cilia- and flagella-associated protein 99

Overview
Namecilia- and flagella-associated protein 99
Smed IDSMED30014219
Length (bp)2115
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cilia- and flagella-associated protein 99 (SMED30014219) t-SNE clustered cells

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 99 (SMED30014219) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cilia- and flagella-associated protein 99 (SMED30014219) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cilia- and flagella-associated protein 99 (SMED30014219) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014219

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30014219SMESG000025927.1 SmedASXL_009792SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30014219SMESG000025927.1 dd_Smed_v4_8538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014219SMESG000025927.1 dd_Smed_v4_8538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014219SMESG000025927.1 dd_Smed_v4_8538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014219SMESG000025927.1 dd_Smed_v4_8538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30014219SMESG000025927.1 dd_Smed_v4_8538_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30014219SMESG000025927.1 dd_Smed_v6_8538_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30014219SMESG000025927.1 dd_Smed_v4_8538_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Human
Match: CFAP99 (cilia and flagella associated protein 99 [Source:HGNC Symbol;Acc:HGNC:51180])

HSP 1 Score: 219.935 bits (559), Expect = 9.750e-62
Identity = 173/563 (30.73%), Postives = 307/563 (54.53%), Query Frame = 1
Query:   76 MSLYEKKLNHCVEILNTFPKDCKSLTIHVEDYFKNLN-ISEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNK--PTKTRKAIPNTKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTYIVSDFKPKQ----------DKKDPYFLMKEADRLQPACAQ----REISQKTLEKLN-QIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERA-KALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNL 1707
            M+ Y K +   +E L+ F     +    +E    +L  +S + + F+++V +  ++Y+K+L +V++ FY  DGR     + + + V+ +L  F LEE+GF+ F + +++Q +  M KFL F  +  +L +WI+ EW  +Y+   V+   ++ L +  P+++  +  ++ +  ++  P KT+  +  T+P  F+L  P+P+ IP PE +P + K + +P +TY      PK+          +++    L+  A+  +  CA     RE  Q + ++L  Q      K  K   Y+    P N       +K NT  ILRE  LY+ ++ ++ Q + KL +GA +  +F  WQ+ +++ D  E+++  E  +L GK+S+EEA+L R  L+QENK+ V+  K++ AK + +   E+ L E+R+ K LVEQVI  Q+  K A+  + K +Q   +E  EESR L +     A+ E RR+ ++I+++RALE   +   K++D T+I GYGL  EMS+ EL+ERL L K+       +KR+ I   K  K +++    E + +CR+ +
Sbjct:    1 MAYYGKCIETVIEQLDKFTPKRDNPEQFLEAAATSLQALSPQKQSFVLEVLSGCLEYRKLLTVVVDAFYVEDGRLCLRVDHSRFEVICYLATFLLEELGFQLFCNIIKSQPVDKMCKFLRFFFNPLHLCSWIKDEWSLIYEPAHVKENWIDPLMRWQPEVQELINHLEGVSASQSSPLKTKAKV--TEPKEFNLTAPRPRTIPAPEPVPVVAKPRPVPQSTYQ----PPKEQQQLETVKRYNRRKAEELLLRANIEELRCAMPRSCRERVQGSKQQLRLQFPPRIRKTPKLTFYR----PDNIL-----VKLNTTAILREGALYQRQVEQELQRVDKLVDGAGDFSEFFEWQKKMQAKDREEQLAASECRRLQGKLSHEEAVLARQSLMQENKQRVEQQKEQMAKLMLQR-AERRLREDRSRKELVEQVIEGQKNAKAAQTKLAKGRQQTVQEAIEESRGLLQRRAQAAQEEQRRRCELISQLRALETQPTRKGKLVDLTQIPGYGLEGEMSIVELRERLALLKENQRRKEEEKRDQIIQGKHTKSQELQNMVEQISLCRAAM 547          
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Human
Match: CFAP99 (cilia and flagella associated protein 99 [Source:HGNC Symbol;Acc:HGNC:51180])

