Lysosomal aspartic protease

Overview
NameLysosomal aspartic protease
Smed IDSMED30014243
Length (bp)1340
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lysosomal aspartic protease (SMED30014243) t-SNE clustered cells

Violin plots show distribution of expression levels for Lysosomal aspartic protease (SMED30014243) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lysosomal aspartic protease (SMED30014243) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lysosomal aspartic protease (SMED30014243) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014243

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014243SMESG000064545.1 SMESG000047762.1 SMESG000046800.1 SMESG000012864.1 SMESG000003895.1 SMESG000070132.1 SMESG000067883.1 SMESG000061668.1 SMESG000058705.1 SMESG000020613.1 Contig337GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014243SMESG000035344.1 Contig337GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30014243SMESG000035344.1 dd_Smed_v4_329_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014243SMESG000035344.1 dd_Smed_v4_329_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30014243SMESG000035344.1 dd_Smed_v4_329_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30014243SMESG000035344.1 dd_Smed_v6_329_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30014243SMESG000035344.1 dd_Smed_v6_329_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014243SMESG000035344.1 dd_Smed_v6_329_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lysosomal aspartic protease vs. Ensembl Human
Match: CTSD (cathepsin D [Source:HGNC Symbol;Acc:HGNC:2529])

HSP 1 Score: 373.244 bits (957), Expect = 3.658e-126
Identity = 197/384 (51.30%), Postives = 247/384 (64.32%), Query Frame = 2
Query:  167 LRVPLKKMESARSNIVKFNMMLNHFMK------------SEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIV-------ATA----KVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISML-GKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSL-----SGIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            +R+PL K  S R  + +    +   +             +  + PIPE L NYMDAQY+GEI IGTPPQ FTV+FDTGSSNLWVPS  CKL ++AC  H KY+S KSSTYVKNGT+F I YG+GSLSG+LS DTV V       A+A    KV  Q FGEA  +PG TF+ AKFDGILGMAYP ISV++V PVF N++ QKLVD  IFSFYL+RD + +PGGE++ GG+D  YY+G  +Y  VT K YWQ  +  + +  G T C   C AI DTGTSL+VGP   + ++         I G  +I C  VS LP I +++ G+ + L P DY LK   T+C+SGF  +     SG P +ILGDVFIGRYYT FD  N+R+GFA
Sbjct:   22 VRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKAGKTLCLSGFMGMDIPPPSG-PLWILGDVFIGRYYTVFDRDNNRVGFA 404          
BLAST of Lysosomal aspartic protease vs. Ensembl Human
Match: CTSD (cathepsin D [Source:HGNC Symbol;Acc:HGNC:2529])

HSP 1 Score: 369.392 bits (947), Expect = 1.441e-124
Identity = 197/387 (50.90%), Postives = 248/387 (64.08%), Query Frame = 2
Query:  167 LRVPLKKMESARSNIVKFNMMLNHFMK------------SEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIV-------ATA----KVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISML-GKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSL-----SGIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            +R+PL K  S R  + +    +   +             +  + PIPE L NYMDAQY+GEI IGTPPQ FTV+FDTGSSNLWVPS  CKL ++AC  H KY+S KSSTYVKNGT+F I YG+GSLSG+LS DTV V       A+A    KV  Q FGEA  +PG TF+ AKFDGILGMAYP ISV++V PVF N++ QKLVD  IFSFYL+RD + +PGGE++ GG+D  YY+G  +Y  VT K YWQ  +  + +  G T C   C AI DTGTSL+VGP   + ++         I G  +I C  VS LP I +++ G+ + L P DY LK+     T+C+SGF  +     SG P +ILGDVFIGRYYT FD  N+R+GFA
Sbjct:   22 VRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSG-PLWILGDVFIGRYYTVFDRDNNRVGFA 407          
BLAST of Lysosomal aspartic protease vs. Ensembl Human
Match: CTSD (cathepsin D [Source:HGNC Symbol;Acc:HGNC:2529])

HSP 1 Score: 362.459 bits (929), Expect = 5.908e-122
Identity = 195/386 (50.52%), Postives = 247/386 (63.99%), Query Frame = 2
Query:  167 LRVPLKKMESARSNIVKFNMMLNHFMK------------SEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIV-------ATA----KVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISML-GKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSL-----SGIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            +R+PL K  S R  + +    +   +             +  + PIPE L NYMDAQY+GEI IGTPPQ FTV+FDTGSSNLWVPS  CKL ++AC  H KY+S KSSTYVKNGT+F I YG+GSLSG+LS DTV V       A+A    KV  Q FGEA  +PG TF+ AKFDGILGMAYP ISV++V PVF N++ QKLVD  IFSFYL+RD + +PGGE++ GG+D  YY+G  +Y  VT K YWQ  +  + +  G T C   C AI DTGTSL+VGP   + ++       K  G   ++   VS LP I +++ G+ + L P DY LK+     T+C+SGF  +     SG P +ILGDVFIGRYYT FD  N+R+GFA
Sbjct:   22 VRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQ------KAIGAVPLIQGEVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSG-PLWILGDVFIGRYYTVFDRDNNRVGFA 400          
BLAST of Lysosomal aspartic protease vs. Ensembl Human
Match: CTSD (cathepsin D [Source:HGNC Symbol;Acc:HGNC:2529])

HSP 1 Score: 360.918 bits (925), Expect = 1.930e-121
Identity = 197/386 (51.04%), Postives = 247/386 (63.99%), Query Frame = 2
Query:  167 LRVPLKKMESARSNIVKFNMMLNHFMK------------SEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIV-------ATA----KVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSL-----SGIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            +R+PL K  S R  + +    +   +             +  + PIPE L NYMDAQY+GEI IGTPPQ FTV+FDTGSSNLWVPS  CKL ++AC  H KY+S KSSTYVKNGT+F I YG+GSLSG+LS DTV V       A+A    KV  Q FGEA  +PG TF+ AKFDGILGMAYP ISV++V PVF N++ QKLVD  IFSFYL+RD + +PGGE++ GG+D  YY+G  +Y  VT K YW   ++  S  G T C   C AI DTGTSL+VGP   + ++         I G  +I C  VS LP I +++ G+ + L P DY LK+     T+C+SGF  +     SG P +ILGDVFIGRYYT FD  N+R+GFA
Sbjct:   22 VRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYW---VEVAS--GLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSG-PLWILGDVFIGRYYTVFDRDNNRVGFA 401          
BLAST of Lysosomal aspartic protease vs. Ensembl Human
Match: CTSD (cathepsin D [Source:HGNC Symbol;Acc:HGNC:2529])

HSP 1 Score: 360.147 bits (923), Expect = 4.859e-121
Identity = 195/387 (50.39%), Postives = 246/387 (63.57%), Query Frame = 2
Query:  167 LRVPLKKMESARSNIVKFNMMLNHFMK------------SEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIV-------ATA----KVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISML-GKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSL-----SGIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            +R+PL K  S R  + +    +   +             +  + PIPE L NYMD  Y+GEI IGTPPQ FTV+FDTGSSNLWVPS  CKL ++AC  H KY+S KSSTYVKNGT+F I YG+GSLSG+LS DTV V       A+A    KV  Q FGEA  +PG TF+ AKFDGILGMAYP ISV++V PVF N++ QKLVD  IFSFYL+RD + +PGGE++ GG+D  YY+G  +Y  VT K YWQ  +  + +  G T C   C AI DTGTSL+VGP   + ++         I G  +I C  VS LP I +++ G+ + L P DY LK+     T+C+SGF  +     SG P +ILGDVFIGRYYT FD  N+R+GFA
Sbjct:   22 VRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMD--YYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSG-PLWILGDVFIGRYYTVFDRDNNRVGFA 405          
BLAST of Lysosomal aspartic protease vs. Ensembl Celegans
Match: asp-4 (ASpartyl Protease [Source:UniProtKB/TrEMBL;Acc:Q21966])

HSP 1 Score: 341.658 bits (875), Expect = 9.220e-114
Identity = 179/350 (51.14%), Postives = 226/350 (64.57%), Query Frame = 2
Query:  221 NMMLNHFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTK--INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLSGIP-----FFILGDVFIGRYYTEFDLGNSRIGFAPVKT 1237
            N   + +    ++  I E L NYMDAQYFG I+IGTP Q FTV+FDTGSSNLW+PSKKC   ++AC+ H +YDS  SSTY ++G   +I+YGTGS+ GF+S D+V VA      Q F EA  EPG TFV AKFDGILGMAYP I+V  V PVF  +  QK V + +FSF+LNR+ + + GGEI FGG D   Y  P TY PVT K YWQF M  +   G   C+N C AIADTGTSLI GP++ I+ I + F G +  I G  +I C  V  LP ++  I G+ F LK  DY+LK+     T+C+SGF  +  +P      +ILGDVFIGRYY+ FD   +R+GFA  KT
Sbjct:   67 NHHFDKYQALNVEGEIDELLRNYMDAQYFGTISIGTPAQNFTVIFDTGSSNLWIPSKKCPFYDIACMLHHRYDSKSSSTYKEDGRKMAIQYGTGSMKGFISKDSVCVAGVCAEDQPFAEATSEPGITFVAAKFDGILGMAYPEIAVLGVQPVFNTLFEQKKVPSNLFSFWLNRNPDSEIGGEITFGGIDSRRYVEPITYVPVTRKGYWQFKMDKVVGSGVLGCSNGCQAIADTGTSLIAGPKAQIEAIQN-FIGAEPLIKGEYMISCDKVPTLPPVSFVIGGQEFSLKGEDYVLKVSQGGKTICLSGFMGID-LPERVGELWILGDVFIGRYYSVFDFDQNRVGFAQAKT 414          
BLAST of Lysosomal aspartic protease vs. Ensembl Celegans
Match: asp-3 (Aspartic protease 3 [Source:UniProtKB/Swiss-Prot;Acc:P55956])

HSP 1 Score: 274.248 bits (700), Expect = 4.545e-88
Identity = 152/380 (40.00%), Postives = 212/380 (55.79%), Query Frame = 2
Query:  164 LLRVPLKKMESARSNIVKFNMMLNHFMKSEIKNPIP------EPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVV----SQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVT-PVFQNMVAQKLVDAPIFSFYLNRDVNG-KPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTKI-NGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD----TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVKT 1237
            + R+ L+K    R    KF  +  H     +   IP      E L +Y +AQY+G +TIGTPPQ F VLFDTGSSNLWVP   C   ++AC  H ++D  KSS+    G +F I+YGTGS+ G +  D V            +Q    A  EPG TFV AKFDGI GM + +ISV+ ++ P+ Q      +    +F+F+L+RD N    GGEI    +DPN+Y G   + P+ S+ YW+  + S+ + G TY +    +I DTGTSL+ GP  +I  I  K  G  + NG   + CS +  LP I   + G+NF L+  DYIL++ +    + C+SGF  +       P +ILGDVFIGR+Y+ FD GN R+GFA  +T
Sbjct:   18 IQRIKLEKRTYTREQ-YKFGSIQEHLKAKYVPGYIPNKDAFNEGLSDYSNAQYYGPVTIGTPPQNFQVLFDTGSSNLWVPCANCPFGDIACRMHNRFDCKKSSSCTATGASFEIQYGTGSMKGTVDNDVVCFGHDTTYCTDKNQGLACATSEPGITFVAAKFDGIFGMGWDTISVNKISQPMDQIFANSAICKNQLFAFWLSRDANDITNGGEITLCDTDPNHYVGNIAWEPLVSEDYWRIKLASVVIDGTTYTSGPIDSIVDTGTSLLTGPTDVIKKIQHKIGGIPLFNGEYEVECSKIPSLPNITFNLGGQNFDLQGKDYILQMSNGNGGSTCLSGFMGMDIPAPAGPLWILGDVFIGRFYSVFDHGNKRVGFATSRT 396          
BLAST of Lysosomal aspartic protease vs. Ensembl Celegans
Match: asp-1 (ASpartyl Protease; Aspartic protease 1 [Source:UniProtKB/TrEMBL;Acc:G5EEI4])

HSP 1 Score: 231.876 bits (590), Expect = 9.235e-72
Identity = 138/392 (35.20%), Postives = 214/392 (54.59%), Query Frame = 2
Query:  116 IKLLIIALVINGIFGGLLRVPLKKMESARSNIVKFN-----MMLNHFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLAC-------LTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDV---NGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTNCTAIADTGTSLIVGPQSIIDDI--NSKFNGTKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQ---DTVCVSGFTSLSG--IPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            ++  ++  ++      +++VP  K ES R+ ++K       +   H  +++  N   +P  +Y D  Y G IT+GTPPQP TV+ DTGSSNLWV    CK    AC        T +K+D++KS+T+VK    FSI+YG+GS +G+L  D +      V SQ FG +       F     DGILG+ +P+++VD V P  QN++AQK +DAP+F+ +L+R++    G PGG I +G  D        TY P+++KTYWQF + + ++   +       I+DTGTS +  P +I+  I   +K        +  + CS++   P +   I G  FP+K  +Y+L LQ       ++ F+  SG   P +ILGD FI +Y   +D+GN +IGFA
Sbjct:    1 MQTFVLLALVAACSAAVIQVPTHKTESLRAKLIKEGKYTAFLASQHAARAQQLNTGFQPFVDYFDDFYLGNITLGTPPQPATVVLDTGSSNLWVIDAACK--TQACNGYPDSGYTKQKFDTTKSTTFVKETRKFSIQYGSGSCNGYLGKDVLNFGGLTVQSQEFGVS-THLADVFGYQPVDGILGLGWPALAVDQVVPPMQNLIAQKQLDAPLFTVWLDRNLQIAQGTPGGLITYGAIDTVNCAKQVTYVPLSAKTYWQFPLDAFAVGTYSETKKDQVISDTGTSWLGAPNTIVSAIVKQTKAVFDWSTELYTVDCSTMKTQPDLIFTIGGAQFPVKSVEYVLDLQLGGGKCALAVFSMGSGGFGPSWILGDTFIRQYCNVYDIGNGQIGFA 389          
BLAST of Lysosomal aspartic protease vs. Ensembl Celegans
Match: asp-1 (ASpartyl Protease; Aspartic protease 1 [Source:UniProtKB/TrEMBL;Acc:G5EEI4])

HSP 1 Score: 231.876 bits (590), Expect = 9.235e-72
Identity = 138/392 (35.20%), Postives = 214/392 (54.59%), Query Frame = 2
Query:  116 IKLLIIALVINGIFGGLLRVPLKKMESARSNIVKFN-----MMLNHFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLAC-------LTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDV---NGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTNCTAIADTGTSLIVGPQSIIDDI--NSKFNGTKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQ---DTVCVSGFTSLSG--IPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            ++  ++  ++      +++VP  K ES R+ ++K       +   H  +++  N   +P  +Y D  Y G IT+GTPPQP TV+ DTGSSNLWV    CK    AC        T +K+D++KS+T+VK    FSI+YG+GS +G+L  D +      V SQ FG +       F     DGILG+ +P+++VD V P  QN++AQK +DAP+F+ +L+R++    G PGG I +G  D        TY P+++KTYWQF + + ++   +       I+DTGTS +  P +I+  I   +K        +  + CS++   P +   I G  FP+K  +Y+L LQ       ++ F+  SG   P +ILGD FI +Y   +D+GN +IGFA
Sbjct:    1 MQTFVLLALVAACSAAVIQVPTHKTESLRAKLIKEGKYTAFLASQHAARAQQLNTGFQPFVDYFDDFYLGNITLGTPPQPATVVLDTGSSNLWVIDAACK--TQACNGYPDSGYTKQKFDTTKSTTFVKETRKFSIQYGSGSCNGYLGKDVLNFGGLTVQSQEFGVS-THLADVFGYQPVDGILGLGWPALAVDQVVPPMQNLIAQKQLDAPLFTVWLDRNLQIAQGTPGGLITYGAIDTVNCAKQVTYVPLSAKTYWQFPLDAFAVGTYSETKKDQVISDTGTSWLGAPNTIVSAIVKQTKAVFDWSTELYTVDCSTMKTQPDLIFTIGGAQFPVKSVEYVLDLQLGGGKCALAVFSMGSGGFGPSWILGDTFIRQYCNVYDIGNGQIGFA 389          
BLAST of Lysosomal aspartic protease vs. Ensembl Celegans
Match: asp-17 (ASpartyl Protease [Source:UniProtKB/TrEMBL;Acc:Q8MYN5])

