60S ribosomal protein L6

Overview
Name60S ribosomal protein L6
Smed IDSMED30014228
Length (bp)1222
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 60S ribosomal protein L6 (SMED30014228) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 60S ribosomal protein L6 (SMED30014228) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014228

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30014228h1SMcG0005281 dd_Smed_v4_10396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014228h1SMcG0005281 dd_Smed_v4_10396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014228h1SMcG0005281 dd_Smed_v4_10396_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014228h1SMcG0005281 dd_Smed_v6_10396_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30014228h1SMcG0005281 dd_Smed_v4_10396_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A1I8I3J0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017071g2 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.738e-10
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 3
Query:  120 FEDAFYQLDQDRDGVITIQDLERYSTEKNLKDKFIQKWLNLF-ADEKNVIYYDNFCSTLGIVPAKEKFENKIYKIDMTNE 356
            F  AF  +D D  G I++++LE Y  + N KD F++KWLNLF  DE   I YD +C+TLG++P +E  E   +K+  T +
Sbjct:    7 FHQAFQAIDTDHSGEISVEELEDYCKKMNYKDTFVKKWLNLFDEDESGTITYDEYCNTLGLIPKQEVVEK--HKVQQTKQ 84          
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A1I8HCC1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017071g1 PE=4 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 4.959e-10
Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 3
Query:  120 FEDAFYQLDQDRDGVITIQDLERYSTEKNLKDKFIQKWLNLF-ADEKNVIYYDNFCSTLGIVPAKEKFENKIYKIDMTNE 356
            F  AF  +D D  G I++++LE Y  + N KD F++KWLNLF  DE   I YD +C+TLG++P +E  E   +K+  T +
Sbjct:    7 FHQAFQAIDTDHSGEISVEELEDYCKKMNYKDTFVKKWLNLFDEDESGTITYDEYCNTLGLIPKQEVVEK--HKVQQTKQ 84          
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A4E0R6U0 (Putative tegumental protein OS=Fasciola hepatica OX=6192 GN=D915_005062 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.789e-10
Identity = 47/176 (26.70%), Postives = 82/176 (46.59%), Query Frame = 3
Query:  105 IMNDAFEDAFYQLDQDRDGVITIQDLERYSTEKNLKDKFIQKWLNLF-ADEKNVIYYDNFCSTLGI-------VPAKEKFENKIYKIDMTNETHKSITDIISKLLDENDEISENTLEKIKNQVEYDNGSQWNIKL-----NPSQEDLKVQYAEDG-----LLYYSPQSNDDKRILI 578
            +  D F  AF  +D+D DGVI I+DLE Y+    +   F+QKW  LF  +    I ++NFCSTLG+          + + E K+Y+ +M+ E+      +I +  + ND   ++++     +++   G +W  +      NP      + Y+ D      +LY  P+   +K    
Sbjct:    1 MSQDTFLSAFENIDRDHDGVIHIRDLEEYAKNDGVSPDFVQKWKLLFDPNNTGQITFENFCSTLGVSKKVRDSAERRRRPEPKVYESNMSLESVDHCLQVIKRNYNHND--PDSSIHVTLTEMDGSLGPRWQARAVKLSENPKPAGEYLTYSLDNGEHKYVLYREPEKRRNKCCCC 174          
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A504X7T8 (Putative tegumental protein OS=Fasciola gigantica OX=46835 GN=FGIG_08761 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 7.406e-10
Identity = 47/176 (26.70%), Postives = 83/176 (47.16%), Query Frame = 3
Query:  105 IMNDAFEDAFYQLDQDRDGVITIQDLERYSTEKNLKDKFIQKWLNLF-ADEKNVIYYDNFCSTLGI-------VPAKEKFENKIYKIDMTNETHKSITDIISKLLDENDEISENTLEKIKNQVEYDNGSQWNIKL-----NPSQEDLKVQYAEDG-----LLYYSPQSNDDKRILI 578
            +  + F  AF  +D+D DGVI IQDLE Y+    +   F+QKW  LF  +    I ++NFCSTLG+          + + E K+Y+ +M+ E+ +    +I +  + ND   ++++     +++   G +W  +      NP      + Y+ D      +LY  P+   +K    
Sbjct:    1 MSQNTFLSAFENIDRDHDGVIHIQDLEEYAKNDGVSPDFVQKWKLLFDPNNTGQITFENFCSTLGVSKKVRDSAERRRRPEPKVYESNMSMESVEHCLQVIKRNYNYND--PDSSIHVTLTEMDGSLGPRWQARAVKLSENPKPAGEYLTYSLDNGEHKYVLYREPEKRRNKCCCC 174          
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Match: A0A448XI69 (Uncharacterized protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS30542 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 2.570e-9
Identity = 26/64 (40.62%), Postives = 44/64 (68.75%), Query Frame = 3
Query:  120 FEDAFYQLDQDRDGVITIQDLERYSTEKNLKDKFIQKWLNLFADEKNV-IYYDNFCSTLGIVPA 308
            F+ AF+++D D  G IT+++L  Y  + + ++ F+ KW+ LF  EK   I Y+++CSTLG++PA
Sbjct:    4 FQRAFFEIDTDASGSITVEELRAYMEKMHYRETFVTKWVQLFDPEKTGEITYESYCSTLGLIPA 67          
BLAST of 60S ribosomal protein L6 vs. Planmine SMEST
Match: SMESG000050581.1 (SMESG000050581.1)