HSP 1 Score: 219.164 bits (557), Expect = 5.588e-61
Identity = 173/563 (30.73%), Postives = 307/563 (54.53%), Query Frame = 1
Query:   76 MSLYEKKLNHCVEILNTFPKDCKSLTIHVEDYFKNLN-ISEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNK--PTKTRKAIPNTKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTYIVSDFKPKQ----------DKKDPYFLMKEADRLQPACAQ----REISQKTLEKLN-QIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERA-KALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNL 1707
            M+ Y K +   +E L+ F     +    +E    +L  +S + + F+++V +  ++Y+K+L +V++ FY  DGR     + + + V+ +L  F LEE+GF+ F + +++Q +  M KFL F  +  +L +WI+ EW  +Y+   V+   ++ L +  P+++  +  ++ +  ++  P KT+  +  T+P  F+L  P+P+ IP PE +P + K + +P +TY      PK+          +++    L+  A+  +  CA     RE  Q + ++L  Q      K  K   Y+    P N       +K NT  ILRE  LY+ ++ ++ Q + KL +GA +  +F  WQ+ +++ D  E+++  E  +L GK+S+EEA+L R  L+QENK+ V+  K++ AK + +   E+ L E+R+ K LVEQVI  Q+  K A+  + K +Q   +E  EESR L +     A+ E RR+ ++I+++RALE   +   K++D T+I GYGL  EMS+ EL+ERL L K+       +KR+ I   K  K +++    E + +CR+ +
Sbjct:    1 MAYYGKCIETVIEQLDKFTPKRDNPEQFLEAAATSLQALSPQKQSFVLEVLSGCLEYRKLLTVVVDAFYVEDGRLCLRVDHSRFEVICYLATFLLEELGFQLFCNIIKSQPVDKMCKFLRFFFNPLHLCSWIKDEWSLIYEPAHVKENWIDPLMRWQPEVQELINHLEGVSASQSSPLKTKAKV--TEPKEFNLTAPRPRTIPAPEPVPVVAKPRPVPQSTYQ----PPKEQQQLETVKRYNRRKAEELLLRANIEELRCAMPRSCRERVQGSKQQLRLQFPPRIRKTPKLTFYR----PDNIL-----VKLNTTAILREGALYQRQVEQELQRVDKLVDGAGDFSEFFEWQKKMQAKDREEQLAASECRRLQGKLSHEEAVLARQSLMQENKQRVEQQKEQMAKLMLQR-AERRLREDRSRKELVEQVIEGQKNAKAAQTKLAKGRQQTVQEAIEESRGLLQRRAQAAQEEQRRRCELISQLRALETQPTRKGKLVDLTQIPGYGLEGEMSIVELRERLALLKENQRRKEEEKRDQIIQGKHTKSQELQNMVEQISLCRAAM 547          
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Zebrafish
Match: cfap99 (cilia and flagella associated protein 99 [Source:ZFIN;Acc:ZDB-GENE-161107-1])