HSP 1 Score: 226.098 bits (575), Expect = 1.598e-69
Identity = 131/375 (34.93%), Postives = 205/375 (54.67%), Query Frame = 2
Query:  158 GGLLRVPLKKMESARSNIVKFNMMLNHFMKSEIK--NPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLAC-------LTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGE---IIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTNCTAIADTGTSLIVGPQSIIDDINSKFNGT--KINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILK--LQDTVCVSGFTSL--SGI-PFFILGDVFIGRYYTEFDLGNSRIGFA 1225
              + ++P K   S R+ +++        +       N I +P+ +Y D  Y G  T+GTPPQP +++ DTGS+N+WV    C   N+ C        T +K+D+SKSS++ +    FSI+YG G  SG+L TDTV +     + +       +    F V   DGI G+A+P+++VD +TP  QN+++Q  +D P+FS +L+R +    GG    I +GG D        TY P+T+KTYWQF M   ++   +       I+DTG+S I  P ++I+DI ++ + T  ++N +  + CS++   P +   I G  FP+K  +YIL   L +  C    + L  SG  P +ILGDVFI +Y   +D+GN+RIGFA
Sbjct:   15 AAVFQLPTKSTGSLRAKLIRAGKYQEFLITQHAARLNTISQPISDYSDEVYLGNFTVGTPPQPVSLVLDTGSANMWVIDASCD--NMFCNGWIGSNYTRQKFDTSKSSSFSRENRKFSIQYGKGLCSGYLGTDTVGLGGGLTIRKQELGIANKLDVDFAVQPMDGIFGLAWPALAVDQITPPMQNLISQ--LDVPVFSVWLDRKIQASHGGSAGMITYGGIDTKNCDAGVTYVPLTAKTYWQFKMDGFAVGTYSQYGYNQVISDTGSSWISAPYAMINDIATQTHATWDEMNEIYTVKCSTMKTQPDLVFTIGGALFPVKSVEYILDIGLDEGKCALAISPLMASGFGPSWILGDVFIRQYCNIYDIGNARIGFA 385          
BLAST of Lysosomal aspartic protease vs. Ensembl Fly
Match: cathD (gene:FBgn0029093 transcript:FBtr0088898)

HSP 1 Score: 408.683 bits (1049), Expect = 1.139e-140
Identity = 207/367 (56.40%), Postives = 243/367 (66.21%), Query Frame = 2
Query:  161 GLLRVPLKKMESARSNIVKFNMMLNHFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            GLLRVPL K +SAR +       L           +PEPL NYMDAQY+G I IG+PPQ F V+FDTGSSNLWVPSKKC LTN+ACL H KYD+SKS TY KNGT F+I+YG+GSLSG+LSTDTV +A   +  QTF EA+ EPG  FV AKFDGILG+ Y SISVD V P F  M  Q L+ AP+FSFYLNRD     GGEIIFGGSDPN+Y G FTY PVT K YWQ  M + S+     C   C  IADTGTSLI  P      IN K  GT  I G  ++ C  + +LPVI   + G+ F L+  DYIL++     T+C+SGF  L       P +ILGDVFIG+YYTEFD+GN R+GFA  K
Sbjct:   26 GLLRVPLHKFQSARRHFADVGTELQQLRIRYGGGDVPEPLSNYMDAQYYGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNKYDASKSKTYTKNGTEFAIQYGSGSLSGYLSTDTVSIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSISVDKVKPPFYAMYEQGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRKAYWQIKMDAASIGDLQLCKGGCQVIADTGTSLIAAPLEEATSINQKIGGTPIIGGQYVVSCDLIPQLPVIKFVLGGKTFELEGKDYILRVAQMGKTICLSGFMGLDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFADAK 392          
BLAST of Lysosomal aspartic protease vs. Ensembl Fly
Match: cathD (gene:FBgn0029093 transcript:FBtr0452079)

HSP 1 Score: 408.683 bits (1049), Expect = 1.139e-140
Identity = 207/367 (56.40%), Postives = 243/367 (66.21%), Query Frame = 2
Query:  161 GLLRVPLKKMESARSNIVKFNMMLNHFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            GLLRVPL K +SAR +       L           +PEPL NYMDAQY+G I IG+PPQ F V+FDTGSSNLWVPSKKC LTN+ACL H KYD+SKS TY KNGT F+I+YG+GSLSG+LSTDTV +A   +  QTF EA+ EPG  FV AKFDGILG+ Y SISVD V P F  M  Q L+ AP+FSFYLNRD     GGEIIFGGSDPN+Y G FTY PVT K YWQ  M + S+     C   C  IADTGTSLI  P      IN K  GT  I G  ++ C  + +LPVI   + G+ F L+  DYIL++     T+C+SGF  L       P +ILGDVFIG+YYTEFD+GN R+GFA  K
Sbjct:   26 GLLRVPLHKFQSARRHFADVGTELQQLRIRYGGGDVPEPLSNYMDAQYYGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNKYDASKSKTYTKNGTEFAIQYGSGSLSGYLSTDTVSIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSISVDKVKPPFYAMYEQGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRKAYWQIKMDAASIGDLQLCKGGCQVIADTGTSLIAAPLEEATSINQKIGGTPIIGGQYVVSCDLIPQLPVIKFVLGGKTFELEGKDYILRVAQMGKTICLSGFMGLDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFADAK 392          
BLAST of Lysosomal aspartic protease vs. Ensembl Fly
Match: cathD (gene:FBgn0029093 transcript:FBtr0452080)

HSP 1 Score: 408.683 bits (1049), Expect = 1.139e-140
Identity = 207/367 (56.40%), Postives = 243/367 (66.21%), Query Frame = 2
Query:  161 GLLRVPLKKMESARSNIVKFNMMLNHFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            GLLRVPL K +SAR +       L           +PEPL NYMDAQY+G I IG+PPQ F V+FDTGSSNLWVPSKKC LTN+ACL H KYD+SKS TY KNGT F+I+YG+GSLSG+LSTDTV +A   +  QTF EA+ EPG  FV AKFDGILG+ Y SISVD V P F  M  Q L+ AP+FSFYLNRD     GGEIIFGGSDPN+Y G FTY PVT K YWQ  M + S+     C   C  IADTGTSLI  P      IN K  GT  I G  ++ C  + +LPVI   + G+ F L+  DYIL++     T+C+SGF  L       P +ILGDVFIG+YYTEFD+GN R+GFA  K
Sbjct:   26 GLLRVPLHKFQSARRHFADVGTELQQLRIRYGGGDVPEPLSNYMDAQYYGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNKYDASKSKTYTKNGTEFAIQYGSGSLSGYLSTDTVSIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSISVDKVKPPFYAMYEQGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRKAYWQIKMDAASIGDLQLCKGGCQVIADTGTSLIAAPLEEATSINQKIGGTPIIGGQYVVSCDLIPQLPVIKFVLGGKTFELEGKDYILRVAQMGKTICLSGFMGLDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFADAK 392          
BLAST of Lysosomal aspartic protease vs. Ensembl Fly
Match: Bace (gene:FBgn0032049 transcript:FBtr0343427)

HSP 1 Score: 358.607 bits (919), Expect = 3.253e-121
Identity = 192/360 (53.33%), Postives = 239/360 (66.39%), Query Frame = 2
Query:  164 LLRVPLKKMES---ARSNIVKFNMMLN-HFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTNCTAIADTGTSLIVGPQSIIDDINSKFNGTKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSLSGIPFFILGDVFIGRYYTEFDLGNSRIGFAPV 1231
            L RVP+ K ++    R N++     L   +    +++   E L N M+  Y+G I+IGTP Q F VLFD+GSSNLWVPS  CK  + ACLTH +YDSS SSTYV NG +FSI+YGTGSL+G+LSTDTV V    + SQTF E+  EPGT F  A FDGILGMAY S++VD V P F NMV+Q LVD  +FSFYL RD     GGE+IFGGSD + Y G  TY P++ + YWQF+M   S+ G + C +C AIADTGTSLIV P +    ++   N   +     + CSSVS LP +   I G NF LKPS YI++  D  C+S F  + G  F+ILGDVFIG+YYTEFDLGN+RIGFAPV
Sbjct:   19 LHRVPILKEQNFVKTRQNVLAEKSYLRTKYQLPSLRSVDEEQLSNSMNMAYYGAISIGTPAQSFKVLFDSGSSNLWVPSNTCK--SDACLTHNQYDSSASSTYVANGESFSIQYGTGSLTGYLSTDTVDVNGLSIQSQTFAESTNEPGTNFNDANFDGILGMAYESLAVDGVAPPFYNMVSQGLVDNSVFSFYLARDGTSTMGGELIFGGSDASLYSGALTYVPISEQGYWQFTMAGSSIDGYSLCDDCQAIADTGTSLIVAPYNAYITLSEILN---VGEDGYLDCSSVSSLPDVTFNIGGTNFVLKPSAYIIQ-SDGNCMSAFEYM-GTDFWILGDVFIGQYYTEFDLGNNRIGFAPV 371          
BLAST of Lysosomal aspartic protease vs. Ensembl Fly
Match: Bace (gene:FBgn0032049 transcript:FBtr0079701)

HSP 1 Score: 358.607 bits (919), Expect = 3.253e-121
Identity = 192/360 (53.33%), Postives = 239/360 (66.39%), Query Frame = 2
Query:  164 LLRVPLKKMES---ARSNIVKFNMMLN-HFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTNCTAIADTGTSLIVGPQSIIDDINSKFNGTKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSLSGIPFFILGDVFIGRYYTEFDLGNSRIGFAPV 1231
            L RVP+ K ++    R N++     L   +    +++   E L N M+  Y+G I+IGTP Q F VLFD+GSSNLWVPS  CK  + ACLTH +YDSS SSTYV NG +FSI+YGTGSL+G+LSTDTV V    + SQTF E+  EPGT F  A FDGILGMAY S++VD V P F NMV+Q LVD  +FSFYL RD     GGE+IFGGSD + Y G  TY P++ + YWQF+M   S+ G + C +C AIADTGTSLIV P +    ++   N   +     + CSSVS LP +   I G NF LKPS YI++  D  C+S F  + G  F+ILGDVFIG+YYTEFDLGN+RIGFAPV
Sbjct:   19 LHRVPILKEQNFVKTRQNVLAEKSYLRTKYQLPSLRSVDEEQLSNSMNMAYYGAISIGTPAQSFKVLFDSGSSNLWVPSNTCK--SDACLTHNQYDSSASSTYVANGESFSIQYGTGSLTGYLSTDTVDVNGLSIQSQTFAESTNEPGTNFNDANFDGILGMAYESLAVDGVAPPFYNMVSQGLVDNSVFSFYLARDGTSTMGGELIFGGSDASLYSGALTYVPISEQGYWQFTMAGSSIDGYSLCDDCQAIADTGTSLIVAPYNAYITLSEILN---VGEDGYLDCSSVSSLPDVTFNIGGTNFVLKPSAYIIQ-SDGNCMSAFEYM-GTDFWILGDVFIGQYYTEFDLGNNRIGFAPV 371          
BLAST of Lysosomal aspartic protease vs. Ensembl Zebrafish
Match: ctsd (cathepsin D [Source:ZFIN;Acc:ZDB-GENE-010131-8])

HSP 1 Score: 355.525 bits (911), Expect = 1.396e-119
Identity = 184/397 (46.35%), Postives = 241/397 (60.71%), Query Frame = 2
Query:  110 MNIKLLIIALVINGIFGGLLRVPLKKMESARSNIVKFNMMLNHFMKSE-----------IKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISM-LGKTYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTKI-NGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVKT 1237
            M I  L++          ++R+PLKK  + R  +      L   + S              +P PE L NY+DAQY+GEI +GTP Q FTV+FDTGSSNLWVPS  C LT++ACL H KY+  KSSTYVKNGT F+I+YG+GSLSG+LS DT  +    V  Q FGEA+ +PG  F+ AKFDGILGMAYP ISVD V PVF  M++QK V+  +FSFYLNR+ + +PGGE++ GG+DP YY G F Y  ++ + YWQ  M  +S+  G + C   C AI DTGTSLI GP + +  +        +  G  ++ C  V  LP I+  + G+ + L    YILK       +C+SGF  L       P +ILGDVFIG+YYT FD  N+R+GFA  K+
Sbjct:    1 MRIAFLLLVAAFFCTSDAIVRIPLKKFRTLRRTLSDSGRSLEELVSSSNSLKYNLGFPASNDPTPETLKNYLDAQYYGEIGLGTPVQTFTVVFDTGSSNLWVPSVHCSLTDIACLLHHKYNGGKSSTYVKNGTQFAIQYGSGSLSGYLSQDTCTIGDIAVEKQIFGEAIKQPGVAFIAAKFDGILGMAYPRISVDGVPPVFDMMMSQKKVEKNVFSFYLNRNPDTQPGGELLLGGTDPKYYTGDFNYVDISRQAYWQIHMDGMSIGSGLSLCKGGCEAIVDTGTSLITGPAAEVKALQKAIGAIPLMQGEYMVDCKKVPTLPTISFSLGGKVYSLTGEQYILKESQGGHDICLSGFMGLDIPPPAGPLWILGDVFIGQYYTVFDRENNRVGFAKAKS 397          
BLAST of Lysosomal aspartic protease vs. Ensembl Zebrafish
Match: ctsd (cathepsin D [Source:ZFIN;Acc:ZDB-GENE-010131-8])

HSP 1 Score: 355.525 bits (911), Expect = 1.396e-119
Identity = 184/397 (46.35%), Postives = 241/397 (60.71%), Query Frame = 2
Query:  110 MNIKLLIIALVINGIFGGLLRVPLKKMESARSNIVKFNMMLNHFMKSE-----------IKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISM-LGKTYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTKI-NGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVKT 1237
            M I  L++          ++R+PLKK  + R  +      L   + S              +P PE L NY+DAQY+GEI +GTP Q FTV+FDTGSSNLWVPS  C LT++ACL H KY+  KSSTYVKNGT F+I+YG+GSLSG+LS DT  +    V  Q FGEA+ +PG  F+ AKFDGILGMAYP ISVD V PVF  M++QK V+  +FSFYLNR+ + +PGGE++ GG+DP YY G F Y  ++ + YWQ  M  +S+  G + C   C AI DTGTSLI GP + +  +        +  G  ++ C  V  LP I+  + G+ + L    YILK       +C+SGF  L       P +ILGDVFIG+YYT FD  N+R+GFA  K+
Sbjct:    1 MRIAFLLLVAAFFCTSDAIVRIPLKKFRTLRRTLSDSGRSLEELVSSSNSLKYNLGFPASNDPTPETLKNYLDAQYYGEIGLGTPVQTFTVVFDTGSSNLWVPSVHCSLTDIACLLHHKYNGGKSSTYVKNGTQFAIQYGSGSLSGYLSQDTCTIGDIAVEKQIFGEAIKQPGVAFIAAKFDGILGMAYPRISVDGVPPVFDMMMSQKKVEKNVFSFYLNRNPDTQPGGELLLGGTDPKYYTGDFNYVDISRQAYWQIHMDGMSIGSGLSLCKGGCEAIVDTGTSLITGPAAEVKALQKAIGAIPLMQGEYMVDCKKVPTLPTISFSLGGKVYSLTGEQYILKESQGGHDICLSGFMGLDIPPPAGPLWILGDVFIGQYYTVFDRENNRVGFAKAKS 397          
BLAST of Lysosomal aspartic protease vs. Ensembl Zebrafish
Match: ctsd (cathepsin D [Source:ZFIN;Acc:ZDB-GENE-010131-8])

HSP 1 Score: 355.525 bits (911), Expect = 1.590e-119
Identity = 183/397 (46.10%), Postives = 242/397 (60.96%), Query Frame = 2
Query:  110 MNIKLLIIALVINGIFGGLLRVPLKKMESARSNIVKFNMMLNHFMKSE-----------IKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISM-LGKTYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTKI-NGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVKT 1237
            M I  L++ +        ++R+PLKK  + R  +      L   + S              +P PE L NY+DAQY+GEI +GTP Q FTV+FDTGSSNLWVPS  C LT++ACL H KY+  KSSTYVKNGT F+I+YG+GSLSG+LS DT  +    V  Q FGEA+ +PG  F+ AKFDGILGMAYP I+VD V PVF  M++QK V+  +FSFYLNR+ + +PGGE++ GG+DP YY G F Y  ++ + YWQ  M  +S+  G + C   C AI DTGTSLI GP + +  +        +  G  ++ C  V  LP I+  + G+ + L    YILK       +C+SGF  L       P +ILGDVFIG+YYT FD  N+R+GFA  K+
Sbjct:    1 MRIAFLLLVVAFFCTSDAIVRIPLKKFRTLRRTLSDSGRSLEELVSSSNSLKYNLGFPASNDPTPETLKNYLDAQYYGEIGLGTPVQTFTVVFDTGSSNLWVPSVHCSLTDIACLLHHKYNGGKSSTYVKNGTQFAIQYGSGSLSGYLSQDTCTIGDIAVEKQIFGEAIKQPGVAFIAAKFDGILGMAYPRIAVDGVPPVFDMMMSQKKVEKNVFSFYLNRNPDTQPGGELLLGGTDPKYYTGDFNYVDISRQAYWQIHMDGMSIGSGLSLCKGGCEAIVDTGTSLITGPAAEVKALQKAIGAIPLMQGEYMVDCKKVPTLPTISFSLGGKVYSLTGEQYILKESQGGHDICLSGFMGLDIPPPAGPLWILGDVFIGQYYTVFDRENNRVGFAKAKS 397          
BLAST of Lysosomal aspartic protease vs. Ensembl Zebrafish
Match: napsa (napsin A aspartic peptidase [Source:ZFIN;Acc:ZDB-GENE-030131-8690])

HSP 1 Score: 335.109 bits (858), Expect = 2.438e-111
Identity = 178/393 (45.29%), Postives = 233/393 (59.29%), Query Frame = 2
Query:  161 GLLRVPLKKMESARSNIVKFNMMLNHF-----MKSEIKN-----------PIP---------EPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYC-TNCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
             ++R+PL KM + R  +      ++       MK++  +           P P         E L N+MDAQY+G I+IGTPPQ F+VLFDTGSSNLWVPS  C   ++AC  HR+Y+S KSSTYV+NGT FSI+YG GSLSGF+S DTV +A   V  Q F EA+ +PG  F VA+FDG+LGMAYP+ISVD VTPVF   +A K++   IFSFY+NRD  G  GGE++ GG D  Y+ G   Y  VT K YWQ  M  + +    T C + C AI DTGTS+I GP   +  +         + G   I C  +  LPV++  + G+ F L   +Y++K+      VC+SGF ++       P +ILGDVFIGRYYT FD    R+GFAP K
Sbjct:   20 AIIRIPLHKMRTVRRMLADNGKTIDEIKSLAKMKAKYSDGTFTNQGSVTIPAPTTTQLPPPVEKLTNFMDAQYYGMISIGTPPQDFSVLFDTGSSNLWVPSIHCAFLDIACWLHRRYNSKKSSTYVQNGTEFSIQYGRGSLSGFISQDTVNLAGLNVTGQQFAEAVKQPGIVFAVARFDGVLGMAYPAISVDRVTPVFDTAMAAKILPQNIFSFYINRDPAGDVGGELMLGGFDQQYFNGDLHYVNVTRKAYWQIKMDEVQVGSTLTLCKSGCQAIVDTGTSMITGPVQEVRALQKAIGAIPLLMGEYWIDCKKIPTLPVVSFSLGGKMFNLTGQEYVMKVSHMGMNVCLSGFMAMDIPPPAGPLWILGDVFIGRYYTVFDRDQDRVGFAPAK 412          
BLAST of Lysosomal aspartic protease vs. Ensembl Zebrafish
Match: ren (renin [Source:ZFIN;Acc:ZDB-GENE-040630-3])

HSP 1 Score: 289.271 bits (739), Expect = 1.019e-93
Identity = 160/374 (42.78%), Postives = 222/374 (59.36%), Query Frame = 2
Query:  161 GLLRVPLKKMESARSNIVKFNM----MLNHFM-KSEIKNPI----PEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKT-YCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTKI-NGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYIL---KLQDTVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
             L RV LKKM S R  + + ++    +L+  M K +  +P     P PL NY+D QYFGEI+IG+P Q F V+FDTGS+NLWVPS  C     AC TH +YD+SKS T++ NGT FSI+Y +G++ GFLS D V V     V Q F EA   P   F+ AKFDG+LGM YP +++D +TPVF  +++Q ++   +FS Y +RD    PGGE++ GG+DPNY+ GPF Y     +  W+  M+ +S+     +C + CTA+ DTG+S I GP S I  +       ++  G   + C+ V  LP +   + G+ + L   DYIL   +  + +C   F +L       P +ILG  FI RYYTEFD GN+RIGFA
Sbjct:   20 ALWRVKLKKMPSIRETLKEMSVTPAQVLSEIMPKYQEPSPTNGTAPTPLINYLDTQYFGEISIGSPAQMFNVVFDTGSANLWVPSHSCSPLYTACFTHNRYDASKSLTHIFNGTGFSIQYASGNVRGFLSEDVV-VVGGIPVVQVFAEATALPAIPFIFAKFDGVLGMGYPDVAIDGITPVFDRIMSQHVLKENVFSVYYSRDPTHIPGGELVLGGTDPNYHTGPFHYINTKEQGKWEVIMKGVSVGADILFCKDGCTAVIDTGSSYITGPASSISILMKTIGAVELAEGGYTVSCNVVRLLPTVAFHLGGQEYSLTDEDYILWQSEFGEDICTVTFKALDVPPPTGPVWILGANFIARYYTEFDRGNNRIGFA 392          
BLAST of Lysosomal aspartic protease vs. Ensembl Xenopus
Match: ENSXETT00000012336.1 (cathepsin D-like [Source:NCBI gene;Acc:613063])

HSP 1 Score: 371.318 bits (952), Expect = 1.597e-125
Identity = 191/378 (50.53%), Postives = 243/378 (64.29%), Query Frame = 2
Query:  164 LLRVPLKKMESARSNIVKFNMMLNHFMKSEIK-----------NPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            L+R+PLKK  S R    +    +   + +E+             P PE L NY+DAQY+GEI +G+PPQ FTV+FDTGSSNLWVPS  C + ++AC  H KYDSSKSSTYVKNGTAF+I+YGTGSLSG+LS DTV +    V  Q FGEA+ +PG TFV AKFDGILGMAYP ISVD V PVF N++AQKLV++ IFSFYLNR+ + +PGGE++ GG+DP YY G F Y  VT K YWQ  M  + +  + T C   C  I DTGTSLI GP   +  +         I G  ++ C  V  LPVI++ + G+ + L    YI+K+     T+C+SGF  L+      P +ILGDVFIG+YY+ FD  N  +GFA  K
Sbjct:   22 LIRIPLKKFPSIRHTFTEAGKDVKELLANEVPLKYSPGFPPSGEPTPEALKNYLDAQYYGEIGLGSPPQNFTVVFDTGSSNLWVPSVHCSMLDIACWMHHKYDSSKSSTYVKNGTAFAIQYGTGSLSGYLSKDTVTIGNLAVKGQIFGEAVKQPGVTFVAAKFDGILGMAYPVISVDGVPPVFDNIMAQKLVESNIFSFYLNRNPDTQPGGELLLGGTDPKYYTGDFHYLSVTRKAYWQIHMDQLGVGDQLTLCKGGCEVIVDTGTSLITGPLEEVTALQKAIGAVPLIQGQYMVQCDKVPTLPVISLTLGGQVYTLTGEQYIMKVSQRGSTICLSGFMGLNIPPPAGPLWILGDVFIGQYYSVFDRANDCVGFAKAK 399          
BLAST of Lysosomal aspartic protease vs. Ensembl Xenopus
Match: ENSXETT00000028662.1 (fatty acid-binding protein, liver [Source:Xenbase;Acc:XB-GENE-5907627])

HSP 1 Score: 351.288 bits (900), Expect = 6.268e-118
Identity = 178/326 (54.60%), Postives = 223/326 (68.40%), Query Frame = 2
Query:  287 YMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILK---LQDTVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            Y+ AQY+GEI +G+PPQ FTV+FDTGSSNLWVPS  C + ++AC  H KYDSSKSSTYVKNGTAF+I+YGTGSLSG+LS DTV +    V  Q FGEA+ +PG TFV AKFDGILGMAYP ISVD V PVF N++AQKLV++ IFSFYLNR+ + +PGGE++ GG+DP YY G F Y  VT K YWQ  M  + +  + T C   C  I DTGTSLI GP   +  +         I G  ++ C  V  LPVI++ + G+ + L    YI+K   L  T+C+SGF  L+      P +ILGDVFIG+YY+ FD  N+R+GFA  K
Sbjct:   60 YLQAQYYGEIGLGSPPQNFTVVFDTGSSNLWVPSVHCSMLDIACWMHHKYDSSKSSTYVKNGTAFAIQYGTGSLSGYLSKDTVTIGILAVKGQIFGEAVKQPGVTFVAAKFDGILGMAYPVISVDGVPPVFDNIMAQKLVESNIFSFYLNRNPDTQPGGELLLGGTDPKYYTGDFHYLNVTRKAYWQIHMDQLGVGDQLTLCKGGCEVIVDTGTSLITGPLEEVTALQKAIGAVPLIQGQYMVQCDKVPTLPVISLTLGGQVYTLTGEQYIMKVSQLGSTICLSGFMGLNIPPPAGPLWILGDVFIGQYYSVFDRANNRVGFAKAK 385          
BLAST of Lysosomal aspartic protease vs. Ensembl Xenopus
Match: ctsd (cathepsin D [Source:NCBI gene;Acc:394561])

HSP 1 Score: 348.977 bits (894), Expect = 7.459e-117
Identity = 193/377 (51.19%), Postives = 241/377 (63.93%), Query Frame = 2
Query:  164 LLRVPLKKMESARSNIVKFNMMLNHFMKSEI----------KNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            L+R+PLKK  S R  + + +        +E           KNP PE L NY+DAQY+GEI IGTPPQPFTV+FDTGSSNLWVPS  C   +LAC  H KYDSSKS+TY+ NGT F+I+YG+GSL+G+LS DTV +    V  Q F EA+ +PG TFV AKFDGILGM YP ISVD V PVF +++ QKLVD+ IFSFYLNR+ +  PGGE++ GG+DP +Y G F Y  VT K YWQ  M  +S+  + + C + C AI DTGTSLI GP   +  +         I G  +ILC S+  LPVI+    GR + L    Y+LK+     TVC+SGF  L       P +I+GDVFIG+YYT FD  N R+GFA  K
Sbjct:   22 LVRIPLKKFTSIRRAMSETDQDALKLSGNEAATKYSAFLNSKNPTPETLLNYLDAQYYGEIGIGTPPQPFTVVFDTGSSNLWVPSIHCSFWDLACWLHHKYDSSKSTTYINNGTEFAIQYGSGSLTGYLSKDTVTIGDLAVNGQFFAEAIKQPGITFVAAKFDGILGMGYPKISVDGVPPVFDDIMEQKLVDSNIFSFYLNRNPDTLPGGELLLGGTDPAFYTGDFNYMNVTRKAYWQIHMDQLSVGDRLSLCKDGCEAIVDTGTSLITGPVEEVTALQRAIGAIPLIRGEYMILCDSIPSLPVISFTFGGRAYSLTGEQYVLKISKAGRTVCLSGFLGLDIPPPAGPLWIIGDVFIGQYYTVFDRANDRVGFAKAK 398          
BLAST of Lysosomal aspartic protease vs. Ensembl Xenopus
Match: ENSXETT00000013456.1 (cathepsin D-like [Source:NCBI gene;Acc:101733630])

HSP 1 Score: 347.051 bits (889), Expect = 1.499e-116
Identity = 176/326 (53.99%), Postives = 221/326 (67.79%), Query Frame = 2
Query:  287 YMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            Y+ AQY+GEI +G+PPQ FTV+FDTGSSNLWVPS  C + ++AC  H KYDSSKSSTYVKNGTAF+I+YGTGSLSG+LS DTV +    V  Q FGEA+ +PG TFV AKFDGILGMAYP ISVD V PVF N++AQKLV++ IFSFYLNR+ + +PGGE++ GG+DP YY G F Y  VT K YWQ  M  + +  + T C   C  I DTGTSLI GP   +  +         I G  ++ C  V  LPVI++ + G+ + L    YI+K+     T+C+SGF  L+      P +ILGDVFIG+YY+ FD    R+GFA  K
Sbjct:   41 YLQAQYYGEIGLGSPPQNFTVVFDTGSSNLWVPSVHCSMLDIACWMHHKYDSSKSSTYVKNGTAFAIQYGTGSLSGYLSKDTVTIGNLAVKRQMFGEAVKQPGVTFVAAKFDGILGMAYPVISVDGVPPVFDNIMAQKLVESNIFSFYLNRNPDTQPGGELLLGGTDPKYYTGDFHYLNVTRKAYWQIHMDQLGVGDQLTLCKGGCEVIVDTGTSLITGPLEEVTALQKAIGAVPLIQGQYMVQCDKVPTLPVISLTLGGQVYTLTGEQYIMKVSQRGSTICLSGFMGLNIPPPAGPLWILGDVFIGQYYSVFDRAYDRVGFAKAK 366          
BLAST of Lysosomal aspartic protease vs. Ensembl Xenopus
Match: ctsd (cathepsin D [Source:NCBI gene;Acc:394561])

HSP 1 Score: 346.665 bits (888), Expect = 3.635e-116
Identity = 194/383 (50.65%), Postives = 241/383 (62.92%), Query Frame = 2
Query:  164 LLRVPLKKMESARSNI----------------VKFNMMLNHFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            L ++PLKK  S R  +                 K++  LN       KNP PE L NY+DAQY+GEI IGTPPQPFTV+FDTGSSNLWVPS  C   +LAC  H KYDSSKS+TY+ NGT F+I+YG+GSL+G+LS DTV +    V  Q F EA+ +PG TFV AKFDGILGM YP ISVD V PVF +++ QKLVD+ IFSFYLNR+ +  PGGE++ GG+DP +Y G F Y  VT K YWQ  M  +S+  + + C + C AI DTGTSLI GP   +  +         I G  +ILC S+  LPVI+    GR + L    Y+LK+     TVC+SGF  L       P +I+GDVFIG+YYT FD  N R+GFA  K
Sbjct:    7 LFKIPLKKFTSIRRAMSETDQDALKLSGNEAATKYSAFLNS------KNPTPETLLNYLDAQYYGEIGIGTPPQPFTVVFDTGSSNLWVPSIHCSFWDLACWLHHKYDSSKSTTYINNGTEFAIQYGSGSLTGYLSKDTVTIGDLAVNGQFFAEAIKQPGITFVAAKFDGILGMGYPKISVDGVPPVFDDIMEQKLVDSNIFSFYLNRNPDTLPGGELLLGGTDPAFYTGDFNYMNVTRKAYWQIHMDQLSVGDRLSLCKDGCEAIVDTGTSLITGPVEEVTALQRAIGAIPLIRGEYMILCDSIPSLPVISFTFGGRAYSLTGEQYVLKISKAGRTVCLSGFLGLDIPPPAGPLWIIGDVFIGQYYTVFDRANDRVGFAKAK 383          
BLAST of Lysosomal aspartic protease vs. Ensembl Mouse
Match: Ctsd (cathepsin D [Source:MGI Symbol;Acc:MGI:88562])

HSP 1 Score: 363.614 bits (932), Expect = 1.415e-122
Identity = 194/386 (50.26%), Postives = 248/386 (64.25%), Query Frame = 2
Query:  164 LLRVPLKKMESARSNIVKF-----NMMLN-----HFMKSEIK--NPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATA---------KVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSL-----SGIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            ++R+PL+K  S R  + +      +++L      + M+S  K   P+ E L NY+DAQY+G+I IGTPPQ FTV+FDTGSSNLWVPS  CK+ ++AC  H KY+S KSSTYVKNGT+F I YG+GSLSG+LS DTV V            KV  Q FGEA  +PG  FV AKFDGILGM YP ISV++V PVF N++ QKLVD  IFSFYLNRD  G+PGGE++ GG+D  YY G  +Y  VT K YWQ  M  + +  + T C   C AI DTGTSL+VGP   + ++         I G  +I C  VS LP + +++ G+N+ L P  YILK+     T+C+SGF  +     SG P +ILGDVFIG YYT FD  N+R+GFA
Sbjct:   21 IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWQVHMDQLEVGNELTLCKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSG-PLWILGDVFIGSYYTVFDRDNNRVGFA 405          
BLAST of Lysosomal aspartic protease vs. Ensembl Mouse
Match: Ctsd (cathepsin D [Source:MGI Symbol;Acc:MGI:88562])

HSP 1 Score: 355.14 bits (910), Expect = 2.829e-119
Identity = 191/385 (49.61%), Postives = 245/385 (63.64%), Query Frame = 2
Query:  164 LLRVPLKKMESARSNIVKF-----NMMLN-----HFMKSEIK--NPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATA---------KVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSL-----SGIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            ++R+PL+K  S R  + +      +++L      + M+S  K   P+ E L NY+DAQY+G+I IGTPPQ FTV+FDTGSSNLWVPS  CK+ ++AC  H KY+S KSSTYVKNGT+F I YG+GSLSG+LS DTV V            KV  Q FGEA  +PG  FV AKFDGILGM YP ISV++V PVF N++ QKLVD  IFSFYLNRD  G+PGGE++ GG+D  YY G  +Y  VT K YW      +++     C   C AI DTGTSL+VGP   + ++         I G  +I C  VS LP + +++ G+N+ L P  YILK+     T+C+SGF  +     SG P +ILGDVFIG YYT FD  N+R+GFA
Sbjct:   21 IIRIPLRKFTSIRRTMTEVGGSVEDLILKGPITKYSMQSSPKTTEPVSELLKNYLDAQYYGDIGIGTPPQCFTVVFDTGSSNLWVPSIHCKILDIACWVHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSDQSKARGIKVEKQIFGEATKQPGIVFVAAKFDGILGMGYPHISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPEGQPGGELMLGGTDSKYYHGELSYLNVTRKAYWLEVGNELTL-----CKGGCEAIVDTGTSLLVGPVEEVKELQKAIGAVPLIQGEYMIPCEKVSSLPTVYLKLGGKNYELHPDKYILKVSQGGKTICLSGFMGMDIPPPSG-PLWILGDVFIGSYYTVFDRDNNRVGFA 399          
BLAST of Lysosomal aspartic protease vs. Ensembl Mouse
Match: Ctse (cathepsin E [Source:MGI Symbol;Acc:MGI:107361])

HSP 1 Score: 307.375 bits (786), Expect = 9.047e-101
Identity = 170/382 (44.50%), Postives = 229/382 (59.95%), Query Frame = 2
Query:  158 GGLLRVPLKKMESARSNIVKFNMMLNHFMKSE------------IKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKT--YCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTV-----CVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPV 1231
            G L RVPL++ +S R  + +    L+ F +S             + + + EPL NY+D +YFG I+IGTPPQ FTV+FDTGSSNLWVPS  C  T+ AC  H  +  S+S TY + G  FSI+YGTGSL+G +  D V V    V  Q FGE++ EPG TFV A+FDGILG+ YPS++   VTPVF NM+AQ LV  P+FS YL+ D  G  G E+ FGG DP+++ G   + PVT + YWQ ++  I  +G T  +C+  C AI DTGTSLI GP   I  +      T I+G   + C+++  +P +   I   ++ L P+DYIL   D V     C SGF  L       P +ILGDVFI ++Y+ FD GN+++G AP 
Sbjct:   20 GALHRVPLRRHQSLRKKL-RAQGQLSEFWRSHNLDMTRLSESCNVYSSVNEPLINYLDMEYFGTISIGTPPQNFTVIFDTGSSNLWVPSVYC--TSPACKAHPVFHPSQSDTYTEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVDGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAAGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQAYWQIALDGI-QVGDTVMFCSEGCQAIVDTGTSLITGPPDKIKQLQEAIGATPIDGEYAVDCATLDTMPNVTFLINEVSYTLNPTDYILP--DLVEGMQFCGSGFQGLDIPPPAGPLWILGDVFIRQFYSVFDRGNNQVGLAPA 395          
BLAST of Lysosomal aspartic protease vs. Ensembl Mouse
Match: Pgc (progastricsin (pepsinogen C) [Source:MGI Symbol;Acc:MGI:98909])

HSP 1 Score: 302.368 bits (773), Expect = 7.910e-99
Identity = 169/396 (42.68%), Postives = 234/396 (59.09%), Query Frame = 2
Query:  116 IKLLIIALVINGIF-GGLLRVPLKKMESARSNIVKFNMMLNHFMKSEIKNP--------------IPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQS--ISMLGKTYCTN--CTAIADTGTSLIVGPQSIIDDINSKFNGTKIN-GMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSL-----SGIPFFILGDVFIGRYYTEFDLGNSRIGFAP 1228
            +K +++AL+   +    L+RVPLKKM+S R  + K   +L  F+K+   +P              + EP+  YMDA Y+GEI+IGTPPQ F VLFDTGSSNLWV S  C+  + AC TH +Y+ SKSSTY   G  FS++YGTGSL+GF   DT+ V + +V +Q FG +  EPGT FV A+FDGI+G+AYP +S    T   Q M+ +  +  P+F  YL     G  GG+I+FGG D N Y G  T+ PVT + YWQ ++    I      +C++  C  I DTGTSL+V P   ++++       +   G   + C SVS LP +   + G  FPL PS YI++ ++  C+ G  SL     SG P +ILGDVF+  YY  FD+GN+R+G AP
Sbjct:    1 MKWMVVALLCLPLLEAALIRVPLKKMKSIRETM-KEQGVLKDFLKNHKYDPGQKYHFGKFGDYSVLYEPM-AYMDASYYGEISIGTPPQNFLVLFDTGSSNLWVSSVYCQ--SEACTTHTRYNPSKSSTYYTQGQTFSLQYGTGSLTGFFGYDTLRVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPGLSSGGATTALQGMLGEGALSQPLFGVYLGSQ-QGSNGGQIVFGGVDENLYTGELTWIPVTQELYWQITIDDFLIGNQASGWCSSSGCQGIVDTGTSLLVMPAQYLNELLQTIGAQEGEYGQYFVSCDSVSSLPTLTFVLNGVQFPLSPSSYIIQ-EEGSCMVGLESLSLNAESGQPLWILGDVFLRSYYAVFDMGNNRVGLAP 390          
BLAST of Lysosomal aspartic protease vs. Ensembl Mouse
Match: Napsa (napsin A aspartic peptidase [Source:MGI Symbol;Acc:MGI:109365])

HSP 1 Score: 301.982 bits (772), Expect = 2.893e-98
Identity = 165/382 (43.19%), Postives = 221/382 (57.85%), Query Frame = 2
Query:  164 LLRVPLKKMESARSNIVKFN--MMLNHFMKSEIK--NPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISM-LGKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILK-LQDTV--CVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNS----RIGFAPVKTPSKDET 1255
            L+RVPL+++      +   N    L    ++     NP   PL  +M+ QYFG I +GTPPQ FTV+FDTGSSNLWVPS +C   +LAC  H +++   SS++  NGT F+I+YGTG LSG LS D + +        TFGEA+ EP   F +A FDGILG+ +P+++V  V P    MV Q L++ P+FSFYLNRD  G  GGE++ GGSDP +Y  P T+ PVT   YWQ  M+S+ +  G + C   C+AI DTGTSLI GP   I  +N    G   +NG   I CS    LP ++  + G  F L   DY++K LQ  V  C+ GF +L       P +ILGDVF+G Y   FD G+     R+G A  ++ S D  
Sbjct:   23 LIRVPLQRIHLGHRILNPLNGWEQLAELSRTSTSGGNPSFVPLSKFMNTQYFGTIGLGTPPQNFTVVFDTGSSNLWVPSTRCHFFSLACWFHHRFNPKASSSFRPNGTKFAIQYGTGRLSGILSQDNLTIGGIHDAFVTFGEALWEPSLIFALAHFDGILGLGFPTLAVGGVQPPLDAMVEQGLLEKPVFSFYLNRDSEGSDGGELVLGGSDPAHYVPPLTFIPVTIPAYWQVHMESVKVGTGLSLCAQGCSAILDTGTSLITGPSEEIRALNKAIGGYPFLNGQYFIQCSKTPTLPPVSFHLGGVWFNLTGQDYVIKILQSDVGLCLLGFQALDIPKPAGPLWILGDVFLGPYVAVFDRGDKNVGPRVGLARAQSRSTDRA 404          
BLAST of Lysosomal aspartic protease vs. UniProt/SwissProt
Match: sp|Q03168|ASPP_AEDAE (Lysosomal aspartic protease OS=Aedes aegypti OX=7159 GN=AAEL006169 PE=1 SV=2)

HSP 1 Score: 409.838 bits (1052), Expect = 3.348e-140
Identity = 210/379 (55.41%), Postives = 258/379 (68.07%), Query Frame = 2
Query:  128 IIALVINGIFG--GLLRVPLKKMESARSNIVKFNMMLNHFM--KSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTKI-NGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            IIALV   +      +RV L K ESAR +    +  +       + +  P+PEPL NY+DAQY+G ITIGTPPQ F V+FDTGSSNLWVPSK+C  TN+ACL H KY++ KSST+ KNGTAF I+YG+GSLSG+LSTDTV +    V  QTF EA+ EPG  FV AKFDGILG+ Y SISVD V PVF NM  Q L+DAP+FSFYLNRD +   GGEIIFGGSD N Y G FTY  V  K YWQF M S+ +    +C N C AIADTGTSLI GP S +  IN    GT I NG  ++ CS + KLP I+  + G++F L+ +DY+L++     T+C+SGF  +       P +ILGDVFIG+YYTEFD+GN R+GFA
Sbjct:    6 IIALVCLAVLAQADFVRVQLHKTESARQHFRNVDTEIKQLRLKYNAVSGPVPEPLSNYLDAQYYGAITIGTPPQSFKVVFDTGSSNLWVPSKECSFTNIACLMHNKYNAKKSSTFEKNGTAFHIQYGSGSLSGYLSTDTVGLGGVSVTKQTFAEAINEPGLVFVAAKFDGILGLGYSSISVDGVVPVFYNMFNQGLIDAPVFSFYLNRDPSAAEGGEIIFGGSDSNKYTGDFTYLSVDRKAYWQFKMDSVKVGDTEFCNNGCEAIADTGTSLIAGPVSEVTAINKAIGGTPIMNGEYMVDCSLIPKLPKISFVLGGKSFDLEGADYVLRVAQMGKTICLSGFMGIDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFA 384          
BLAST of Lysosomal aspartic protease vs. UniProt/SwissProt
Match: sp|Q05744|CATD_CHICK (Cathepsin D OS=Gallus gallus OX=9031 GN=CTSD PE=1 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 6.244e-129
Identity = 197/381 (51.71%), Postives = 249/381 (65.35%), Query Frame = 2
Query:  149 GIFGGLLRVPLKKMESAR-------SNIVKFNMMLNHFMK-----SEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISML-GKTYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQ---DTVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            G    L+R+PL K  S R       S I   N  +  F+K     +++  P PE L NYMDAQY+GEI IGTPPQ FTV+FDTGSSNLWVPS  C L ++ACL H KYD+SKSSTYV+NGT F+I YGTGSLSGFLS DTV +   K+ +Q FGEA+ +PG TF+ AKFDGILGMA+P ISVD VTP F N++ QKL++  IFSFYLNRD   +PGGE++ GG+DP YY G F++  VT K YWQ  M S+ +  G T C   C AI DTGTSLI GP   + ++ +       I G  +I C  +S LPV+ + + G+ + L    Y+ K+    +T+C+SGF+ L     G P +ILGDVFIG YYT FD  N  +GFA
Sbjct:   16 GPCAALIRIPLTKFTSTRRMLTEVGSEIPDMNA-ITQFLKFKLGFADLAEPTPEILKNYMDAQYYGEIGIGTPPQKFTVVFDTGSSNLWVPSVHCHLLDIACLLHHKYDASKSSTYVENGTEFAIHYGTGSLSGFLSQDTVTLGNLKIKNQIFGEAVKQPGITFIAAKFDGILGMAFPRISVDKVTPFFDNVMQQKLIEKNIFSFYLNRDPTAQPGGELLLGGTDPKYYSGDFSWVNVTRKAYWQVHMDSVDVANGLTLCKGGCEAIVDTGTSLITGPTKEVKELQTAIGAKPLIKGQYVISCDKISSLPVVTLMLGGKPYQLTGEQYVFKVSAQGETICLSGFSGLDVPPPGGPLWILGDVFIGPYYTVFDRDNDSVGFA 395          
BLAST of Lysosomal aspartic protease vs. UniProt/SwissProt
Match: sp|P07339|CATD_HUMAN (Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1)

HSP 1 Score: 369.392 bits (947), Expect = 6.918e-124
Identity = 197/387 (50.90%), Postives = 248/387 (64.08%), Query Frame = 2
Query:  167 LRVPLKKMESARSNIVKFNMMLNHFMK------------SEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIV-------ATA----KVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISML-GKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSL-----SGIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            +R+PL K  S R  + +    +   +             +  + PIPE L NYMDAQY+GEI IGTPPQ FTV+FDTGSSNLWVPS  CKL ++AC  H KY+S KSSTYVKNGT+F I YG+GSLSG+LS DTV V       A+A    KV  Q FGEA  +PG TF+ AKFDGILGMAYP ISV++V PVF N++ QKLVD  IFSFYL+RD + +PGGE++ GG+D  YY+G  +Y  VT K YWQ  +  + +  G T C   C AI DTGTSL+VGP   + ++         I G  +I C  VS LP I +++ G+ + L P DY LK+     T+C+SGF  +     SG P +ILGDVFIGRYYT FD  N+R+GFA
Sbjct:   22 VRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVPAVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQPGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSLMVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQAGKTLCLSGFMGMDIPPPSG-PLWILGDVFIGRYYTVFDRDNNRVGFA 407          
BLAST of Lysosomal aspartic protease vs. UniProt/SwissProt
Match: sp|Q4LAL9|CATD_CANLF (Cathepsin D OS=Canis lupus familiaris OX=9615 GN=CTSD PE=2 SV=1)

HSP 1 Score: 365.925 bits (938), Expect = 1.257e-122
Identity = 196/384 (51.04%), Postives = 243/384 (63.28%), Query Frame = 2
Query:  167 LRVPLKKMESARSNIVKFNMMLNHFM-KSEIKN-----------PIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIV---------ATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            +R+PL K  S R  + +    +   + K  I             PIPE L NYMDAQY+GEI IGTPPQ FTV+FDTGSSNLWVPS  CKL ++AC  H KY+S KSSTYVKNGT+F I YG+GSLSG+LS DTV V         A  KV  QTFGEA  +PG TF+ AKFDGILGMAYP ISV++V PVF N++ QKLV+  IFSFYLNRD N +PGGE++ GG+D  YY+GP +Y  VT K YWQ  M+ + +    T C   C AI DTGTSLIVGP   + ++         I G  +I C  VS LP + +++ G+ + L   DY LK+     T+C+SGF  +     G P +ILGDVFIG YYT FD   +R+G A
Sbjct:   22 VRIPLHKFTSVRRTMTELGGPVEDLIAKGPISKYAQGAPAVTGGPIPEMLRNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSALSGLAGIKVERQTFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVEKNIFSFYLNRDPNAQPGGELMLGGTDSKYYKGPLSYLNVTRKAYWQVHMEQVDVGSSLTLCKGGCEAIVDTGTSLIVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPDVTLKLGGKLYKLSSEDYTLKVSQGGKTICLSGFMGMDIPPPGGPLWILGDVFIGCYYTVFDRDQNRVGLA 405          
BLAST of Lysosomal aspartic protease vs. UniProt/SwissProt
Match: sp|P80209|CATD_BOVIN (Cathepsin D OS=Bos taurus OX=9913 GN=CTSD PE=1 SV=2)

HSP 1 Score: 364.77 bits (935), Expect = 1.731e-122
Identity = 192/385 (49.87%), Postives = 244/385 (63.38%), Query Frame = 2
Query:  164 LLRVPLKKMESARSNIVKFNMMLNHFM-KSEI-----------KNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIV---------ATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKL---QDTVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            ++R+PL K  S R  + +    +   + K  I           + PIPE L NYMDAQY+GEI IGTPPQ FTV+FDTGS+NLWVPS  CKL ++AC THRKY+S KSSTYVKNGT F I YG+GSLSG+LS DTV V             V  QTFGEA+ +PG  F+ AKFDGILGMAYP ISV++V PVF N++ QKLVD  +FSF+LNRD   +PGGE++ GG+D  YY+G   +  VT + YWQ  M  + +    T C   C AI DTGTSLIVGP   + ++         I G  +I C  VS LP + +++ G+++ L P DY LK+   + TVC+SGF  +     G P +ILGDVFIGRYYT FD   +R+G A
Sbjct:    1 VIRIPLHKFTSIRRTMSEAAGXVXXLIAKGPISKYATGEPAVRQGPIPELLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSANLWVPSIHCKLLDIACWTHRKYNSDKSSTYVKNGTTFDIHYGSGSLSGYLSQDTVSVPCNPSSSSPGGVTVQRQTFGEAIKQPGVVFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDKNVFSFFLNRDPKAQPGGELMLGGTDSKYYRGSLMFHNVTRQAYWQIHMDQLDVGSSLTVCKGGCEAIVDTGTSLIVGPVEEVRELQKAIGAVPLIQGEYMIPCEKVSSLPEVTVKLGGKDYALSPEDYALKVSQAETTVCLSGFMGMDIPPPGGPLWILGDVFIGRYYTVFDRDQNRVGLA 385          
BLAST of Lysosomal aspartic protease vs. TrEMBL
Match: A0A2L2Y403 (Lysosomal aspartic protease (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 426.787 bits (1096), Expect = 2.063e-144
Identity = 221/398 (55.53%), Postives = 271/398 (68.09%), Query Frame = 2
Query:   74 FRIYILHNFINMMNIKLLIIALVINGIFGGLLRVPLKKMESARSNIVKFN---MMLNHFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKT--YCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILK---LQDTVCVSGFTSLSGI----PFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            F I+IL NF +                   L ++PL +M+S R ++ +      ++N         P PEPL NY+DAQY+G I+IGTPPQPF V+FDTGSSNLWVPSKKCK TN+ACL H KYDSS+SSTY +NGT   IRYG+GS++GFLSTD V V  +K+  QTFGEA+ EPG  FV AKFDGILG+ + SI+VD V PVF NMV QKLVD+PIFSFYLNRD   + GGEIIFGGSDP++Y+G FTY PV  + YWQF M  +S+ GKT  YC   C AIADTGTSLI GP + ++ +N +   T  + G  +I C  + KLP I++   GRNF L+ SDY+LK   L  TVC+SGF  L       P +ILGDVFIGRYYTEFD GNSR+GFA
Sbjct:    4 FSIFILLNFASCTR----------------LFKIPLLRMQSIREHMHEVGTPIHIVNQKWSHLEAGPFPEPLSNYLDAQYYGSISIGTPPQPFKVVFDTGSSNLWVPSKKCKWTNIACLLHNKYDSSQSSTYKENGTELEIRYGSGSMTGFLSTDIVTVGGSKIQDQTFGEAITEPGLAFVAAKFDGILGLGFSSIAVDGVVPVFDNMVKQKLVDSPIFSFYLNRDPKAEVGGEIIFGGSDPDHYKGNFTYVPVDRRGYWQFPMDGLSINGKTGVYCACGCEAIADTGTSLIAGPVAEVEKLNKELGATPLVQGEYMIDCDLIPKLPKISLTFGGRNFDLQGSDYVLKVSQLGKTVCLSGFIGLDVPKPMGPLWILGDVFIGRYYTEFDQGNSRVGFA 385          
BLAST of Lysosomal aspartic protease vs. TrEMBL
Match: A0A232ETM9 (Peptidase A1 domain-containing protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_007250 PE=3 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 3.274e-144
Identity = 218/383 (56.92%), Postives = 263/383 (68.67%), Query Frame = 2
Query:  116 IKLLIIA-LVINGIFGGLLRVPLKKMESARSNIVKFNMMLNHFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTKI-NGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            ++L+ +A L +  +   +LRVPL +++SAR  + +    L+        +P+PEPL NY+DAQY+GEI IG+P Q FTV+FDTGSSNLWVPSKKC +TN+ACL H KYDS KS +Y  NGT FSIRYG+GSLSGFLSTD V +A   V   TF EAM EPG  FV AKFDGILGMAY  ISVD V PVF NMV Q LV  PIFSFYLNRD N K GGE+I GGSDP +Y G FTY PV+ K YWQF M  IS+  K +C N C AIADTGTSLI GP   I+ IN K   T I  G  ++ C +V  LP I+  + G+NF LK  +Y+LK+     T+C+SGF  +       P +ILGDVFIGR+YTEFD+GN RIGFA  K
Sbjct:    2 LRLVFLASLCLAFVTADVLRVPLYRVKSARRTLQEVGTELHQIKLRYGADPVPEPLSNYLDAQYYGEIGIGSPMQKFTVIFDTGSSNLWVPSKKCHITNIACLLHNKYDSRKSKSYKANGTEFSIRYGSGSLSGFLSTDVVTIAGVDVKDTTFAEAMSEPGLAFVAAKFDGILGMAYDRISVDGVPPVFYNMVKQNLVPQPIFSFYLNRDPNAKIGGEMILGGSDPAHYTGDFTYVPVSRKAYWQFKMDKISIGDKLFCENGCEAIADTGTSLIAGPVGEIEGINKKIGATPIVAGEAMVSCDAVPNLPTIDFVVGGKNFSLKGEEYVLKVAQFGKTICLSGFMGIDIPPPNGPLWILGDVFIGRFYTEFDMGNDRIGFANAK 384          
BLAST of Lysosomal aspartic protease vs. TrEMBL
Match: A0A2L2Y0H5 (Lysosomal aspartic protease OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 3.854e-144
Identity = 214/370 (57.84%), Postives = 264/370 (71.35%), Query Frame = 2
Query:  164 LLRVPLKKMESARSNIVKFNMMLNHFMKSEI--KNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKT--YCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTKI-NGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYIL---KLQDTVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            LLRV L      R  + +    +   +   I  K+P PEPL NY+DAQY+G+I+IGTPPQ F V+FDTGSSNLWVPSKKCK TN+ACL H KYDSSKSSTY  NGTAF I+YG+GS++GFLSTDTV +   +V SQTF EA+ EPG TFV AKFDGILGM + +ISVD VTPVF NM+ +K+VD P+FSFYL+R+ N   GGEIIFGGSDPN+Y+G FTY PV  K YWQF M SIS+ GKT  YC++ C AIADTGTSLI GP   ID +N +   T +  G  ++ C+ + KLP ++  + G+ F LK SDY++   +L  T+C+SGF  +       P +ILGDVFIGRYYTEFD  NSR+GFA  K
Sbjct:   21 LLRVKLAHSRPVRHKLHEVGTPVEIALPRRILGKSPFPEPLSNYLDAQYYGQISIGTPPQTFKVVFDTGSSNLWVPSKKCKWTNIACLLHNKYDSSKSSTYKANGTAFEIKYGSGSMTGFLSTDTVAIGGVQVASQTFAEAVTEPGLTFVAAKFDGILGMGFSTISVDGVTPVFDNMLKEKVVDKPVFSFYLSRNPNASAGGEIIFGGSDPNHYKGDFTYVPVDKKGYWQFHMDSISVNGKTSAYCSSGCEAIADTGTSLIAGPVDEIDKLNKEIGATPLMQGEYVVDCNLIPKLPTVSFTLGGKKFDLKGSDYVIQVSQLGQTICLSGFMGIDIPKPAGPLWILGDVFIGRYYTEFDYANSRVGFADAK 390          
BLAST of Lysosomal aspartic protease vs. TrEMBL
Match: A0A2L2Y439 (Lysosomal aspartic protease (Fragment) OS=Parasteatoda tepidariorum OX=114398 PE=2 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 6.205e-144
Identity = 220/398 (55.28%), Postives = 271/398 (68.09%), Query Frame = 2
Query:   74 FRIYILHNFINMMNIKLLIIALVINGIFGGLLRVPLKKMESARSNIVKFN---MMLNHFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKT--YCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILK---LQDTVCVSGFTSLSGI----PFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            F I+IL NF +                   L ++PL +M+S R ++ +      ++N         P PEPL NY+DAQY+G I+IGTPPQPF V+FDTGSSNLWVPSKKCK TN+ACL H KYDSS+SSTY +NGT   IRYG+GS++GFLSTD V V  +K+  QTFGEA+ EPG  FV AKFDGILG+ + SI+VD V PVF NMV QKLVD+PIFSFYLNRD   + GGEIIFGGSDP++Y+G FTY PV  + YWQF M  +S+ GKT  YC   C AIADTGTSLI GP + ++ +N +   T  + G  +I C  + KLP I++   GRNF L+ SDY+LK   L  +VC+SGF  L       P +ILGDVFIGRYYTEFD GNSR+GFA
Sbjct:    4 FSIFILLNFASCTR----------------LFKIPLLRMQSIREHMHEVGTPIHIVNQKWSHLEAGPFPEPLSNYLDAQYYGSISIGTPPQPFKVVFDTGSSNLWVPSKKCKWTNIACLLHNKYDSSQSSTYKENGTELEIRYGSGSMTGFLSTDIVTVGGSKIQDQTFGEAITEPGLAFVAAKFDGILGLGFSSIAVDGVVPVFDNMVKQKLVDSPIFSFYLNRDPKAEVGGEIIFGGSDPDHYKGNFTYVPVDRRGYWQFPMDGLSINGKTGVYCACGCEAIADTGTSLIAGPVAEVEKLNKELGATPLVQGEYMIDCDLIPKLPKISLTFGGRNFDLQGSDYVLKVSQLGKSVCLSGFIGLDVPKPMGPLWILGDVFIGRYYTEFDQGNSRVGFA 385          
BLAST of Lysosomal aspartic protease vs. TrEMBL
Match: A0A482X3U9 (Peptidase A1 domain-containing protein OS=Laodelphax striatellus OX=195883 GN=LSTR_LSTR002334 PE=3 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 6.507e-143
Identity = 216/390 (55.38%), Postives = 269/390 (68.97%), Query Frame = 2
Query:  116 IKLLIIALVINGIFGGLLRVPLKKMESARSNIVKFNMMLNHFM--------KSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKP--GGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTKI-NGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSL-----SGIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            +K  ++ L I    G L+RVP+ K +S R   V+F   L             S++K    E L NY DAQYFGEI++GTPPQPF V+FDTGSSNLWVPSKKC   N+ACLTH KYD++KSSTY KNG  F I YGTGSLSGFLSTDT+ +   K+ +QTFGEA+ EPG TFV AKFDGILG+A+ SIS D VTP F NM+ Q+L+  P+FSFYLNR+ +     GGEIIFGGSDP  Y+G FTY PV    YWQF M  + + GKT+C   C AIADTGTSLIVGP + + +IN     T++  G  ++ CS +SKLP I+I +AG+ F L   DY+LK+ + +C+SGF+ +     SG P +ILGDVFIG+YYTEFD GN R+GFA VK
Sbjct:    1 MKAFVLLLGIGLCCGELMRVPVYKADSIRKQFVEFGNELPQSGIVYGLGSDGSKLKEGTAERLTNYFDAQYFGEISLGTPPQPFQVIFDTGSSNLWVPSKKCSYFNIACLTHHKYDATKSSTYSKNGKEFDIHYGTGSLSGFLSTDTLTIGDMKIKNQTFGEAVKEPGMTFVAAKFDGILGLAFSSISQDSVTPPFYNMMTQQLIKNPVFSFYLNRNASAPAGQGGEIIFGGSDPEKYEGEFTYLPVDRPAYWQFKMDKVQVSGKTFCAKGCEAIADTGTSLIVGPVAEVTEINKLIGATEMPGGQYVVECSLISKLPEISIILAGKEFKLSGEDYVLKISEKICLSGFSGMDIPPPSG-PLWILGDVFIGKYYTEFDFGNKRVGFASVK 389          
BLAST of Lysosomal aspartic protease vs. Ensembl Cavefish
Match: ctsd (cathepsin D [Source:ZFIN;Acc:ZDB-GENE-010131-8])

HSP 1 Score: 354.369 bits (908), Expect = 3.212e-119
Identity = 180/376 (47.87%), Postives = 237/376 (63.03%), Query Frame = 2
Query:  164 LLRVPLKKMESARSNIVKFNMMLNHFMKSEI------------KNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDT---VCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            ++R+PLKK  S R ++      +   +                  P PE L NY+DAQY+GEI +GTP Q FTV+FDTGSSNLWVPS  C LT++ACL H KY+ +KSSTYVKNGTAF+I+YG+GSLSG+LS DT  +    V  Q FGEA+ +PG  F+ AKFDGILGMAYP ISVD V PVF  M++QK V+  +FSFYLNR+ + +PGGE++ GG+DP YY G F Y  ++ + YWQ  M  +++  +   C   C AI DTGTSLI GP + +  +         I G  ++ C  V  LP I+  + G+++ L    YILK       +C+SGF +L       P +ILGDVFIG+YYTEFD  N+R+GFA
Sbjct:   21 IVRIPLKKFRSIRRSMTDSGRAMEELLADSQSTKYNLGFPPPSNGPTPETLKNYLDAQYYGEIGLGTPIQTFTVVFDTGSSNLWVPSVHCSLTDIACLLHHKYNGAKSSTYVKNGTAFAIQYGSGSLSGYLSQDTCTIGDIAVEKQIFGEAIKQPGVAFIAAKFDGILGMAYPRISVDGVPPVFDMMMSQKKVEKNVFSFYLNRNPDTQPGGELLLGGTDPKYYTGDFHYVNISRQAYWQVHMDGMNIGSQLNLCKGGCEAIVDTGTSLITGPAAEVKALQKAIGAIPLIQGEYMVDCKKVPSLPTISFVLGGQSYTLTGEQYILKESQAGKEICLSGFMALDIPPPAGPLWILGDVFIGQYYTEFDRENNRVGFA 396          
BLAST of Lysosomal aspartic protease vs. Ensembl Cavefish
Match: ENSAMXT00000045448.1 (cathepsin D-like [Source:NCBI gene;Acc:103032210])

HSP 1 Score: 341.273 bits (874), Expect = 9.240e-114
Identity = 175/331 (52.87%), Postives = 215/331 (64.95%), Query Frame = 2
Query:  272 EPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYIL---KLQDTVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            E L N+MD+QYFG I+IGTPPQ FTVLFDTGSSNLWVPS  C   +LAC  H +Y+S KSSTYVKNGT+FSIRYG GSLSGF+S DTV +A   V  Q F EA+ +PG  F VA+FDG+LGMAYP+ISVD V PVF   +A KL+   IFSFY NRD   + GGE++ GG D  Y+ G   Y  VT K YWQF M  + +    T C   C AIADTGTS+IVGP   I  +N        + G   I C  +  LP ++I + G+ F L   DY++   ++  ++C+SGF  +       P +ILGDVFIGRYYT FD  N R+GFAP K
Sbjct:   85 EKLTNFMDSQYFGVISIGTPPQEFTVLFDTGSSNLWVPSVHCSFFDLACWLHHRYNSKKSSTYVKNGTSFSIRYGRGSLSGFISQDTVNLAGLNVTGQQFAEAVKQPGIVFAVARFDGVLGMAYPTISVDGVRPVFDTAMASKLLPRNIFSFYFNRDTAAEIGGELMLGGFDAQYFDGDLHYVSVTRKAYWQFLMDEVQVGSTLTICKGGCQAIADTGTSMIVGPVQEIRALNKAIGAIPLLMGEYFIDCKKIPSLPTVSISLGGKMFNLTGKDYVVQETQMGVSICLSGFMGMDVPPPAGPLWILGDVFIGRYYTVFDRDNDRVGFAPTK 415          
BLAST of Lysosomal aspartic protease vs. Ensembl Cavefish
Match: ren (renin [Source:NCBI gene;Acc:103036504])

HSP 1 Score: 297.745 bits (761), Expect = 4.049e-97
Identity = 163/375 (43.47%), Postives = 221/375 (58.93%), Query Frame = 2
Query:  161 GLLRVPLKKMESARSNIVKFNMMLNH-FMKSEIKNPI---------PEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISM-LGKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTKI-NGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYIL---KLQDTVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
             L RV +KKM S R  + +  +     F + E+K+ I         P PL NY+DAQYFGEI+IG+P Q F V+FDTGS+NLWVPS  C     AC TH +YD+SKS T+V NGT FSI+Y +G++ GFLS D V V     V Q F EA   P   F+ AKFDG+LGM YP+ ++D +TPVF  +++Q ++   +FS Y +RD    PGGE++ GG+DPNYY G F Y P   +  W+  M+ +S+   K +CT  CTA+ DTG+S I GP S +  +       ++  G   + C  V  LP +   + G+ +PL   DYIL   +  + +C   F +L       P +ILG  FI RYYTEFD  N+RIGFA
Sbjct:   19 ALQRVRMKKMPSIRETLKETGVTPAQVFAELELKSDISLSPRNGTAPTPLTNYLDAQYFGEISIGSPAQMFNVVFDTGSANLWVPSHMCSPLYTACFTHNRYDASKSHTHVYNGTGFSIQYASGNVRGFLSEDIV-VVGGIPVVQVFAEATALPAIPFIFAKFDGVLGMGYPNAAIDGITPVFDRIMSQHVLKEEVFSVYYSRDPQSIPGGELVLGGTDPNYYTGSFNYVPTKGEGKWEVIMKGVSVGADKLFCTEGCTAVIDTGSSFITGPASSVSILMKTIGAVELAEGGYTVNCDLVMSLPSVIFHLGGKEYPLTQEDYILWQSQFGEDICTVTFRALDVPPPTGPVWILGANFIARYYTEFDRRNNRIGFA 392          
BLAST of Lysosomal aspartic protease vs. Ensembl Cavefish
Match: ren (renin [Source:NCBI gene;Acc:103036504])

HSP 1 Score: 285.419 bits (729), Expect = 2.634e-92
Identity = 162/380 (42.63%), Postives = 220/380 (57.89%), Query Frame = 2
Query:  164 LLRVPLKKMESARSNIVKFNMMLNH-FMKSEIKNPI---------PEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFY-------LNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISM-LGKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYIL---KLQDTVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            L RV +KKM S R  + +  +     F + E+K+ I         P PL NY+DAQYFGEI+IG+P Q F V+FDTGS+NLWVPS  C     AC TH +YD+SKS T+V NGT FSI+Y +G++ GFLS D V V     V Q F EA   P   F+ AKFDG+LGM YP+ ++D +TPVF  +++Q ++   +FS Y       +N   N  PGGE++ GG+DPNYY G F Y P   +  W+  M+ +S+   K +CT  CTA+ DTG+S I GP S +  +       +   +  + C  V  LP +   + G+ +PL   DYIL   +  + +C   F +L       P +ILG  FI RYYTEFD  N+RIGFA
Sbjct:   12 LNRVRMKKMPSIRETLKETGVTPAQVFAELELKSDISLSPRNGTAPTPLTNYLDAQYFGEISIGSPAQMFNVVFDTGSANLWVPSHMCSPLYTACFTHNRYDASKSHTHVYNGTGFSIQYASGNVRGFLSEDIV-VVGGIPVVQVFAEATALPAIPFIFAKFDGVLGMGYPNAAIDGITPVFDRIMSQHVLKEEVFSVYYSSENLIINNFKNIIPGGELVLGGTDPNYYTGSFNYVPTKGEGKWEVIMKGVSVGADKLFCTEGCTAVIDTGSSFITGPASSVSILMKTIGAVE---LYTVNCDLVMSLPSVIFHLGGKEYPLTQEDYILWQSQFGEDICTVTFRALDVPPPTGPVWILGANFIARYYTEFDRRNNRIGFA 387          
BLAST of Lysosomal aspartic protease vs. Ensembl Cavefish
Match: nots (cathepsin E-like [Source:NCBI gene;Acc:103036771])

HSP 1 Score: 284.648 bits (727), Expect = 6.787e-92
Identity = 156/392 (39.80%), Postives = 229/392 (58.42%), Query Frame = 2
Query:  164 LLRVPLKKMESARSNIVKFNMMLNHFMKSEIK-------------------NPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKT-YC----TNCTAIADTGTSLIVGPQSIIDDINSKFNGTKI-NGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILK--LQDTV-CVSGFTSLSGI----PFFILGDVFIGRYYTEFDLGNSRIGFAPVKTPS 1243
            L+R+PL K  S RS++   N + +     ++                        E L N+MDAQYFG+I++GTP Q FTV+FDTGS++LWVPS  C   + AC +H K+ + +SSTY+ +G  F I YG+G L G L+ D + V +  V +Q FGE++ EPG +FV+ KFDGILG++YP+++ +H  PVF NM+ Q LV+ PIFSF+LN  +  +  GE++ GG D + +  P  + PVT K YWQ  M  + + G + +C    ++C AI DTGTSLI GP   I  +      T    G  ++ CS +  LPVI+  + G  + L    YI K  + D V C++GF ++  +    P +ILGDVF+ + Y+ +D G  R+GFA +K PS
Sbjct:   18 LVRIPLTKAPSLRSHLRAKNQLEDFLKDHQVDAFSRRYAQCYPSALLSLKSGKTAERLYNFMDAQYFGQISLGTPAQNFTVVFDTGSADLWVPSTYC--VSPACASHHKFKAIESSTYIHDGRIFGIHYGSGHLLGVLAKDMLKVGSVTVQNQEFGESVYEPGMSFVMTKFDGILGLSYPALAEEHGAPVFDNMIKQNLVEKPIFSFFLN--IGPEKEGELLLGGVDEDLFVPPINWVPVTVKGYWQIKMDVLKVQGTSAFCHGDTSSCQAIVDTGTSLIAGPTMDILILQQLIGATPTPAGEFLVDCSRIKSLPVISFVLNGVEYSLPGESYIRKDVVGDRVLCLTGFVAVDIVSPKGPLWILGDVFLSQVYSIYDRGQDRVGFAQLKVPS 405          
BLAST of Lysosomal aspartic protease vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007388.1 (pep scaffold:Pmarinus_7.0:GL480547:23667:25044:-1 gene:ENSPMAG00000006669.1 transcript:ENSPMAT00000007388.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 6.399e-18
Identity = 50/133 (37.59%), Postives = 75/133 (56.39%), Query Frame = 2
Query:  860 SISMLG-KTYC-TNCTAIADTGTSLIVGPQSIIDDINSKFNGTKIN-GMTIILCSSVSKLPVINIQIAGRNFPLKPSDYIL---KLQDTVCVSGFTSLSGIP-----FFILGDVFIGRYYTEFDLGNSRIGFA 1225
            SIS++G  + C + C AI DTGTS+I GP   +  +      T +  G   I C ++  LP I + + G+ F L    Y++    +Q T+C+ GF  +  +P      +ILGDVFIG++YTEFD  + R+GFA
Sbjct:    1 SISVVGGPSLCVSGCPAIVDTGTSVIAGPSGPLRILQVALGATALPWGQYTIDCRAIPTLPDIVLTLGGKPFHLSGKQYVIVDETVQGTLCLLGFMVMD-VPSSEGLLWILGDVFIGKFYTEFDRDHDRVGFA 132          
BLAST of Lysosomal aspartic protease vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006274.1 (pep scaffold:Pmarinus_7.0:GL484715:1746:11685:1 gene:ENSPMAG00000005661.1 transcript:ENSPMAT00000006274.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.1586 bits (152), Expect = 1.021e-11
Identity = 48/151 (31.79%), Postives = 72/151 (47.68%), Query Frame = 2
Query:  266 IPEPLDNYMDAQ---YFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVV--AKFDGILGMAYPSISV--DHVTPVFQNMVAQ 697
            +P  LDN        Y+ E+ +GTPPQ   +L DTGSSN  V +             R Y   +SSTY  + ++  + Y  G+  G L TD V V      S     A +    +F +  + ++GILG+AY +I+   D + P F ++V Q
Sbjct:   65 VPGMLDNLRGKPGQGYYIEMALGTPPQMLNILVDTGSSNFAVGAAPH------LFLKRYYRPERSSTYRPSHSSVYVPYTQGNWQGDLGTDLVSVPHGGNSSVRANVAAITYSNSFFINGSNWEGILGLAYANIARPDDSLEPFFDSLVKQ 209          
BLAST of Lysosomal aspartic protease vs. Ensembl Yeast
Match: PEP4 (Vacuolar aspartyl protease (proteinase A); required for posttranslational precursor maturation of vacuolar proteinases; important for protein turnover after oxidative damage; plays a protective role in acetic acid induced apoptosis; synthesized as a zymogen, self-activates [Source:SGD;Acc:S000006075])

HSP 1 Score: 264.233 bits (674), Expect = 7.301e-85
Identity = 142/325 (43.69%), Postives = 194/325 (59.69%), Query Frame = 2
Query:  275 PLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYL-NRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYC--TNCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSLSGI----PFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            PL NY++AQY+ +IT+GTPPQ F V+ DTGSSNLWVPS +C   +LAC  H KYD   SS+Y  NGT F+I+YGTGSL G++S DT+ +    +  Q F EA  EPG TF   KFDGILG+ Y +ISVD V P F N + Q L+D   F+FYL +   + + GGE  FGG D + ++G  T+ PV  K YW+   + I  LG  Y    +  A  DTGTSLI  P  + + IN++    K   G   + C++   LP +     G NF + P DY L++  + C+S  T +       P  I+GD F+ +YY+ +DLGN+ +G A
Sbjct:   82 PLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWVPSNECG--SLACFLHSKYDHEASSSYKANGTEFAIQYGTGSLEGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGLGYDTISVDKVVPPFYNAIQQDLLDEKRFAFYLGDTSKDTENGGEATFGGIDESKFKGDITWLPVRRKAYWEVKFEGIG-LGDEYAELESHGAAIDTGTSLITLPSGLAEMINAEIGAKKGWTGQYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSGS-CISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLA 402          
BLAST of Lysosomal aspartic protease vs. Ensembl Yeast
Match: BAR1 (Aspartyl protease; secreted into the periplasmic space of mating type a cell; helps cells find mating partners; cleaves and inactivates alpha factor allowing cells to recover from alpha-factor-induced cell cycle arrest [Source:SGD;Acc:S000001277])

HSP 1 Score: 86.2705 bits (212), Expect = 1.296e-18
Identity = 96/366 (26.23%), Postives = 151/366 (41.26%), Query Frame = 2
Query:  278 LDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWV----------PSKKCKLTN-----------LACLTHRKYDSSKSST--YVKNGTAFSIRYGTGSLS-GFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISV--------DHVTPVF-QNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGP-FTY-------TPVTSKTYWQFSMQSISMLGKTYCTNCT-------AIADTGTSLIVGPQSIIDDINSKFNG--TKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSLSGIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            L +  +  Y   + IGTP Q  TVLFDTGS++ WV           S     +N           + C +   Y+  +SST  Y++NG  F I Y  G+ + G   T+TV +    + +  FG A       +      G+LG+ +P            +   P F Q + ++K++D   +S +LN   +G   G I+FG  D + + G  FT+       T V +      ++Q +    K+ C + T        + D+GTSL+  P+ I D + S  N   ++  G+ I+ C         N         +  S  IL  +      GF         +LGDVF+   Y  FDL N +I  A
Sbjct:   37 LQHEEEMYYATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFCLPNSNTSSYSNATYNGEEVKPSIDCRSMSTYNEHRSSTYQYLENG-RFYITYADGTFADGSWGTETVSINGIDIPNIQFGVAK------YATTPVSGVLGIGFPRRESVKGYEGAPNEYYPNFPQILKSEKIIDVVAYSLFLNSPDSGT--GSIVFGAIDESKFSGDLFTFPMVNEYPTIVDAPATLAMTIQGLGAQNKSSCEHETFTTTKYPVLLDSGTSLLNAPKVIADKMASFVNASYSEEEGIYILDCPVSVGDVEYNFDFGDLQISVPLSSLILSPETEGSYCGFAVQPTNDSMVLGDVFLSSAYVVFDLDNYKISLA 393          
BLAST of Lysosomal aspartic protease vs. Ensembl Yeast
Match: YPS3 (Aspartic protease; member of the yapsin family of proteases involved in cell wall growth and maintenance; attached to the plasma membrane via a glycosylphosphatidylinositol (GPI) anchor [Source:SGD;Acc:S000004111])

HSP 1 Score: 85.5001 bits (210), Expect = 2.064e-18
Identity = 93/353 (26.35%), Postives = 146/353 (41.36%), Query Frame = 2
Query:  302 YFGEITIGTPPQPFTVLFDTGSSNLWVPSKK---CKLTNLACLTHRKYDSSKSSTYVKNGTA-FSIRYGTGSLS-GFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISV---------DHVTPVFQN----MVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVT----SKTYWQFSMQSISMLG---KTYCTNCT-------AIADTGTSLIVGPQSIIDDINSKFNG--TKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSLSGIPFFILGDVFIGRYYTEFDLGNSRIGFAPVKTPSKDETL 1258
            Y  E+ IGTP Q  TVL DTGS++LWVP K    C  + + C  +  +D +KSST+  N ++ F   YG G+ + G    D +      +   +F  A  E  +TF      G+LG+   ++ V         D  +  + N    +     +DA  +S +LN +   +  G I+FG  D + Y+G     P+     S+ Y       +++ G   +T   N T       A+ D+GT+L   P   +  +    N   +K  G     C S      +     G       SD+ ++     CV      +G    ILGD F+   Y  +DL N  I  A  K  +  E +
Sbjct:   63 YSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCG-SVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAEGAFGQDKLKYNELDLSGLSFAVAN-ESNSTF------GVLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDATAYSLFLNDE--SQSSGSILFGAVDHSKYEGQLYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQTDKRNITLTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSVAFDFGGFRINAPLSDFTMQTSVGTCVLAIIPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQAKYGTGKENV 405          
BLAST of Lysosomal aspartic protease vs. Ensembl Yeast
Match: YPS1 (Aspartic protease; hyperglycosylated member of the yapsin family of proteases, attached to the plasma membrane via a glycosylphosphatidylinositol (GPI) anchor; involved in nutrient limitation-induced cleavage of the extracellular inhibitory domain of signaling mucin Msb2p, resulting in activation of the filamentous growth MAPK pathway; involved with other yapsins in the cell wall integrity response; role in KEX2-independent processing of the alpha factor precursor [Source:SGD;Acc:S000004110])

HSP 1 Score: 62.3882 bits (150), Expect = 5.374e-11
Identity = 86/335 (25.67%), Postives = 140/335 (41.79%), Query Frame = 2
Query:  359 TGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSL-SGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISV----------------DHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTS-------KTYWQFSMQ----SISMLGKTYCTNCT----AIADTGTSLIVGPQSIIDDINSKFNG---TKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSLSGIPFFILGDVFIGRYYTEFDLGNSRIGFAPVKTPSKDETL 1258
            +G++   VP+ +  +    C  +  + +S SST+  N T FSI YG G+  SG   TD + ++   V   +F  A  E  +T       G+LG+  P + V                D+   V +N  A K   +  +S YLN   +    G I+FG  D + Y G     P+ +        +  QF +      IS  G +  T  T    A+ D+GT+L   PQ+++  I ++      ++I G  ++ C S   + ++     G +     S +IL    T C+ G    S     ILGD F+   Y  +DL N  I  A  +  +  E +
Sbjct:  170 SGTATQSVPASEATMD---CQQYGTFSTSGSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVAN-ETNSTM------GVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIK---SNTYSLYLND--SDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGISDSGSSNKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRI-GYYVLDCPSDDSMEIV-FDFGGFHINAPLSSFILS-TGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTTSENI 486          
BLAST of Lysosomal aspartic protease vs. Ensembl Yeast
Match: YPS6 (Putative GPI-anchored aspartic protease; member of the yapsin family of proteases involved in cell wall growth and maintenance [Source:SGD;Acc:S000001478])

HSP 1 Score: 58.9214 bits (141), Expect = 7.860e-10
Identity = 89/383 (23.24%), Postives = 151/383 (39.43%), Query Frame = 2
Query:  302 YFGEITIGTPPQPFTVLFDTGSSNLWVPSKK---CK---------------LT----------------NLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGS-LSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYP----------SISVDHVTPVFQN----MVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVT-------SKTYWQFSMQSISMLGKTYCTNCTA------IADTGTSLIVGPQSIIDDINSKFNG--TKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSLSGIPFFILGDVFIGRYYTEFDLGNSRIGFAPVKTPSKDETL 1258
            Y  ++ IGTPPQ   +  DTGSS++ V +     CK               LT                N  C     +D+S SST+  N T F+  YG G+  +G   TD V      +   TFG +    G         GILG++ P          +++++    ++ N    +  Q  ++   +S +LN        G I+FG  D + Y G     P+        S      + QS+++L         +      + D+GT+    P  I + I   F+G  +  +   I  CS V+   ++++   G N     S+++   +D   ++   S S    ++LGD F+   Y  +DL N  I  A     +++E +
Sbjct:   67 YVVKMEIGTPPQTLYLQLDTGSSDMIVNNADIAYCKSMSDGSDYASTDNYELTATFNGLPSTTISSEAYNTLCSYWGTFDASNSSTFENNATFFNNTYGDGTYYAGTYGTDVVSFENITLNDFTFGVSNDTIGNP------SGILGISLPIAEFTDGIEYALALNRTPFIYDNFPMELKNQGKINKIAYSLFLNGP--DAHFGSILFGAVDKSKYTGQLYTLPMLQAFNTLGSNPGMIITAQSVAILDSESGNKTVSDIQFPVMLDSGTTFSYLPTEIAEAIGKSFDGEYSSDDQGYIFDCSKVND-TLLSVDFGGFNISANISNFVTSAKDRCVLNVKQSEST---YMLGDAFLVDAYVVYDLENYEISIAQASFNNQEEDI 437          
BLAST of Lysosomal aspartic protease vs. Ensembl Nematostella
Match: EDO49162 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH56])

HSP 1 Score: 406.757 bits (1044), Expect = 1.181e-140
Identity = 211/366 (57.65%), Postives = 252/366 (68.85%), Query Frame = 2
Query:  170 RVPLKKMESARSNI----VKFNMMLNHFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTK--INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILK---LQDTVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
            R+PL KM + R ++    +    +L  +        +PEPL NYMDAQY+GEITIGTPPQ FTV+FDTGSSNLWVPSKKC  TN+ACL H KYDS+KSSTY KNGT F+IRYG+GSLSGFLS DTV V    V  QTF EA+ EPG TFV AKFDGILGM + SISVD V PVF +MV QKLV AP+FSFYLNR+    PGGE++ GGSDP YY+G F+Y PVT + YWQF M  IS+   ++C++ C AIADTGTSLI GP   I+ +N+   G K  I G   + CS++  LP I   I G+ + L    YILK   L  +VC+SGF  L       P +ILGDVFIG YYTEFD GN R+GFA
Sbjct:    3 RIPLHKMPTPRQSLKEVGISVEQLLGKYGGKYEGGDVPEPLINYMDAQYYGEITIGTPPQKFTVVFDTGSSNLWVPSKKCSWTNIACLLHDKYDSTKSSTYKKNGTEFAIRYGSGSLSGFLSIDTVSVGGIDVKGQTFAEALKEPGLTFVAAKFDGILGMGFSSISVDQVVPVFYDMVLQKLVPAPVFSFYLNREPGASPGGELLLGGSDPKYYKGNFSYVPVTQEGYWQFKMDGISVKEGSFCSDGCQAIADTGTSLIAGPTDEIEKLNN-LIGAKIIIGGEYTVNCSAIDSLPDITFTIGGKKYVLTGKQYILKVTTLGQSVCISGFLGLDVPPPRGPLWILGDVFIGPYYTEFDFGNKRVGFA 367          
BLAST of Lysosomal aspartic protease vs. Ensembl Nematostella
Match: EDO37418 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFW0])

HSP 1 Score: 80.8777 bits (198), Expect = 2.211e-16
Identity = 68/219 (31.05%), Postives = 105/219 (47.95%), Query Frame = 2
Query:  302 YFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCK-LTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGE-AMVEPGTTFVVAKF--DGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTN----CTAIADTGTSLIV 934
            Y  E+ IGTPPQ    L DTGSSN+ +   KC+      C     Y   KS++          +YG G+ SG +  D  +VA  +    T  E A++     F +     +GILG+AY S++ D VTP++  +V    +D  + + +     NG   G+I     +P  Y GP  YT +  +T++  SM  I + G +   +     TAI D+GT+ I+
Sbjct:  181 YVIELDIGTPPQKLEFLIDTGSSNMAIAGPKCQDQWGSKCKIDNFYFPDKSTSARDIKIPIETQYGKGAWSGDMYQD--VVAFPENGPNTLVEFAVIRNEKDFFLRNSINEGILGLAYRSLATDGVTPLYDQLV----LDGKVPNVFTLGLCNGM--GQIWLDHPEPGTYVGPIHYTEIEQETWYTVSMTGIDVAGNSLDLSPQVFPTAIVDSGTTDIL 391          
BLAST of Lysosomal aspartic protease vs. Ensembl Nematostella
Match: EDO39359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA91])

HSP 1 Score: 77.7962 bits (190), Expect = 1.540e-15
Identity = 84/363 (23.14%), Postives = 147/363 (40.50%), Query Frame = 2
Query:  302 YFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVV--AKFDGILGMAYPSISV--DHVTPVFQNMVAQKLVDAPIFSFYL----NRDVNGKP--GGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTNC------TAIADTGTSLIVGPQSIIDDINSKFNGTKINGMTII----------LCSSVSKLP----------VINIQIAGRNFPLK--PSDYILKLQDTVCVSG-----FTSLSGIPFFILGDVFIGRYYTEFDLGNSRIGFAPVKTPSKDETLY 1261
            Y+    +G+PPQ   VL DTGSSN  V +               +   KS++Y       S+ Y  GS  G L +D +       V+     A +     F +  + ++GILG+ Y  ++     VTPVF   V    V+   FS  L      D + +P   G ++FG  D   Y+G   YTP+  K Y++  +  +++ G +   +C        I D+GT+ +   + + + I  +    K + + +I          +C +  + P          +++   + + F LK  P  Y+ +  +   + G     F         ++G V +  +Y  FD  N ++GFA      K+   Y
Sbjct:   12 YYIASNLGSPPQRINVLVDTGSSNFAVAASAHPYIPYY------FHIDKSTSYKDLNKPVSVPYTQGSWEGELGSDLIKFVDGPNVTLRVDVASILQSENFFINGSMWEGILGLGYARLAKPDSSVTPVFDQFVLDHGVEKDSFSMQLCGSSEIDPSAEPTVAGTMVFGEIDEELYKGDLLYTPIVKKWYYEVVITDVAVDGDSLALDCKKYNYDKTIVDSGTTNLRVSEEVFNAILDRLR--KFDKVNLIPDDFWYGRQMMCWNYDRTPWEEFPDMSISLLSSLSSSKEFRLKIPPQLYLRETIEHGPIMGQHCYKFAITRAERGTVIGAVIMEGFYVVFDRENVQVGFAATTCGGKEPMRY 366          
BLAST of Lysosomal aspartic protease vs. Ensembl Medaka
Match: ctsd (cathepsin D [Source:NCBI gene;Acc:111946846])

HSP 1 Score: 369.007 bits (946), Expect = 5.248e-125
Identity = 189/391 (48.34%), Postives = 250/391 (63.94%), Query Frame = 2
Query:  125 LIIALVINGIFGGLLRVPLKKMESARSNIVKFNMMLNHFM--KSEIK---------NPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            +I AL ++G    L+R+PLKK  S R  +       +  +  K  +K          P PE L NY+DAQY+GEI +GTPPQPFTV+FDTGSSNLWVPS  C L ++ACL H KY+S+KSSTYVKNGT+FSI+YG+GSLSG+LS DT  +    V +Q FGEA+ +PG  F+ AKFDGILGMAYP ISVD V PVF N++ QK VD+ +FSFYLNR+ + +PGGE++ GG+DP YY G F Y  ++ + YWQ  M  +++  + + C   C AI DTGTSL+ GP + +  +         I G  +I C  +  LP I   I G+++ L    Y+LK      T+C+SGF  L       P +ILGDVFIG+YYT FD  ++R+GFA  K
Sbjct:    8 VIAALALSG--EALIRIPLKKFRSIRRELTDSGREAHELLADKHSLKYNLGFPSSNGPTPETLKNYLDAQYYGEIALGTPPQPFTVVFDTGSSNLWVPSVHCSLLDIACLLHHKYNSAKSSTYVKNGTSFSIQYGSGSLSGYLSQDTCTIGDISVENQVFGEAIKQPGVAFIAAKFDGILGMAYPRISVDGVVPVFDNIMQQKKVDSNVFSFYLNRNPDTEPGGELLLGGTDPKYYSGDFHYVNISRQAYWQIHMDGMAVGSQLSLCKGGCEAIVDTGTSLLTGPSAEVKALQKAIGAIPLIQGEYMINCDKIPSLPAITFNIGGQSYTLTGDQYVLKESQAGKTICLSGFMGLDIPAPAGPLWILGDVFIGQYYTVFDRDSNRVGFAKSK 396          
BLAST of Lysosomal aspartic protease vs. Ensembl Medaka
Match: ENSORLT00000000117.2 (cathepsin D [Source:NCBI gene;Acc:101161712])

HSP 1 Score: 369.007 bits (946), Expect = 5.248e-125
Identity = 189/391 (48.34%), Postives = 250/391 (63.94%), Query Frame = 2
Query:  125 LIIALVINGIFGGLLRVPLKKMESARSNIVKFNMMLNHFM--KSEIK---------NPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYCT-NCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQD---TVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            +I AL ++G    L+R+PLKK  S R  +       +  +  K  +K          P PE L NY+DAQY+GEI +GTPPQPFTV+FDTGSSNLWVPS  C L ++ACL H KY+S+KSSTYVKNGT+FSI+YG+GSLSG+LS DT  +    V +Q FGEA+ +PG  F+ AKFDGILGMAYP ISVD V PVF N++ QK VD+ +FSFYLNR+ + +PGGE++ GG+DP YY G F Y  ++ + YWQ  M  +++  + + C   C AI DTGTSL+ GP + +  +         I G  +I C  +  LP I   I G+++ L    Y+LK      T+C+SGF  L       P +ILGDVFIG+YYT FD  ++R+GFA  K
Sbjct:    8 VIAALALSG--EALIRIPLKKFRSIRRELTDSGREAHELLADKHSLKYNLGFPSSNGPTPETLKNYLDAQYYGEIALGTPPQPFTVVFDTGSSNLWVPSVHCSLLDIACLLHHKYNSAKSSTYVKNGTSFSIQYGSGSLSGYLSQDTCTIGDISVENQVFGEAIKQPGVAFIAAKFDGILGMAYPRISVDGVVPVFDNIMQQKKVDSNVFSFYLNRNPDTEPGGELLLGGTDPKYYSGDFHYVNISRQAYWQIHMDGMAVGSQLSLCKGGCEAIVDTGTSLLTGPSAEVKALQKAIGAIPLIQGEYMINCDKIPSLPAITFNIGGQSYTLTGDQYVLKESQAGKTICLSGFMGLDIPAPAGPLWILGDVFIGQYYTVFDRDSNRVGFAKSK 396          
BLAST of Lysosomal aspartic protease vs. Ensembl Medaka
Match: ENSORLT00000016892.2 (cathepsin D [Source:NCBI gene;Acc:101168958])

HSP 1 Score: 350.903 bits (899), Expect = 6.457e-118
Identity = 191/391 (48.85%), Postives = 240/391 (61.38%), Query Frame = 2
Query:  122 LLIIALVINGIFGGLLRVPLKKMESARSNIVKFNMMLNHF---------MKSEIKNPIP-EPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYC-TNCTAIADTGTSLIVGPQSIIDDINSKFNGTK-INGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILK---LQDTVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
            L II  ++ G    L+RVPL K  S R  +    M L+           + S     +P E L N+MDAQY+G I+IGTPPQ F+VLFDTGSSNLWVPS  C   ++AC  HR+Y+S KSS+YVKNGT FSIRYG GSLSGF+S DTV VA   V  Q FGEA+ +PG TF VA+FDG+LGMAYPSISV +VTPVF   +A KL+   IFS Y++RD   + GGE+I GG DP Y+ G   Y  VT K YWQ  M  + +  + T C   C +I DTGTSL+VGP   I  ++        + G   I C  +  LPVI+  I G+ F L   DYILK   +  ++C+SGF ++       P +ILGDVFIG+YYT FD    R+GFA  K
Sbjct:    7 LCIIGALMMGQSTALIRVPLHKTRSLRRLMSDNGMSLDDLRALGMRVGSLDSSASPELPVERLTNFMDAQYYGLISIGTPPQNFSVLFDTGSSNLWVPSIHCSFLDVACWVHRRYNSKKSSSYVKNGTEFSIRYGRGSLSGFISQDTVSVAGLSVPGQQFGEAVKQPGITFAVARFDGVLGMAYPSISVANVTPVFDTAMAAKLLPQNIFSVYISRDTAAEVGGELILGGIDPQYFSGDLHYVNVTRKAYWQIQMDRVDVGNQLTLCKAGCQSIVDTGTSLMVGPAEEIRALHKAIGALPLLMGEYFIDCKKIPSLPVISFNIGGKTFNLTGEDYILKESQMGASICLSGFMAMDIPPPAGPLWILGDVFIGKYYTVFDRNADRVGFAAAK 397          
BLAST of Lysosomal aspartic protease vs. Ensembl Medaka
Match: ren (renin [Source:NCBI gene;Acc:101168210])

HSP 1 Score: 292.738 bits (748), Expect = 3.479e-95
Identity = 158/377 (41.91%), Postives = 221/377 (58.62%), Query Frame = 2
Query:  161 GLLRVPLKKMESARSNIVKFNMMLNHFMK-------SEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKT-YCTN-CTAIADTGTSLIVGPQS----IIDDINSKFN--GTKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYIL---KLQDTVCVSGFTSLS----GIPFFILGDVFIGRYYTEFDLGNSRIGFA 1225
             L R+ LKKM S R  + +  + + H +        ++     P PL NY+D QYFGEI+IG+P Q F V+FDTGS+NLWVPS+ C   + AC TH +YD+S S TYV+NGT FSI+Y +G++ GFLS D V V     V Q F EA       F+ AKFDG+LGM YP +++D +TPVF  +++Q ++   +FS Y +RD    PGGE++ GG+DPNYY G F Y        W+  M+ +S+  +T +C   CTA+ DTG+S I GP S    +++ I +  +  G K+N      C +V  LP +   + G+ + L   DYIL   +++  VC   F  L       P +ILG  FI RYYTEFD  ++RIGFA
Sbjct:   23 ALRRIALKKMPSIRETLQEMGVSVEHVLTELAQMKPADNNGTAPTPLTNYLDTQYFGEISIGSPAQMFNVVFDTGSANLWVPSQSCSPFSTACFTHNRYDASHSRTYVENGTGFSIQYASGNVRGFLSEDVV-VVGGIPVVQVFAEATSLSAMPFIFAKFDGVLGMGYPDVAIDGITPVFDRIMSQHVLKEEVFSVYYSRDPKHSPGGELVLGGTDPNYYTGSFNYVKTKDTGKWEVLMKGVSVGTRTMFCAEGCTAVIDTGSSYITGPASSVSVLMETIGADLDESGYKVN------CDTVKLLPSVTFHLGGQQYSLTHEDYILWQSQIEGEVCTVTFRGLDVPPPTGPLWILGANFIARYYTEFDRRHNRIGFA 392          
BLAST of Lysosomal aspartic protease vs. Ensembl Medaka
Match: nots (cathepsin D-like [Source:NCBI gene;Acc:101159061])

HSP 1 Score: 286.96 bits (733), Expect = 9.585e-93
Identity = 158/389 (40.62%), Postives = 225/389 (57.84%), Query Frame = 2
Query:  161 GLLRVPLKKMESARSNIVKFNMMLNHFMKSEIKNPI--------------------PEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGK-PGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLG-KTYCTN-CTAIADTGTSLIVGPQSIIDDINSKFNGTKIN-GMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKL---QDTVCVSGFTSLSGI----PFFILGDVFIGRYYTEFDLGNSRIGFAPVK 1234
             LLRVPL++  + R+ + +   +L+ F+K    +                       E + N+MDAQY+GEI +GTP Q F+V+FDTGSS+LWVPS  C   + AC  HR + + KSS++  +G  F I YG+G L G +  DT+ +    V++Q FGE++ EPG+TFV AKFDG+LG+AYPS++     PVF NM+AQK++D PIFSFYL+R  +   P G+++ GG+D + Y GP  + PVT K YWQ  M S+S+ G  + C   C AI DTGTSLI GP   I  ++     T  + G  ++ C+ +S LP +   +    + L    YI K       +C +GF +        P +ILGDVF+ +YYT FD G  R+GFA  K
Sbjct:   17 ALLRVPLRRNPTIRTQM-RAEGLLDQFLKDNQPDTFNRRYAQCFPPGTQSLRLGRSSEKIYNFMDAQYYGEIRLGTPEQNFSVIFDTGSSDLWVPSSYC--VSQACAFHRHFKAFKSSSFHHDGRTFGIHYGSGHLLGVMGKDTLRIGNLTVLNQEFGESVYEPGSTFVTAKFDGVLGLAYPSLAEIIGKPVFDNMLAQKILDEPIFSFYLSRSKSKSVPEGQLLLGGTDESLYSGPINWVPVTIKGYWQIRMDSVSVQGVSSLCRRGCEAIVDTGTSLIAGPPREILRLHQLIGATPTHFGDFVVDCARLSSLPHVTFVLGEVEYTLTSEHYIRKETFSSRELCFTGFMAAEMFSADGPLWILGDVFLTQYYTIFDKGQDRVGFARAK 402          
BLAST of Lysosomal aspartic protease vs. Planmine SMEST
Match: SMESG000035344.1 (SMESG000035344.1)

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 388/389 (99.74%), Postives = 389/389 (100.00%), Query Frame = 2
Query:  110 MNIKLLIIALVINGIFGGLLRVPLKKMESARSNIVKFNMMLNHFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTNCTAIADTGTSLIVGPQSIIDDINSKFNGTKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSLSGIPFFILGDVFIGRYYTEFDLGNSRIGFAPVKTPSKDETLYYKPLF 1276
            MN+KLLIIALVINGIFGGLLRVPLKKMESARSNIVKFNMMLNHFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTNCTAIADTGTSLIVGPQSIIDDINSKFNGTKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSLSGIPFFILGDVFIGRYYTEFDLGNSRIGFAPVKTPSKDETLYYKPLF
Sbjct:    1 MNVKLLIIALVINGIFGGLLRVPLKKMESARSNIVKFNMMLNHFMKSEIKNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVVSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLVDAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGKTYCTNCTAIADTGTSLIVGPQSIIDDINSKFNGTKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSLSGIPFFILGDVFIGRYYTEFDLGNSRIGFAPVKTPSKDETLYYKPLF 389          
BLAST of Lysosomal aspartic protease vs. Planmine SMEST
Match: SMESG000037819.1 (SMESG000037819.1)

HSP 1 Score: 57.3806 bits (137), Expect = 1.275e-8
Identity = 83/312 (26.60%), Postives = 134/312 (42.95%), Query Frame = 2
Query:  302 YFGEITIGTPPQPFTVLFDTGSSNLWVP-SKKCKLTNLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKVV----SQTFGE--------AMVEPGTTFVV--AKFDGILGMAYPSIS----VDHVTPVFQNMVAQKLVDAPIFSFYL---NRDVNGKP--GGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSMQSISMLGK-TYCTNC------TAIADTGTSLIVGPQSIIDDINSK--FNGTKINGMTIILCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSLS 1138
            Y+  + IG+PPQ F ++ DTGSSN  V  S +  L+N        + S  SSTYV +  +  + Y +G  +G  S+D         +    +Q + +         +++  TTF      F GILG+AYP ++    + H + +F ++V  K     +FS  L   NR+   +P   G  I GG + + Y  P     +  K +++  +  IS+  K    ++C       +I DTGT+    P  I   + S   FN         I      +  VI I     N P  PS Y  ++Q    ++  +SL 
Sbjct:   46 YYMTVGIGSPPQKFNLVIDTGSSNTAVAGSPQQFLSNY-------FKSQLSSTYVDHKISVGVPYDSGKWNGLYSSDIFTFEGVAYIDANKTQRYSKEINVRSNFGLIKESTTFFPKNGNFQGILGLAYPVLAQPANLIHKSTLFDDVV-MKYGLPNMFSIVLCGHNRN-ESQPTTNGFFIAGGKNDSLYNPPLVDILIRRKWFYEIIISRISISNKPIILSSCKEYNRDKSILDTGTADTYFPNVIFHSLVSSIIFNMKNAPFKVTIHSPFWDRRAVICIL---SNSPNHPSTYFPEIQIEFVINDTSSLE 345          
The following BLAST results are available for this feature:
BLAST of Lysosomal aspartic protease vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CTSD3.658e-12651.30cathepsin D [Source:HGNC Symbol;Acc:HGNC:2529][more]
CTSD1.441e-12450.90cathepsin D [Source:HGNC Symbol;Acc:HGNC:2529][more]
CTSD5.908e-12250.52cathepsin D [Source:HGNC Symbol;Acc:HGNC:2529][more]
CTSD1.930e-12151.04cathepsin D [Source:HGNC Symbol;Acc:HGNC:2529][more]
CTSD4.859e-12150.39cathepsin D [Source:HGNC Symbol;Acc:HGNC:2529][more]
back to top
BLAST of Lysosomal aspartic protease vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asp-49.220e-11451.14ASpartyl Protease [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
asp-34.545e-8840.00Aspartic protease 3 [Source:UniProtKB/Swiss-Prot;... [more]
asp-19.235e-7235.20ASpartyl Protease; Aspartic protease 1 [Source:Un... [more]
asp-19.235e-7235.20ASpartyl Protease; Aspartic protease 1 [Source:Un... [more]
asp-171.598e-6934.93ASpartyl Protease [Source:UniProtKB/TrEMBL;Acc:Q8... [more]
back to top
BLAST of Lysosomal aspartic protease vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cathD1.139e-14056.40gene:FBgn0029093 transcript:FBtr0088898[more]
cathD1.139e-14056.40gene:FBgn0029093 transcript:FBtr0452079[more]
cathD1.139e-14056.40gene:FBgn0029093 transcript:FBtr0452080[more]
Bace3.253e-12153.33gene:FBgn0032049 transcript:FBtr0343427[more]
Bace3.253e-12153.33gene:FBgn0032049 transcript:FBtr0079701[more]
back to top
BLAST of Lysosomal aspartic protease vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctsd1.396e-11946.35cathepsin D [Source:ZFIN;Acc:ZDB-GENE-010131-8][more]
ctsd1.396e-11946.35cathepsin D [Source:ZFIN;Acc:ZDB-GENE-010131-8][more]
ctsd1.590e-11946.10cathepsin D [Source:ZFIN;Acc:ZDB-GENE-010131-8][more]
napsa2.438e-11145.29napsin A aspartic peptidase [Source:ZFIN;Acc:ZDB-G... [more]
ren1.019e-9342.78renin [Source:ZFIN;Acc:ZDB-GENE-040630-3][more]
back to top
BLAST of Lysosomal aspartic protease vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000012336.11.597e-12550.53cathepsin D-like [Source:NCBI gene;Acc:613063][more]
ENSXETT00000028662.16.268e-11854.60fatty acid-binding protein, liver [Source:Xenbase;... [more]
ctsd7.459e-11751.19cathepsin D [Source:NCBI gene;Acc:394561][more]
ENSXETT00000013456.11.499e-11653.99cathepsin D-like [Source:NCBI gene;Acc:101733630][more]
ctsd3.635e-11650.65cathepsin D [Source:NCBI gene;Acc:394561][more]
back to top
BLAST of Lysosomal aspartic protease vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ctsd1.415e-12250.26cathepsin D [Source:MGI Symbol;Acc:MGI:88562][more]
Ctsd2.829e-11949.61cathepsin D [Source:MGI Symbol;Acc:MGI:88562][more]
Ctse9.047e-10144.50cathepsin E [Source:MGI Symbol;Acc:MGI:107361][more]
Pgc7.910e-9942.68progastricsin (pepsinogen C) [Source:MGI Symbol;Ac... [more]
Napsa2.893e-9843.19napsin A aspartic peptidase [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Lysosomal aspartic protease vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q03168|ASPP_AEDAE3.348e-14055.41Lysosomal aspartic protease OS=Aedes aegypti OX=71... [more]
sp|Q05744|CATD_CHICK6.244e-12951.71Cathepsin D OS=Gallus gallus OX=9031 GN=CTSD PE=1 ... [more]
sp|P07339|CATD_HUMAN6.918e-12450.90Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 S... [more]
sp|Q4LAL9|CATD_CANLF1.257e-12251.04Cathepsin D OS=Canis lupus familiaris OX=9615 GN=C... [more]
sp|P80209|CATD_BOVIN1.731e-12249.87Cathepsin D OS=Bos taurus OX=9913 GN=CTSD PE=1 SV=... [more]
back to top
BLAST of Lysosomal aspartic protease vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2L2Y4032.063e-14455.53Lysosomal aspartic protease (Fragment) OS=Parastea... [more]
A0A232ETM93.274e-14456.92Peptidase A1 domain-containing protein OS=Trichoma... [more]
A0A2L2Y0H53.854e-14457.84Lysosomal aspartic protease OS=Parasteatoda tepida... [more]
A0A2L2Y4396.205e-14455.28Lysosomal aspartic protease (Fragment) OS=Parastea... [more]
A0A482X3U96.507e-14355.38Peptidase A1 domain-containing protein OS=Laodelph... [more]
back to top
BLAST of Lysosomal aspartic protease vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctsd3.212e-11947.87cathepsin D [Source:ZFIN;Acc:ZDB-GENE-010131-8][more]
ENSAMXT00000045448.19.240e-11452.87cathepsin D-like [Source:NCBI gene;Acc:103032210][more]
ren4.049e-9743.47renin [Source:NCBI gene;Acc:103036504][more]
ren2.634e-9242.63renin [Source:NCBI gene;Acc:103036504][more]
nots6.787e-9239.80cathepsin E-like [Source:NCBI gene;Acc:103036771][more]
back to top
BLAST of Lysosomal aspartic protease vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007388.16.399e-1837.59pep scaffold:Pmarinus_7.0:GL480547:23667:25044:-1 ... [more]
ENSPMAT00000006274.11.021e-1131.79pep scaffold:Pmarinus_7.0:GL484715:1746:11685:1 ge... [more]
back to top
BLAST of Lysosomal aspartic protease vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PEP47.301e-8543.69Vacuolar aspartyl protease (proteinase A); require... [more]
BAR11.296e-1826.23Aspartyl protease; secreted into the periplasmic s... [more]
YPS32.064e-1826.35Aspartic protease; member of the yapsin family of ... [more]
YPS15.374e-1125.67Aspartic protease; hyperglycosylated member of the... [more]
YPS67.860e-1023.24Putative GPI-anchored aspartic protease; member of... [more]
back to top
BLAST of Lysosomal aspartic protease vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO491621.181e-14057.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374182.211e-1631.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393591.540e-1523.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lysosomal aspartic protease vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ctsd5.248e-12548.34cathepsin D [Source:NCBI gene;Acc:111946846][more]
ENSORLT00000000117.25.248e-12548.34cathepsin D [Source:NCBI gene;Acc:101161712][more]
ENSORLT00000016892.26.457e-11848.85cathepsin D [Source:NCBI gene;Acc:101168958][more]
ren3.479e-9541.91renin [Source:NCBI gene;Acc:101168210][more]
nots9.585e-9340.62cathepsin D-like [Source:NCBI gene;Acc:101159061][more]
back to top
BLAST of Lysosomal aspartic protease vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000035344.10.000e+099.74SMESG000035344.1[more]
SMESG000037819.11.275e-826.60SMESG000037819.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014243 ID=SMED30014243|Name=Lysosomal aspartic protease|organism=Schmidtea mediterranea sexual|type=transcript|length=1340bp
TTTAAATTTTCTCTGTGTTGTTTTAAATTGATTGTGTTAATATTCAAGGT
CATATTTACATATTTAATGATAATTTAGAATTTACATATTACACAATTTT
ATAAATATGATGAACATTAAGTTGTTAATTATTGCACTGGTTATCAATGG
AATATTTGGTGGATTGCTTCGAGTTCCACTTAAGAAAATGGAATCCGCAC
GATCCAATATTGTAAAATTCAATATGATGCTGAATCATTTTATGAAAAGT
GAAATAAAGAATCCAATTCCCGAACCTTTAGATAATTATATGGATGCTCA
ATATTTTGGCGAAATCACAATTGGAACTCCTCCTCAACCTTTTACTGTTC
TCTTCGATACAGGATCGTCTAATTTGTGGGTTCCATCAAAGAAATGCAAG
TTGACTAATTTGGCTTGTTTAACCCATCGCAAATATGATAGCTCAAAATC
TTCGACATATGTTAAAAATGGAACCGCATTTTCCATTCGATACGGCACTG
GCAGTCTCAGTGGGTTTCTATCTACAGATACAGTCATTGTAGCAACCGCA
AAAGTTGTCAGTCAGACATTTGGGGAAGCTATGGTAGAACCAGGCACAAC
TTTCGTCGTCGCAAAATTCGATGGAATTTTAGGAATGGCATATCCGTCGA
TTTCTGTCGATCATGTTACTCCGGTTTTTCAAAATATGGTTGCCCAAAAG
CTAGTTGATGCTCCTATATTTTCTTTCTATTTAAATAGAGATGTCAATGG
CAAGCCAGGAGGAGAGATAATATTCGGTGGAAGTGATCCGAATTATTATC
AAGGTCCATTCACATATACACCAGTGACATCTAAAACCTATTGGCAATTC
TCAATGCAAAGTATATCGATGCTTGGTAAGACATATTGCACCAACTGTAC
GGCCATTGCCGATACTGGAACATCTTTGATTGTTGGACCCCAATCTATTA
TCGATGATATCAATTCCAAGTTTAACGGCACCAAGATCAATGGAATGACC
ATTATTCTCTGTAGCAGCGTCAGTAAACTTCCTGTAATCAACATCCAAAT
AGCGGGGCGCAATTTCCCACTGAAGCCGTCTGATTATATTCTTAAACTTC
AAGATACAGTCTGCGTTAGTGGTTTCACGTCGTTAAGCGGGATTCCTTTT
TTCATTCTCGGTGATGTTTTTATCGGTCGGTATTATACGGAATTCGATTT
GGGAAATAGTCGAATAGGTTTCGCTCCAGTGAAAACCCCAAGTAAAGATG
AAACTCTTTATTACAAACCACTTTTCTAATTTCCTTGCGTTGGACATGAT
TTGAACGACCTGATTTTTAATTTTGATAAATGTGATTGAT
back to top

protein sequence of SMED30014243-orf-1

>SMED30014243-orf-1 ID=SMED30014243-orf-1|Name=SMED30014243-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=391bp
MMNIKLLIIALVINGIFGGLLRVPLKKMESARSNIVKFNMMLNHFMKSEI
KNPIPEPLDNYMDAQYFGEITIGTPPQPFTVLFDTGSSNLWVPSKKCKLT
NLACLTHRKYDSSKSSTYVKNGTAFSIRYGTGSLSGFLSTDTVIVATAKV
VSQTFGEAMVEPGTTFVVAKFDGILGMAYPSISVDHVTPVFQNMVAQKLV
DAPIFSFYLNRDVNGKPGGEIIFGGSDPNYYQGPFTYTPVTSKTYWQFSM
QSISMLGKTYCTNCTAIADTGTSLIVGPQSIIDDINSKFNGTKINGMTII
LCSSVSKLPVINIQIAGRNFPLKPSDYILKLQDTVCVSGFTSLSGIPFFI
LGDVFIGRYYTEFDLGNSRIGFAPVKTPSKDETLYYKPLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001461Aspartic_peptidase_A1
IPR021109Peptidase_aspartic_dom_sf
IPR012848Aspartic_peptidase_N
IPR033121PEPTIDASE_A1
IPR001969Aspartic_peptidase_AS
Vocabulary: molecular function
TermDefinition
GO:0004190aspartic-type endopeptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: cellular component
TermDefinition
GO:0005764lysosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001461Aspartic peptidase A1 familyPRINTSPR00792PEPSINcoord: 71..91
score: 71.22
coord: 265..276
score: 62.69
coord: 348..363
score: 55.37
coord: 218..231
score: 44.95
IPR001461Aspartic peptidase A1 familyPANTHERPTHR13683ASPARTYL PROTEASEScoord: 43..373
IPR021109Aspartic peptidase domain superfamilyGENE3DG3DSA:2.40.70.10coord: 20..224
e-value: 1.1E-69
score: 236.5
IPR021109Aspartic peptidase domain superfamilyGENE3DG3DSA:2.40.70.10coord: 228..376
e-value: 8.3E-45
score: 154.3
IPR021109Aspartic peptidase domain superfamilySUPERFAMILYSSF50630Acid proteasescoord: 8..375
IPR033121Peptidase family A1 domainPFAMPF00026Aspcoord: 64..374
e-value: 6.0E-116
score: 387.3
IPR033121Peptidase family A1 domainPROSITEPS51767PEPTIDASE_A1coord: 65..372
score: 76.016
IPR012848Aspartic peptidase, N-terminalPFAMPF07966A1_Propeptidecoord: 19..46
e-value: 2.1E-4
score: 21.1
NoneNo IPR availablePANTHERPTHR13683:SF230CATHEPSIN Dcoord: 43..373
NoneNo IPR availableTMHMMTMhelixcoord: 334..356
NoneNo IPR availableTMHMMTMhelixcoord: 5..24
IPR001969Aspartic peptidase, active sitePROSITEPS00141ASP_PROTEASEcoord: 80..91
IPR001969Aspartic peptidase, active sitePROSITEPS00141ASP_PROTEASEcoord: 265..276