HSP 1 Score: 508.449 bits (1308), Expect = 1.122e-179
Identity = 283/355 (79.72%), Postives = 311/355 (87.61%), Query Frame = 3
Query:  108 MNDAFEDAFYQLDQDRDGVITIQDLERYSTEKNLKDKFIQKWLNLFADEKNVIYYDNFCSTLGIVPAKEKFENKIYKIDMTNETHKSITDIISKLLDENDEISENTLEKIKNQVEYDNGSQWNIKLNPSQEDLKVQYAEDGLLYYSPQSNDDKRILIWKVENELEDPYEIYQXXXXXXXXXXXXXXXSEFKVKDKNLSKNTLDQITNKIANKTDGKWDIKINPNYESLSVKYSEDGILYYNPDNKDDLKILVWKISEELEDNNAV-IYDCDMTENIKTEILKLVHEKT-NENVVDNES---IISELDKRFGETWNMQLNPTAKQLKVDYDLDGKIYFSPNSIEQPKIFIWRQDKD 1157
            MNDAFEDAFYQLDQDRDGVITIQDLERYSTEKNLKDKFIQKWLNLFADEKNVIYYDNFCSTLGIVPAKEKFENKIYKIDMTNETHKSITDIISKLLDENDEISENTLEKIKNQVEYDNGSQWNIKLNPSQEDLKVQYAEDGLLYYSP+SNDDKRILIWKVENELEDPYEIYQIDMTDKTKTTVIDIISEFKVKDKNLSKNTLDQITNKI+NKTDGKWDIKINPNYESLSVKYSEDGILYYNPDN+DDLKILVWKISEELED +   I+  DMT+  K  I++++++   +EN +  +S   I  E+  + G  W+++L+P+ + L   Y  DG +  S N+    +I +W+  KD
Sbjct:    1 MNDAFEDAFYQLDQDRDGVITIQDLERYSTEKNLKDKFIQKWLNLFADEKNVIYYDNFCSTLGIVPAKEKFENKIYKIDMTNETHKSITDIISKLLDENDEISENTLEKIKNQVEYDNGSQWNIKLNPSQEDLKVQYAEDGLLYYSPRSNDDKRILIWKVENELEDPYEIYQIDMTDKTKTTVIDIISEFKVKDKNLSKNTLDQITNKISNKTDGKWDIKINPNYESLSVKYSEDGILYYNPDNEDDLKILVWKISEELEDKDKFKIHVIDMTDKTKNSIMEILNKFVDDENDLSKDSLENIKKEIANQVGGDWDIKLDPSQRDLSTKYAEDGLVCLSRNNSNDLRILVWKVPKD 355          

HSP 2 Score: 352.058 bits (902), Expect = 3.924e-118
Identity = 182/290 (62.76%), Postives = 238/290 (82.07%), Query Frame = 3
Query:  330 IYKIDMTNETHKSITDIISKLLDENDEISENTLEKIKNQVEYDNGSQWNIKLNPSQEDLKVQYAEDGLLYYSPQSNDDKRILIWKVENELEDP--YEIYQXXXXXXXXXXXXXXXSEFKVKDKNLSKNTLDQITNKIANKTDGKWDIKINPNYESLSVKYSEDGILYYNPDNKDDLKILVWKISEELEDNNAVIYDCDMTENIKTEILKLVHEKTNENVVDNESIISELDKRFGETWNMQLNPTAKQLKVDYDLDGKIYFSPNSIEQPKIFIWRQDKDKKRGSLCCCGCF 1193
            IY+IDMT++T  ++ DIIS+   ++  +S+NTL++I N++      +W+IK+NP+ E L V+Y+EDG+LYY+P + DD +IL+WK+  ELED   ++I+ IDMTDKTK ++++I+++F   + +LSK++L+ I  +IAN+  G WDIK++P+   LS KY+EDG++  + +N +DL+ILVWK+ ++    NAVIYDCDMTENIKTEILKLVHEKTNENVVDNESIISELDKRFGETWNMQLNPTAKQLKVDYDLDGKIYFSPNS EQPKIFIWRQDKDKKRGSLCCCGCF
Sbjct:  170 IYQIDMTDKTKTTVIDIISEFKVKDKNLSKNTLDQITNKISNKTDGKWDIKINPNYESLSVKYSEDGILYYNPDNEDDLKILVWKISEELEDKDKFKIHVIDMTDKTKNSIMEILNKFVDDENDLSKDSLENIKKEIANQVGGDWDIKLDPSQRDLSTKYAEDGLVCLSRNNSNDLRILVWKVPKDPSITNAVIYDCDMTENIKTEILKLVHEKTNENVVDNESIISELDKRFGETWNMQLNPTAKQLKVDYDLDGKIYFSPNSTEQPKIFIWRQDKDKKRGSLCCCGCF 459          
BLAST of 60S ribosomal protein L6 vs. Planmine SMEST
Match: SMESG000017253.1 (SMESG000017253.1)

HSP 1 Score: 109.383 bits (272), Expect = 4.326e-28
Identity = 60/169 (35.50%), Postives = 95/169 (56.21%), Query Frame = 3
Query:  114 DAFEDAFYQLDQDRDGVITIQDLERYSTEKNLKDKFIQKWLNLF-ADEKNVIYYDNFCSTLGIVPAKEKFENK--------IYK-IDMTNETHKSITDIISKLLDENDEISENTLEKIKNQVEYDNGSQWNIKLNPSQEDLKVQYAEDGLLYYSPQSNDDKRILIWKVE 590
            D F  AF+Q+D D DG+I   DL  Y  E NLK  F +KWL+LF  D   +I+Y+ FC  LGI  +K ++ N         ++K  DM+N T  +I   I +       + E+ ++ I  ++  D+G  WN+ +NP+++++K  Y  DG LYYSP      ++L+W++E
Sbjct:    2 DGFVSAFHQVDVDDDGIINEDDLNHYCEENNLKRNFTEKWLSLFDHDNDKIIHYEEFCRALGI-ESKRRYSNASAGNDDIVVFKETDMSNATKDAIIRKIYRKGKHEYNLKEDNIKDIIEELNMDHGPNWNVIVNPTEKEVKCCYDFDGKLYYSPNVKGKNKLLVWRIE 169          

HSP 2 Score: 74.3294 bits (181), Expect = 1.984e-15
Identity = 39/106 (36.79%), Postives = 61/106 (57.55%), Query Frame = 3
Query:  888 DNNAVIYDCDMTENIKTEILKLVHEKTN-------ENVVDNESIISELDKRFGETWNMQLNPTAKQLKVDYDLDGKIYFSPNSIEQPKIFIWRQDKDKKRGSLCCC 1184
            D+  V  + DM+   K  I++ ++ K         +N+ D   II EL+   G  WN+ +NPT K++K  YD DGK+Y+SPN   + K+ +WR ++ KK+G  CCC
Sbjct:   78 DDIVVFKETDMSNATKDAIIRKIYRKGKHEYNLKEDNIKD---IIEELNMDHGPNWNVIVNPTEKEVKCCYDFDGKLYYSPNVKGKNKLLVWRIEEKKKKGLACCC 180          
BLAST of 60S ribosomal protein L6 vs. Planmine SMEST
Match: SMESG000017253.1 (SMESG000017253.1)

HSP 1 Score: 109.383 bits (272), Expect = 4.469e-28
Identity = 60/169 (35.50%), Postives = 95/169 (56.21%), Query Frame = 3
Query:  114 DAFEDAFYQLDQDRDGVITIQDLERYSTEKNLKDKFIQKWLNLF-ADEKNVIYYDNFCSTLGIVPAKEKFENK--------IYK-IDMTNETHKSITDIISKLLDENDEISENTLEKIKNQVEYDNGSQWNIKLNPSQEDLKVQYAEDGLLYYSPQSNDDKRILIWKVE 590
            D F  AF+Q+D D DG+I   DL  Y  E NLK  F +KWL+LF  D   +I+Y+ FC  LGI  +K ++ N         ++K  DM+N T  +I   I +       + E+ ++ I  ++  D+G  WN+ +NP+++++K  Y  DG LYYSP      ++L+W++E
Sbjct:    4 DGFVSAFHQVDVDDDGIINEDDLNHYCEENNLKRNFTEKWLSLFDHDNDKIIHYEEFCRALGI-ESKRRYSNASAGNDDIVVFKETDMSNATKDAIIRKIYRKGKHEYNLKEDNIKDIIEELNMDHGPNWNVIVNPTEKEVKCCYDFDGKLYYSPNVKGKNKLLVWRIE 171          

HSP 2 Score: 74.3294 bits (181), Expect = 2.048e-15
Identity = 39/106 (36.79%), Postives = 61/106 (57.55%), Query Frame = 3
Query:  888 DNNAVIYDCDMTENIKTEILKLVHEKTN-------ENVVDNESIISELDKRFGETWNMQLNPTAKQLKVDYDLDGKIYFSPNSIEQPKIFIWRQDKDKKRGSLCCC 1184
            D+  V  + DM+   K  I++ ++ K         +N+ D   II EL+   G  WN+ +NPT K++K  YD DGK+Y+SPN   + K+ +WR ++ KK+G  CCC
Sbjct:   80 DDIVVFKETDMSNATKDAIIRKIYRKGKHEYNLKEDNIKD---IIEELNMDHGPNWNVIVNPTEKEVKCCYDFDGKLYYSPNVKGKNKLLVWRIEEKKKKGLACCC 182          
BLAST of 60S ribosomal protein L6 vs. Planmine SMEST
Match: SMESG000026622.1 (SMESG000026622.1)

HSP 1 Score: 60.8474 bits (146), Expect = 9.226e-11
Identity = 30/80 (37.50%), Postives = 50/80 (62.50%), Query Frame = 3
Query:  114 DAFEDAFYQLDQDRDGVITIQDLERYSTEKNLKDKFIQKWLNLF-ADEKNVIYYDNFCSTLGIVPAKEKFENKIYKIDMT 350
            D F  AF+ +D D+   ITI +LE+Y    NLKD F++KW+N+F +++  VI  D +CS LG+V  + +   + + I+ +
Sbjct:    2 DNFLTAFFNIDSDQSEEITIAELEKYMRLNNLKDAFVKKWINIFDSNDDGVITLDEYCSVLGLVTNEARIMREQFNIEHS 81          
BLAST of 60S ribosomal protein L6 vs. Planmine SMEST
Match: SMESG000019835.1 (SMESG000019835.1)

HSP 1 Score: 62.003 bits (149), Expect = 1.660e-10
Identity = 27/63 (42.86%), Postives = 40/63 (63.49%), Query Frame = 3
Query:  120 FEDAFYQLDQDRDGVITIQDLERYSTEKNLKDKFIQKWLNLF-ADEKNVIYYDNFCSTLGIVP 305
            F  AF  +D+D  G IT+ +L+ Y  + N KD F+ KWL LF +++   I Y ++C TLG+VP
Sbjct:    4 FHKAFEAIDEDGSGEITVDELQHYMIKNNYKDSFVSKWLTLFDSNQSGKITYKHYCDTLGLVP 66          
The following BLAST results are available for this feature:
BLAST of 60S ribosomal protein L6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I3J04.738e-1042.50Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HCC14.959e-1042.50Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4E0R6U06.789e-1026.70Putative tegumental protein OS=Fasciola hepatica O... [more]
A0A504X7T87.406e-1026.70Putative tegumental protein OS=Fasciola gigantica ... [more]
A0A448XI692.570e-940.63Uncharacterized protein OS=Protopolystoma xenopodi... [more]
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 60S ribosomal protein L6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050581.11.122e-17979.72SMESG000050581.1[more]
SMESG000017253.14.326e-2835.50SMESG000017253.1[more]
SMESG000017253.14.469e-2835.50SMESG000017253.1[more]
SMESG000026622.19.226e-1137.50SMESG000026622.1[more]
SMESG000019835.11.660e-1042.86SMESG000019835.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014228 ID=SMED30014228|Name=60S ribosomal protein L6|organism=Schmidtea mediterranea sexual|type=transcript|length=1222bp
CGCATTAACGAATTGTTATTATAAATTTTCAACTGCCAGAAATTTTGAAA
CACATTTTTCGAGCTGTTTATTTAATTTTTTTTTGTTTTTTAAAATAATC
TATAATAATGAATGATGCTTTTGAAGATGCTTTTTATCAATTGGACCAAG
ACCGTGATGGAGTAATTACAATTCAGGATTTGGAAAGATATTCTACAGAA
AAGAATTTAAAAGACAAATTTATTCAGAAATGGCTGAATTTATTTGCAGA
CGAAAAAAATGTCATTTATTATGATAACTTCTGCAGTACTCTTGGAATCG
TCCCAGCTAAAGAAAAATTTGAGAACAAAATATATAAAATTGACATGACA
AATGAAACTCACAAGTCAATTACAGATATTATTTCAAAATTGCTTGATGA
AAATGATGAAATTAGCGAAAATACATTAGAAAAAATCAAAAATCAAGTGG
AGTATGATAATGGCAGTCAATGGAACATCAAATTGAATCCTTCTCAAGAA
GATCTGAAGGTTCAATATGCTGAAGACGGGTTACTATATTACAGTCCACA
GTCAAATGATGACAAAAGAATTTTAATTTGGAAGGTGGAAAATGAACTAG
AAGATCCGTATGAGATATATCAAATAGATATGACAGATAAAACTAAAACG
ACCGTGATTGATATTATATCGGAATTCAAAGTAAAAGATAAAAATCTCTC
GAAAAACACTCTAGATCAAATAACAAATAAAATAGCAAACAAAACCGATG
GCAAATGGGATATTAAAATAAATCCGAATTATGAAAGCCTCAGTGTAAAA
TATAGCGAAGACGGTATTTTGTATTATAATCCAGATAATAAAGATGATTT
AAAGATTTTGGTTTGGAAAATCTCAGAGGAACTCGAAGACAACAATGCCG
TTATATACGACTGTGACATGACCGAAAACATTAAAACAGAAATCTTAAAG
TTAGTGCATGAGAAAACGAACGAAAACGTTGTGGACAATGAGTCTATTAT
TTCGGAACTTGATAAAAGGTTTGGAGAAACTTGGAACATGCAACTTAATC
CAACTGCAAAACAATTAAAAGTTGATTATGATTTGGACGGAAAAATTTAC
TTTTCACCAAATTCGATAGAGCAACCAAAAATATTCATCTGGAGACAAGA
TAAAGATAAAAAAAGAGGATCTTTGTGTTGTTGTGGTTGTTTTTGACATG
AAACTGAAAAGATATTTGTGTG
back to top

protein sequence of SMED30014228-orf-1

>SMED30014228-orf-1 ID=SMED30014228-orf-1|Name=SMED30014228-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=363bp
MNDAFEDAFYQLDQDRDGVITIQDLERYSTEKNLKDKFIQKWLNLFADEK
NVIYYDNFCSTLGIVPAKEKFENKIYKIDMTNETHKSITDIISKLLDEND
EISENTLEKIKNQVEYDNGSQWNIKLNPSQEDLKVQYAEDGLLYYSPQSN
DDKRILIWKVENELEDPYEIYQIDMTDKTKTTVIDIISEFKVKDKNLSKN
TLDQITNKIANKTDGKWDIKINPNYESLSVKYSEDGILYYNPDNKDDLKI
LVWKISEELEDNNAVIYDCDMTENIKTEILKLVHEKTNENVVDNESIISE
LDKRFGETWNMQLNPTAKQLKVDYDLDGKIYFSPNSIEQPKIFIWRQDKD
KKRGSLCCCGCF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
GO:0030286dynein complex
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0007017microtubule-based process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001372Dynein_light_chain_typ-1/2
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
IPR002048EF_hand_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 1..139
e-value: 5.1E-6
score: 28.1
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 13..25
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 1..35
score: 8.99
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 4..66