HSP 1 Score: 284.648 bits (727), Expect = 5.904e-86
Identity = 184/557 (33.03%), Postives = 326/557 (58.53%), Query Frame = 1
Query:   85 YEKKLNHCVEILNTFPKDCKSLTIHVEDYFKNLNI-SEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPNTKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTY-------IVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNLQEKETYKA 1731
            Y++ +N     L+ F +D + +    ED  KNL   S  D+ FI++     I ++K+L +V+N FY   G+NIF  ++N++ V+ +L +F L+++G E F   +++     M+KFL+F  + NNL T I+ EW  +YD+  V+   +  L     ++   ++++   +       R    NT+P  FDL KPK + +P PE+IP+ +K K +P++T+       I+ D + + ++   +  + EA+  Q  CA  + S+KT   +++I+ +RE +LKF++  +  +P      S  ++ NT  ILRE  LY  ++  + Q L++L +GA     F  WQ+ ++  DL E++++LE+ +L G+ISYEEA+L R+R+++ N+   Q  K+E A+ ++K+ +++   E+  + LV+QV    +  K AK  +Q+ KQ I +E++E+SR L  + L EA+AE+ RK+++I +IRA E      QK +D TE AG+ LLCEMSLAEL+ERL L ++  + ++  +R+ I   KQ K++ + E  + + + R NL E+   ++
Sbjct:    3 YKELVNEVARFLDEFQEDKQCIDSFTEDTAKNLQTRSSADQKFIINTLYGCIMHKKLLNVVVNIFYLHHGKNIFRVDRNLFTVVCYLAMFCLDDLGLEHFSRIIKSLDNAKMHKFLSFFFNVNNLTTHIQKEWSHIYDAAIVDENWITPLLSWCSEMEMLLDQLTIKMGMGSVPKRSPRKNTEPKEFDLTKPKARPLPAPEVIPQQDKPKPVPASTHRSPKEPEILDDLR-QMNRLKAFQTLNEANSQQFRCANPQKSEKTQNIISEIIKKREAELKFDKTYTSGSPATQKTNSLPVRLNTTAILREGALYNRQLEGELQRLEQLSQGASEPSSFLQWQKEMKEKDLQEELAELERRRLEGRISYEEAVLARERVLKHNRYKAQETKEETAELMRKYAEKRLKEEKEMRELVQQVADGHKSSKAAKARLQEIKQRIVKEVSEQSRELLSQALEEAQAELSRKMELIRQIRAFELVPMVRQKFIDETETAGHDLLCEMSLAELRERLALLRESEQCDLEDRRQRIFQEKQFKEQLLLEQLDNIAL-RRNLAEQAALRS 557          
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Xenopus
Match: CFAP99 (cilia and flagella associated protein 99 [Source:NCBI gene;Acc:100495334])

HSP 1 Score: 209.92 bits (533), Expect = 3.019e-59
Identity = 172/514 (33.46%), Postives = 291/514 (56.61%), Query Frame = 1
Query:  172 FKNLNISEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPNTKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTYIVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISS-QLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEER-AKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNL 1707
            F++LN  ++++ F+      S++Y+ +L  V+  FY  DG++   SE+ ++ V+ +L  F+LEE+G + F   + +Q +  M KFL+F  +  NL TWI+ EW ++YDS +V+   ++ L K  P++    E +++     P++ R +   T+   F+L KP+P+ +P+P+LIP  +  + +P T Y      PK+ +     L+KE              QK                K N  K++ A   + Q  +  +K N A ILRE  LY+ ++ ++ + ++KL +GA +  +F  WQ+ +R  DL ++++++E  +L GK+S EEA+L R  LIQENK+   + KK+  +++ + + EK + EE+  + LVEQV    +  K A+L +QK KQ I +E+ EESR L  + L EAE E+++K ++I EIRA+E       K +D T+ AG+ L CEMSL EL+ERL + K+  ++   +KR  I   KQ KQ+ + +T E + + RS L
Sbjct:   36 FQSLN--DEEERFVGAALCGSVQYRALLDTVVRAFYARDGKHCKQSEQYLFVVIGYLATFQLEELGLQTFVRIITSQDVTKMCKFLSFFFNVVNLNTWIKDEWSQIYDSNYVKENWISHLLKWQPEIHNITEGLQSKTAKGPSRARSS-KTTETKEFNLTKPRPRSLPVPQLIPAQKPHQPVPQTLYKA----PKEQE-----LLKE--------------QK----------------KRNRRKAESACCFSFQADNVPVKLNAAAILREGALYQRQVEEELRRIEKLVDGARDPTEFLEWQRQMREKDLEQQLAEIECRRLEGKLSREEAVLARQNLIQENKKKADI-KKQETEKLMRIYAEKRIQEEKEMRDLVEQVSEGHKNTKQARLKLQKYKQQIVQEVTEESRELLRQALEEAEEELKKKFELIREIRAMESVPFIRHKFVDLTQTAGHRLNCEMSLVELRERLAILKEAEKKAEEEKRNQILIEKQSKQQLLLDTLEQISLHRSAL 506          
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Mouse
Match: Cfap99 (cilia and flagella associated protein 99 [Source:MGI Symbol;Acc:MGI:5434801])

HSP 1 Score: 249.21 bits (635), Expect = 1.246e-72
Identity = 191/567 (33.69%), Postives = 326/567 (57.50%), