGQRL 610
            T QN+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQT+ +EDT VKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDI +QDSF RAK W++EL ++A+   VIALAGNK+DLS  R V   +   YA+ENGLLFMETSAKT  NVN+IFL IAKKLP+++  N Q AG+G+RL
Sbjct:   21 TSQNKSCQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTICIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADLSNIRVVEYEEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQGAGAGRRL 206          
BLAST of Ras-related protein Rab-5A vs. TrEMBL
Match: A0A069DQS6 (Putative rab subfamily protein of small gtpase OS=Panstrongylus megistus OX=65343 PE=2 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 9.829e-94
Identity = 137/186 (73.66%), Postives = 160/186 (86.02%), Query Frame = 2
Query:   56 TMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQN-AGSGQRL 610
            T Q +  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+QD+F RAK W++EL  +A+   VIALAGNK+DL+ +R V + +   YA+ENGLLFMETSAKT+ NVN+IFL IAKKLP+ + NT N +G G+RL
Sbjct:   13 TAQAKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDTFGRAKTWVKELQRQASPNIVIALAGNKADLANKRSVELEEAQAYAEENGLLFMETSAKTAMNVNDIFLAIAKKLPKSDQNTGNTSGQGRRL 198          
BLAST of Ras-related protein Rab-5A vs. TrEMBL
Match: A0A224XXU2 (Putative rab subfamily protein of small gtpase OS=Panstrongylus lignarius OX=156445 PE=4 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 9.829e-94
Identity = 137/186 (73.66%), Postives = 160/186 (86.02%), Query Frame = 2
Query:   56 TMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQN-AGSGQRL 610
            T Q +  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+QD+F RAK W++EL  +A+   VIALAGNK+DL+ +R V + +   YA+ENGLLFMETSAKT+ NVN+IFL IAKKLP+ + NT N +G G+RL
Sbjct:   13 TAQAKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDTFGRAKTWVKELQRQASPNIVIALAGNKADLANKRSVELEEAQAYAEENGLLFMETSAKTAMNVNDIFLAIAKKLPKSDQNTGNTSGQGRRL 198          
BLAST of Ras-related protein Rab-5A vs. TrEMBL
Match: A0A0P4VM87 (Putative ras-related protein rab-5b OS=Rhodnius neglectus OX=72488 PE=2 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 9.829e-94
Identity = 137/186 (73.66%), Postives = 160/186 (86.02%), Query Frame = 2
Query:   56 TMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQN-AGSGQRL 610
            T Q +  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+QD+F RAK W++EL  +A+   VIALAGNK+DL+ +R V + +   YA+ENGLLFMETSAKT+ NVN+IFL IAKKLP+ + NT N +G G+RL
Sbjct:   13 TAQAKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDTFGRAKTWVKELQRQASPNIVIALAGNKADLANKRSVELEEAQAYAEENGLLFMETSAKTAMNVNDIFLAIAKKLPKSDQNTGNTSGQGRRL 198          
BLAST of Ras-related protein Rab-5A vs. TrEMBL
Match: A0A0V0G6J0 (Putative rab subfamily protein of small gtpase OS=Triatoma dimidiata OX=72491 PE=4 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 9.829e-94
Identity = 137/186 (73.66%), Postives = 160/186 (86.02%), Query Frame = 2
Query:   56 TMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQN-AGSGQRL 610
            T Q +  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+QD+F RAK W++EL  +A+   VIALAGNK+DL+ +R V + +   YA+ENGLLFMETSAKT+ NVN+IFL IAKKLP+ + NT N +G G+RL
Sbjct:   13 TAQAKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDTFGRAKTWVKELQRQASPNIVIALAGNKADLANKRSVELEEAQAYAEENGLLFMETSAKTAMNVNDIFLAIAKKLPKSDQNTGNTSGQGRRL 198          
BLAST of Ras-related protein Rab-5A vs. Ensembl Cavefish
Match: rab5ab (ras-related protein Rab-5A [Source:NCBI gene;Acc:103038585])

HSP 1 Score: 280.026 bits (715), Expect = 1.059e-93
Identity = 131/187 (70.05%), Postives = 154/187 (82.35%), Query Frame = 2
Query:   44 NNSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQ 604
            N      N+  QFKLVLLGESAVGKSSLV+RFVKGQFHE+QEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+++SF RAKNW++EL  +A+   VIALAGNK+DL+ +R +   D  +YA +N LLFMETSAKTS NVNEIF+ IAKKLP+ E     A +G+
Sbjct:   11 NGPNAASNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKADLANKRALDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKSEPQPAGASTGR 197          
BLAST of Ras-related protein Rab-5A vs. Ensembl Cavefish
Match: rab5aa (ras-related protein Rab-5A [Source:NCBI gene;Acc:103027170])

HSP 1 Score: 278.1 bits (710), Expect = 6.368e-93
Identity = 130/186 (69.89%), Postives = 153/186 (82.26%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQ 604
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHE+QEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+++SF RAKNW++EL  +A+   VIAL+GNK+DL+ +R V   D  +YA +N LLFMETSAKTS NVNEIF+ IAK+LP+ E       SG+
Sbjct:   11 NGPNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKRLPKSEPQAAGTNSGR 196          
BLAST of Ras-related protein Rab-5A vs. Ensembl Cavefish
Match: rab5c (RAB5C, member RAS oncogene family [Source:NCBI gene;Acc:103045387])

HSP 1 Score: 276.944 bits (707), Expect = 2.121e-92
Identity = 129/177 (72.88%), Postives = 150/177 (84.75%), Query Frame = 2
Query:   44 NNSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
            N +    N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+ D+F RAKNW++EL  +A+   VIALAGNK+DL+ +R V   +   YA +N LLFMETSAKT+ NVNEIF+ IAKKLP++E
Sbjct:   11 NGATAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFTRAKNWVKELQRQASPNIVIALAGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNE 187          
BLAST of Ras-related protein Rab-5A vs. Ensembl Cavefish
Match: ENSAMXT00000046211.1 (ras-related protein Rab-5C [Source:NCBI gene;Acc:103035226])

HSP 1 Score: 274.633 bits (701), Expect = 1.452e-91
Identity = 127/176 (72.16%), Postives = 149/176 (84.66%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAI+VYDIT+ D+F RAKNW++EL  +A+   VIAL+GNK+DL+ +R V   +   YA +N LLFMETSAKT+ NVNEIF+ IAKKLP++E
Sbjct:    6 NGPAAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIIVYDITNTDTFTRAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNE 181          
BLAST of Ras-related protein Rab-5A vs. Ensembl Cavefish
Match: rab5b (ras-related protein Rab-5B-like [Source:NCBI gene;Acc:103034209])

HSP 1 Score: 259.225 bits (661), Expect = 1.478e-85
Identity = 125/188 (66.49%), Postives = 152/188 (80.85%), Query Frame = 2
Query:   44 NNSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQR 607
            N SL  Q +  QFKLVLLG+ AVGKSSLV+RFVKGQF E+QE+T+GAAFL Q+V ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVV+DIT  ++F RAK W++EL  +A+   VIALAGNK+DL+ +R V   +  TYA++ GLLFMETSAKT+ NVNE+FL IAKK+P+   +TQNA    R
Sbjct:   10 NGSLP-QTKICQFKLVLLGDMAVGKSSLVLRFVKGQFDEFQETTIGAAFLAQSVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVFDITKPETFERAKAWVKELQRQASPNIVIALAGNKADLADKRLVEYEEAQTYAEDTGLLFMETSAKTAMNVNELFLAIAKKMPK--TDTQNATHAAR 194          
BLAST of Ras-related protein Rab-5A vs. Ensembl Sea Lamprey
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 282.337 bits (721), Expect = 2.238e-95
Identity = 134/183 (73.22%), Postives = 154/183 (84.15%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAG 595
            N  T  N+  QFKLVLLGESAVGKSSLV+RFVKGQFHE+QEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+ DSF RAK W++EL  +A    VIAL+GNK+DL++QR V   +   YA+ENGLLFMETSAKT+ NVNE+FL IAKKLP++E   QN G
Sbjct:   11 NCQTATNKMCQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVSLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNLDSFARAKTWVKELQRQANPTIVIALSGNKADLASQRMVEFEEAQGYAEENGLLFMETSAKTAMNVNEVFLAIAKKLPKNE--QQNPG 191          
BLAST of Ras-related protein Rab-5A vs. Ensembl Sea Lamprey
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 281.952 bits (720), Expect = 2.933e-95
Identity = 130/178 (73.03%), Postives = 154/178 (86.52%), Query Frame = 2
Query:   65 NRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGS 598
            N+  QFKLVLLGESAVGKSSLV+RFVKGQFHE+QEST+GAAFLTQTV +EDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+QDSF RAKNW++EL  +A    VIALAGNK+DL+ QR V   +   Y+++NGLLFMETSAKT+ NVN++FL IAKKLP+++ + Q+  +
Sbjct:   17 NKMCQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDSFARAKNWVKELQRQANPNIVIALAGNKTDLANQRTVDFEEAQGYSEDNGLLFMETSAKTAMNVNDVFLAIAKKLPKNDQSMQSGNA 194          
BLAST of Ras-related protein Rab-5A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000009.1 (pep scaffold:Pmarinus_7.0:GL476426:408368:444599:1 gene:ENSPMAG00000000008.1 transcript:ENSPMAT00000000009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 280.026 bits (715), Expect = 2.619e-94
Identity = 131/176 (74.43%), Postives = 153/176 (86.93%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
             +L   ++ +QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV +EDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+QD+F RAK W++EL  +A+   VIALAGNK+DL+++R V   +  +YA +NGLLFMETSAKT+ NVN+IFL IAKKLPR E
Sbjct:   16 GALASTSKILQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDTFSRAKTWVKELQRQASPNIVIALAGNKADLASKRIVEFEEAQSYADDNGLLFMETSAKTAMNVNDIFLAIAKKLPRSE 191          
BLAST of Ras-related protein Rab-5A vs. Ensembl Sea Lamprey
Match: RAB31 (RAB31, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9771])

HSP 1 Score: 175.252 bits (443), Expect = 8.884e-54
Identity = 78/163 (47.85%), Postives = 114/163 (69.94%), Query Frame = 2
Query:   77 QFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLP 565
            + K+ LLG++ VGKSS+V RFV+  F      T+GA+F+T+T+   +   K+ IWDTAGQER+ SLAPMYYRG+ AA++VYDIT ++SF   K+W++EL +      ++A+AGNK DL   REVS+ D   YA     +F+ETSAK++ N+ EIF  I++++P
Sbjct:    5 ELKVCLLGDTGVGKSSIVCRFVQDNFDPNINPTIGASFMTKTMPQGNEVHKYLIWDTAGQERFRSLAPMYYRGSAAAVIVYDITKEESFQMLKSWVRELRQHGPQDIIVAIAGNKCDLDDMREVSVQDARDYADSIDAIFIETSAKSAINICEIFARISERVP 167          
BLAST of Ras-related protein Rab-5A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001552.1 (pep scaffold:Pmarinus_7.0:GL476520:43153:47504:1 gene:ENSPMAG00000001403.1 transcript:ENSPMAT00000001552.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.777 bits (421), Expect = 1.893e-50
Identity = 78/163 (47.85%), Postives = 118/163 (72.39%), Query Frame = 2
Query:   74 VQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKL 562
            ++ KLVL+GES VGK+SL+ R  + QF   + +TVG AF +  V +E+  V+ EIWDTAGQER+  L P+++R A+AA++ YDI+SQ+SF++ + WI EL EK+    V+ALAG+K DL   R+V   +G+ +A+E+G++FMETSA+ + NV E+F  IA++ 
Sbjct:   11 LRVKLVLIGESNVGKTSLLRRLARNQFIPNEVATVGVAFQSYVVHLEEAPVRLEIWDTAGQERHRMLTPIFFRNAEAAVLTYDISSQESFNKLQFWISELKEKSHPNVVMALAGSKCDLEVSRQVQHEEGARFAREHGMIFMETSAQAAMNVVELFHAIAERF 173          
BLAST of Ras-related protein Rab-5A vs. Ensembl Yeast
Match: VPS21 (Endosomal Rab family GTPase; required for endocytic transport and sorting of vacuolar hydrolases; required for endosomal localization of the CORVET complex; required with YPT52 for MVB biogenesis and sorting; involved in autophagy and ionic stress tolerance; geranylgeranylation required for membrane association; protein abundance increases in response to DNA replication stress; mammalian Rab5 homolog; VPS21 has a paralog, YPT53, that arose from the whole genome duplication [Source:SGD;Acc:S000005615])

HSP 1 Score: 212.231 bits (539), Expect = 3.724e-68
Identity = 103/186 (55.38%), Postives = 133/186 (71.51%), Query Frame = 2
Query:   59 MQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDL---SAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQR 607
            M       KLVLLGE+AVGKSS+V+RFV   F E +E T+GAAFLTQ V + + TVKFEIWDTAGQER+ SLAPMYYR AQAA+VVYD+T   SF +A++W++EL E+A+   +IAL GNK D+     +R+V+  +G   A+E GLLF ETSAKT  NVN++FL I +K+P      QN+ S +R
Sbjct:    1 MNTSVTSIKLVLLGEAAVGKSSIVLRFVSNDFAENKEPTIGAAFLTQRVTINEHTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDMLQEGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGIGEKIPLKTAEEQNSASNER 186          
BLAST of Ras-related protein Rab-5A vs. Ensembl Yeast
Match: YPT52 (Endosomal Rab family GTPase; required for vacuolar protein sorting, endocytosis and multivesicular body (MVB) biogenesis and sorting; required for localization of the CORVET complex to endosomes; involved in autophagy and ionic stress tolerance; similar to Vps21p and Ypt53p; mammalian Rab5 homolog; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001722])

HSP 1 Score: 188.348 bits (477), Expect = 1.796e-58
Identity = 99/192 (51.56%), Postives = 121/192 (63.02%), Query Frame = 2
Query:   74 VQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVV--------EDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVK-VIALAGNKSDLSAQ--------------------REVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKL 562
            +QFKLVLLG+S+VGKSS+V RFVK  F E +EST+GAAFL+Q++ +        +D  +KFEIWDTAGQERY SLAPMYYR A AA+VVYDIT +DS  +A+NW+ EL  K      VI L GNK DL  +                    R +S  +   YAQE GLLF E SAKT   V EIF +I +KL
Sbjct:    2 LQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVKEIFQDIGEKL 193          
BLAST of Ras-related protein Rab-5A vs. Ensembl Yeast
Match: YPT53 (Stress-induced Rab family GTPase; required for vacuolar protein sorting and endocytosis; involved in ionic stress tolerance; similar to Vps21p and Ypt52p; functional homolog of Vps21p; mammalian Rab5 homolog; YPT53 has a paralog, VPS21, that arose from the whole genome duplication [Source:SGD;Acc:S000005037])

HSP 1 Score: 181.415 bits (459), Expect = 5.976e-56
Identity = 89/182 (48.90%), Postives = 121/182 (66.48%), Query Frame = 2
Query:   80 FKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDL------SAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQR 607
             K+VLLGESAVGKSS+V+RFV   F E +E T+GAAFLT+ +  +   +KFEIWDTAGQER+  LAPMYYR AQAA+VV+D+T++ SF++A+NW++EL EK     VIAL GNK DL      +  R +         +   LL+ E SAKT  N+ +IF  + +K+P  E NT+ + +  R
Sbjct:   13 IKVVLLGESAVGKSSIVLRFVSDDFKESKEPTIGAAFLTKRITRDGKVIKFEIWDTAGQERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVGHDIVIALVGNKMDLLNNDDENENRAMKAPAVQNLCERENLLYFEASAKTGENIYQIFQTLGEKVPCPEQNTRQSSTHDR 194          
BLAST of Ras-related protein Rab-5A vs. Ensembl Yeast
Match: YPT31 (Rab family GTPase; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; YPT31 has a paralog, YPT32, that arose from the whole genome duplication; localizes to the transitional and late Golgi [Source:SGD;Acc:S000000833])

HSP 1 Score: 158.688 bits (400), Expect = 3.180e-47
Identity = 77/171 (45.03%), Postives = 112/171 (65.50%), Query Frame = 2
Query:   80 FKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLE----IAKKLPRHEVN 580
            FK+VL+G+S VGKS+L+ RF K +F+   +ST+G  F T+T+ ++   +K +IWDTAGQERY ++   YYRGA  A++VYDI+   S+    +W+ EL E A     + L GNKSDL+  R V   +  T+AQEN LLF ETSA  S NV++ F E    I +K+ +H+++
Sbjct:   14 FKIVLIGDSGVGKSNLLSRFTKNEFNMDSKSTIGVEFATRTLEIDGKRIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLSELRENADDNVAVGLIGNKSDLAHLRAVPTEESKTFAQENQLLFTETSALNSENVDKAFEELINTIYQKVSKHQMD 184          
BLAST of Ras-related protein Rab-5A vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 155.606 bits (392), Expect = 4.457e-46
Identity = 76/177 (42.94%), Postives = 112/177 (63.28%), Query Frame = 2
Query:   80 FKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLE----IAKKLPRHEVNTQNAGS 598
            FK+VL+G+S VGKS+L+ RF   +F+   +ST+G  F T+T+ VE+  +K +IWDTAGQERY ++   YYRGA  A++VYDI+   S+    +W+ EL E A     + L GNKSDL+  R V   +   +A EN +LF ETSA  S NV++ F E    I + + +H+V+   +G+
Sbjct:   14 FKIVLIGDSGVGKSNLLSRFTTDEFNIESKSTIGVEFATRTIEVENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHLRAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGT 190          
BLAST of Ras-related protein Rab-5A vs. Ensembl Nematostella
Match: EDO49482 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG79])

HSP 1 Score: 278.1 bits (710), Expect = 2.620e-93
Identity = 133/187 (71.12%), Postives = 156/187 (83.42%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQR 607
            N  TM  +  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+QD+F RAK W++EL  +A+   VIAL+GNK+DL+++R V   D  +YA++NGLLFMETSAKT+ NVN+IFL IAKKLP+ +       S QR
Sbjct:   12 NGATM-GKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDTFARAKTWVKELQRQASPNIVIALSGNKADLASKRMVEYEDAQSYAEDNGLLFMETSAKTAMNVNDIFLAIAKKLPKSDNTPGGQQSSQR 197          
BLAST of Ras-related protein Rab-5A vs. Ensembl Nematostella
Match: EDO40557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S718])

HSP 1 Score: 174.866 bits (442), Expect = 3.642e-53
Identity = 85/166 (51.20%), Postives = 111/166 (66.87%), Query Frame = 2
Query:   77 QFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
            + K+ LLG++ VGKS LV RFV   F+     T+GAAF+T+ ++V D   KF IWDTAGQER+ SLAP+YYR A AAI+VYDIT + +FH  + WI+EL        VIA+AGNK D + QR+V + D   +A     +F ETSA TS NV+ +F E+ KKLP HE
Sbjct:   12 ELKVCLLGDAGVGKSCLVHRFVSDIFNASSPPTIGAAFMTKMMIVNDKAYKFNIWDTAGQERFKSLAPLYYRDAAAAILVYDITIESTFHSLRPWIRELQRYGPQDIVIAVAGNKCDKADQRDVQVQDAQDFAGSVDAIFAETSALTSKNVHWLFEELCKKLP-HE 176          
BLAST of Ras-related protein Rab-5A vs. Ensembl Nematostella
Match: EDO34991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMT0])

HSP 1 Score: 163.31 bits (412), Expect = 1.432e-48
Identity = 74/165 (44.85%), Postives = 108/165 (65.45%), Query Frame = 2
Query:   68 RQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKL 562
            RQ QFK+VLLGE  VGK+SL++R+V+ +F++   +T+ A+FL + + +    V   IWDTAGQER+H+L P+YYR +  AI+VYDIT +DSF + KNW++EL +       + +AGNK DL   R V  SD   YA+  G     TSAK +  + E+F E+ K++
Sbjct:    6 RQNQFKVVLLGEGCVGKTSLMLRYVQDKFNDKHLTTLQASFLNKRLNINGQRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFLKVKNWVRELKKMLGDDICLCIAGNKIDLEKDRHVEASDAEAYAKTVGAKHFHTSAKLNKGIEEMFFELTKRM 170          
BLAST of Ras-related protein Rab-5A vs. Ensembl Nematostella
Match: EDO36687 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHU3])

HSP 1 Score: 158.688 bits (400), Expect = 7.866e-47
Identity = 69/161 (42.86%), Postives = 111/161 (68.94%), Query Frame = 2
Query:   80 FKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKL 562
            FK +++G++ VGKS L+++F   +F    + T+G  F  + + ++   +K +IWDTAGQE + S+   YYRGA  A++VYDIT +D+F+    W+++  + ++S  VI L GNKSDL A+R+V   +G  +A+E+GL+FMETSAKT++NV E F+  AK++
Sbjct:    7 FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIGVEFGARMITIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTTWLEDARQHSSSNMVIMLIGNKSDLEARRDVKKEEGEAFAREHGLIFMETSAKTAANVEEAFINTAKEI 167          
BLAST of Ras-related protein Rab-5A vs. Ensembl Nematostella
Match: EDO29880 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2D5])

HSP 1 Score: 158.303 bits (399), Expect = 7.924e-47
Identity = 75/164 (45.73%), Postives = 114/164 (69.51%), Query Frame = 2
Query:   77 QFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQEL-TEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLP 565
            +FKLV LGE +VGK+SL+ RF+   F    ++T+G  FL++T+ +ED TV+ ++WDTAGQER+ SL P Y R +  A+VVYDIT+ +SF +   WI ++ TE+   V +I L GNK+DLS +R+V+  +G   A+E  ++F+ETSAK   NV +++  +A +LP
Sbjct:   11 KFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDITNYNSFQQTSKWIDDVRTERGNDV-IIMLVGNKTDLSDKRQVTAEEGERKAKELNVMFIETSAKAGYNVKQMYRNLALELP 173          
BLAST of Ras-related protein Rab-5A vs. Ensembl Medaka
Match: rab5aa (ras-related protein Rab-5A [Source:NCBI gene;Acc:101159835])

HSP 1 Score: 280.796 bits (717), Expect = 5.650e-94
Identity = 132/186 (70.97%), Postives = 154/186 (82.80%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQ 604
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHE+QEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+++SF RAKNW++EL  +A+   VIALAGNK+DL+ +R V   D  +YA +N LLFMETSAKTS NVNEIF+ IAK+LP+ E     A SG+
Sbjct:   11 NGPNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALAGNKADLANKRAVEFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKRLPKSEPQAPGATSGR 196          
BLAST of Ras-related protein Rab-5A vs. Ensembl Medaka
Match: rab5ab (ras-related protein Rab-5A-like [Source:NCBI gene;Acc:101157247])

HSP 1 Score: 277.715 bits (709), Expect = 9.261e-93
Identity = 133/187 (71.12%), Postives = 155/187 (82.89%), Query Frame = 2
Query:   47 NSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQR 607
            N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHE+QEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIT+++SF RAKNW++EL  +A+   VIALAGNK+DL+ +R +   D  +YA +N LLFMETSAKTS NVNEIF+ IAKKLP++E     A SG R
Sbjct:   11 NGPNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFVRAKNWVKELQRQASPNIVIALAGNKADLANKRALDFQDAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPAAAGA-SGAR 196          
BLAST of Ras-related protein Rab-5A vs. Ensembl Medaka
Match: rab5c (RAB5C, member RAS oncogene family [Source:NCBI gene;Acc:101162840])

HSP 1 Score: 276.944 bits (707), Expect = 2.291e-92
Identity = 129/180 (71.67%), Postives = 150/180 (83.33%), Query Frame = 2
Query:   35 PLINNSLTMQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
            P   N     N+  QFKLVLLGESAVGKSSLV+RFVKGQFHEYQEST+GAAFLTQTV ++DTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVV+DIT+ D+F RAKNW++EL  +A+   VIALAGNK+DL+ +R V   +   YA +N LLFMETSAKT+ NVNEIF+ IAKKLP++E
Sbjct:    7 PARTNGTAASNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVFDITNTDTFTRAKNWVKELQRQASPNIVIALAGNKADLTNKRNVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNE 186          
BLAST of Ras-related protein Rab-5A vs. Ensembl Medaka
Match: rab22a (RAB22A, member RAS oncogene family [Source:NCBI gene;Acc:101174498])

HSP 1 Score: 184.882 bits (468), Expect = 9.697e-57
Identity = 84/163 (51.53%), Postives = 117/163 (71.78%), Query Frame = 2
Query:   77 QFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLP 565
            + K+ LLG++ VGK+S+V RFV+  F      T+GA+F+T+TV  ++   KF IWDTAGQER+ +LAPMYYRG+ AA++VYDIT +DSF   KNW++EL +      V+A+AGNK DLS  REVS  D   YA+    +F+ETSAK + N+NE+F EI+K++P
Sbjct:    5 ELKVCLLGDTGVGKTSIVWRFVEDSFDPNINPTIGASFMTKTVQYQNELHKFLIWDTAGQERFRALAPMYYRGSAAAVIVYDITKEDSFQTLKNWVKELRQHGPPNIVVAIAGNKCDLSDAREVSEKDAKDYAESIHAIFVETSAKNAININEVFTEISKRIP 167          
BLAST of Ras-related protein Rab-5A vs. Ensembl Medaka
Match: RAB31 (RAB31, member RAS oncogene family [Source:NCBI gene;Acc:101173252])

HSP 1 Score: 179.489 bits (454), Expect = 1.015e-54
Identity = 83/166 (50.00%), Postives = 115/166 (69.28%), Query Frame = 2
Query:   77 QFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHE 574
            + K+ LLG++ VGKSS+V RFV+  F      T+GA+FLT+TV   +   KF IWDTAGQER+HSLAPMYYRG+ AA++VYDIT  DSF   K W++EL E      V+A+AGNK+DL   REV + +   +A+    +F+ETSA+ + NV E+F +I+K++P  E
Sbjct:    6 ELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFLTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKLDSFQTLKKWVKELKEHGPEDIVVAIAGNKNDLGDIREVPMKEAKEFAESIAAIFIETSARNAVNVEELFQKISKQIPPLE 171          
BLAST of Ras-related protein Rab-5A vs. Planmine SMEST
Match: SMESG000064914.1 (SMESG000064914.1)

HSP 1 Score: 339.347 bits (869), Expect = 9.436e-118
Identity = 166/174 (95.40%), Postives = 168/174 (96.55%), Query Frame = 2
Query:   59 MQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVN 580
            MQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEI + L  +  N
Sbjct:    1 MQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIGEILMNNLAN 174          
BLAST of Ras-related protein Rab-5A vs. Planmine SMEST
Match: SMESG000065500.1 (SMESG000065500.1)

HSP 1 Score: 234.187 bits (596), Expect = 4.534e-76
Identity = 113/169 (66.86%), Postives = 136/169 (80.47%), Query Frame = 2
Query:   59 MQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLP 565
            M +R    KLVLLGE+ VGKSSLV+RFV+GQF+E  ESTVGAAF+TQTV+    T+KFEIWDTAGQERY SLAPMYYRGA+AAIV+YDIT+ DSF  AK+WI+EL  KA SV+VI L GNK DL   R+VS  +G  +A++NGL+FME S K S NVNE+F+EIAK+LP
Sbjct:    1 MNSRLGSHKLVLLGETFVGKSSLVLRFVRGQFNEILESTVGAAFMTQTVMTMGKTIKFEIWDTAGQERYRSLAPMYYRGARAAIVMYDITNSDSFENAKSWIEELKIKAPSVEVIVLVGNKIDLQDSRKVSSVEGEQHAKDNGLMFMEISVKDSVNVNEVFIEIAKQLP 169          
BLAST of Ras-related protein Rab-5A vs. Planmine SMEST
Match: SMESG000057525.1 (SMESG000057525.1)

HSP 1 Score: 224.557 bits (571), Expect = 2.333e-72
Identity = 105/175 (60.00%), Postives = 137/175 (78.29%), Query Frame = 2
Query:   74 VQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGS 598
            +QFK+VLLGE++VGKSSL +RFVK  F+E QE T+GAAFL++ V++ED  +K EIWDTAGQERY SLAPMYYRGA  A+V+YDIT+ +SFHRAK WIQEL E+A +V VIAL GNK DLS  REV+ ++   YA+E  L+FMETS+KT+ NV E+F E++ +L +  +N   + S
Sbjct:    4 LQFKVVLLGETSVGKSSLSLRFVKDYFNEVQEITIGAAFLSKIVIIEDVKIKLEIWDTAGQERYRSLAPMYYRGAHGALVMYDITNLESFHRAKLWIQELKERAATVAVIALVGNKIDLSHGREVNETEAKLYAEEQNLIFMETSSKTNLNVQEVFTELSCELSKLNLNNNPSDS 178          
BLAST of Ras-related protein Rab-5A vs. Planmine SMEST
Match: SMESG000057525.1 (SMESG000057525.1)

HSP 1 Score: 224.557 bits (571), Expect = 2.410e-72
Identity = 105/175 (60.00%), Postives = 137/175 (78.29%), Query Frame = 2
Query:   74 VQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEVNTQNAGS 598
            +QFK+VLLGE++VGKSSL +RFVK  F+E QE T+GAAFL++ V++ED  +K EIWDTAGQERY SLAPMYYRGA  A+V+YDIT+ +SFHRAK WIQEL E+A +V VIAL GNK DLS  REV+ ++   YA+E  L+FMETS+KT+ NV E+F E++ +L +  +N   + S
Sbjct:    5 LQFKVVLLGETSVGKSSLSLRFVKDYFNEVQEITIGAAFLSKIVIIEDVKIKLEIWDTAGQERYRSLAPMYYRGAHGALVMYDITNLESFHRAKLWIQELKERAATVAVIALVGNKIDLSHGREVNETEAKLYAEEQNLIFMETSSKTNLNVQEVFTELSCELSKLNLNNNPSDS 179          
BLAST of Ras-related protein Rab-5A vs. Planmine SMEST
Match: SMESG000078456.1 (SMESG000078456.1)

HSP 1 Score: 212.616 bits (540), Expect = 1.166e-67
Identity = 99/173 (57.23%), Postives = 126/173 (72.83%), Query Frame = 2
Query:   59 MQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVVVEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKNWIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETSAKTSSNVNEIFLEIAKKLPRHEV 577
            M N QV  K+VLLG+SAVGK+S+ +  VK QF+E QE+TVGA +L +TV V++   KF+IWDTAGQERY SL PMYYRGA AAI+VYDIT++ SF RA NWI EL E  ++VK I L GNK DLS  R +  +    +A EN LLF+ETSAK S N+ EIF+ +A+K P+  +
Sbjct:    1 MSNSQVIIKVVLLGDSAVGKTSIALNIVKDQFNENQEATVGALYLNKTVEVDNMCFKFDIWDTAGQERYKSLTPMYYRGAHAAIIVYDITNRSSFTRANNWIAELNEITSTVKTIILVGNKCDLSEHRVIDSNTAQKFADENNLLFIETSAKLSINIKEIFILLARKYPKSAI 173          
The following BLAST results are available for this feature:
BLAST of Ras-related protein Rab-5A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB5C8.615e-9369.89RAB5C, member RAS oncogene family [Source:HGNC Sym... [more]
RAB5C8.615e-9369.89RAB5C, member RAS oncogene family [Source:HGNC Sym... [more]
RAB5A2.055e-9271.20RAB5A, member RAS oncogene family [Source:HGNC Sym... [more]
RAB5C3.556e-9269.89RAB5C, member RAS oncogene family [Source:HGNC Sym... [more]
RAB5B3.461e-8972.99RAB5B, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-51.504e-9074.25RAB family [Source:UniProtKB/TrEMBL;Acc:P91857][more]
rab-6.22.415e-4947.56Ras-related protein Rab-6.2 [Source:UniProtKB/Swi... [more]
rab-6.11.741e-4844.17Ras-related protein Rab-6.1 [Source:UniProtKB/Swi... [more]
rab-214.482e-4844.05RAB family [Source:UniProtKB/TrEMBL;Acc:Q22045][more]
unc-1081.440e-4744.17pep chromosome:WBcel235:I:3824947:3826514:1 gene:W... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab51.135e-9375.72gene:FBgn0014010 transcript:FBtr0330670[more]
Rab51.135e-9375.72gene:FBgn0014010 transcript:FBtr0077796[more]
Rab51.135e-9375.72gene:FBgn0014010 transcript:FBtr0077793[more]
Rab51.135e-9375.72gene:FBgn0014010 transcript:FBtr0077797[more]
Rab51.135e-9375.72gene:FBgn0014010 transcript:FBtr0077795[more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab5aa1.437e-9372.22RAB5A, member RAS oncogene family, a [Source:ZFIN;... [more]
rab5aa1.437e-9372.22RAB5A, member RAS oncogene family, a [Source:ZFIN;... [more]
rab5c1.041e-9172.32RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab5c1.041e-9172.32RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab5ab1.141e-9170.65RAB5A, member RAS oncogene family, b [Source:ZFIN;... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab5a3.225e-9172.73RAB5A, member RAS oncogene family [Source:NCBI gen... [more]
rab5b2.701e-8866.67RAB5B, member RAS oncogene family [Source:NCBI gen... [more]
rab5d3.120e-8368.42RAB5D, member RAS oncogene family [Source:NCBI gen... [more]
ncapd27.813e-5748.31non-SMC condensin I complex subunit D2 [Source:Xen... [more]
ncapd21.463e-5347.43non-SMC condensin I complex subunit D2 [Source:Xen... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab5c5.190e-9372.53RAB5C, member RAS oncogene family [Source:MGI Symb... [more]
Rab5a1.135e-9271.20RAB5A, member RAS oncogene family [Source:MGI Symb... [more]
Rab5b2.376e-8972.99RAB5B, member RAS oncogene family [Source:MGI Symb... [more]
Rab5c1.062e-8866.00RAB5C, member RAS oncogene family [Source:MGI Symb... [more]
Rab311.509e-5752.15RAB31, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q98932|RAB5C_CHICK3.636e-9471.51Ras-related protein Rab-5C OS=Gallus gallus OX=903... [more]
sp|Q58DS9|RAB5C_BOVIN2.017e-9272.53Ras-related protein Rab-5C OS=Bos taurus OX=9913 G... [more]
sp|P51147|RAB5C_CANLF2.952e-9272.53Ras-related protein Rab-5C OS=Canis lupus familiar... [more]
sp|P35278|RAB5C_MOUSE3.631e-9272.53Ras-related protein Rab-5C OS=Mus musculus OX=1009... [more]
sp|Q5R7L7|RAB5C_PONAB4.137e-9269.89Ras-related protein Rab-5C OS=Pongo abelii OX=9601... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L0CCQ35.763e-9474.19Uncharacterized protein OS=Lucilia cuprina OX=7375... [more]
A0A069DQS69.829e-9473.66Putative rab subfamily protein of small gtpase OS=... [more]
A0A224XXU29.829e-9473.66Putative rab subfamily protein of small gtpase OS=... [more]
A0A0P4VM879.829e-9473.66Putative ras-related protein rab-5b OS=Rhodnius ne... [more]
A0A0V0G6J09.829e-9473.66Putative rab subfamily protein of small gtpase OS=... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab5ab1.059e-9370.05ras-related protein Rab-5A [Source:NCBI gene;Acc:1... [more]
rab5aa6.368e-9369.89ras-related protein Rab-5A [Source:NCBI gene;Acc:1... [more]
rab5c2.121e-9272.88RAB5C, member RAS oncogene family [Source:NCBI gen... [more]
ENSAMXT00000046211.11.452e-9172.16ras-related protein Rab-5C [Source:NCBI gene;Acc:1... [more]
rab5b1.478e-8566.49ras-related protein Rab-5B-like [Source:NCBI gene;... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab5c2.238e-9573.22RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab5c2.933e-9573.03RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
ENSPMAT00000000009.12.619e-9474.43pep scaffold:Pmarinus_7.0:GL476426:408368:444599:1... [more]
RAB318.884e-5447.85RAB31, member RAS oncogene family [Source:HGNC Sym... [more]
ENSPMAT00000001552.11.893e-5047.85pep scaffold:Pmarinus_7.0:GL476520:43153:47504:1 g... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
VPS213.724e-6855.38Endosomal Rab family GTPase; required for endocyti... [more]
YPT521.796e-5851.56Endosomal Rab family GTPase; required for vacuolar... [more]
YPT535.976e-5648.90Stress-induced Rab family GTPase; required for vac... [more]
YPT313.180e-4745.03Rab family GTPase; involved in the exocytic pathwa... [more]
YPT324.457e-4642.94Rab family GTPase involved in the exocytic pathway... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494822.620e-9371.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405573.642e-5351.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO349911.432e-4844.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366877.866e-4742.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO298807.924e-4745.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab5aa5.650e-9470.97ras-related protein Rab-5A [Source:NCBI gene;Acc:1... [more]
rab5ab9.261e-9371.12ras-related protein Rab-5A-like [Source:NCBI gene;... [more]
rab5c2.291e-9271.67RAB5C, member RAS oncogene family [Source:NCBI gen... [more]
rab22a9.697e-5751.53RAB22A, member RAS oncogene family [Source:NCBI ge... [more]
RAB311.015e-5450.00RAB31, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of Ras-related protein Rab-5A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064914.19.436e-11895.40SMESG000064914.1[more]
SMESG000065500.14.534e-7666.86SMESG000065500.1[more]
SMESG000057525.12.333e-7260.00SMESG000057525.1[more]
SMESG000057525.12.410e-7260.00SMESG000057525.1[more]
SMESG000078456.11.166e-6757.23SMESG000078456.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014246 ID=SMED30014246|Name=Ras-related protein Rab-5A|organism=Schmidtea mediterranea sexual|type=transcript|length=1135bp
TTAATTGTTATAAACACTATTTTTATAAACATTTCCACTAATAAATAATA
GTTTAACAATGCAAAATCGTCAAGTACAATTTAAATTAGTACTTCTTGGT
GAATCAGCTGTCGGTAAATCTAGTTTGGTAATGCGGTTCGTTAAAGGTCA
ATTTCACGAGTACCAAGAAAGCACCGTTGGAGCTGCATTCCTCACTCAAA
CCGTTGTTGTCGAAGATACTACTGTCAAATTTGAAATATGGGATACTGCA
GGACAAGAACGTTATCACAGTTTAGCACCGATGTATTATCGTGGTGCACA
AGCAGCAATTGTCGTGTATGATATCACAAGTCAAGATTCATTTCATAGAG
CTAAAAACTGGATTCAAGAGTTGACAGAAAAAGCCACATCTGTCAAAGTA
ATAGCATTGGCCGGTAATAAATCAGATTTGAGTGCCCAAAGAGAAGTATC
TATTTCAGATGGCAGCACATATGCTCAAGAAAATGGTTTACTTTTCATGG
AGACTTCAGCGAAAACTTCATCAAACGTTAATGAAATATTTTTAGAAATA
GCCAAGAAATTGCCTCGACACGAGGTTAACACTCAAAATGCAGGTTCGGG
ACAACGACTTGGTCAATCTGGACGACCAGTTGGATCAGGCTCTTCTAGTG
GTCCATGTGGTTGTAAGTAATCACTCGCTGAATTCGTTATGATTTCTACG
ACATACCAATCGTACATTTGTGTGTATTGAATGCTTTGAAGTGTGTTTAA
AACAATAATTTGCATTGAGGCGATATTCAATATTGTTTAAGAATAGAGTG
TGATTATTGATTACCTTATTCATTTTCTGGATGTGTTTGTTTTAATCTGT
GCTTACGATGGTGTCTGGAAGTGTTTTGCACTGACGACAGTTTTAATTGC
TACCCGTATGCAAATATACAGTGACATTTCGATAATAAAATCATTTTATG
AAGAAGCAATTATTAAAATTTTCCTTGATCCAAATTTGGCGTTCATTAAT
GATCTAAAGGATTATTTATTTATTTATTTTTCAATATTTGACATCTTTAC
AAAAGTCATGAAATCGAATAATTTTAATATTAACAAAAATTCATGTTATG
TGATTTTCATGTTTGTTTTAGTTGGACTGATAAAC
back to top

protein sequence of SMED30014246-orf-1

>SMED30014246-orf-1 ID=SMED30014246-orf-1|Name=SMED30014246-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=204bp
MQNRQVQFKLVLLGESAVGKSSLVMRFVKGQFHEYQESTVGAAFLTQTVV
VEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITSQDSFHRAKN
WIQELTEKATSVKVIALAGNKSDLSAQREVSISDGSTYAQENGLLFMETS
AKTSSNVNEIFLEIAKKLPRHEVNTQNAGSGQRLGQSGRPVGSGSSSGPC
GCK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000418head
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR027417P-loop_NTPase
IPR001806Small_GTPase
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0019003GDP binding
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0006810transport
GO:0015031protein transport
GO:0030100regulation of endocytosis
Vocabulary: cellular component
TermDefinition
GO:0005768endosome
GO:0005769early endosome
GO:0005886plasma membrane
GO:0016020membrane
GO:0030139endocytic vesicle
GO:0031901early endosome membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 49..71
score: 48.02
coord: 146..168
score: 42.27
coord: 8..29
score: 48.92
coord: 111..124
score: 45.17
coord: 31..47
score: 28.08
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 10..171
e-value: 9.9E-13
score: 43.0
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 5..171
e-value: 4.5E-35
score: 132.5
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 8..171
e-value: 1.9E-84
score: 296.5
NoneNo IPR availableSMARTSM00176ran_sub_2coord: 13..191
e-value: 5.4E-5
score: 22.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 2..188
e-value: 8.7E-65
score: 219.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 175..203
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 175..194
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 7..172
NoneNo IPR availablePANTHERPTHR24073:SF366RAS-RELATED PROTEIN RAB-5Ccoord: 7..172
NoneNo IPR availablePROSITEPS51419RABcoord: 3..202
score: 34.267
NoneNo IPR availableCDDcd01860Rab5_relatedcoord: 7..169
e-value: 2.93698E-113
score: 317.956
IPR001806Small GTPasePFAMPF00071Rascoord: 9..168
e-value: 3.7E-61
score: 205.5
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 8..162
e-value: 1.4E-28
score: 97.7
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 3..176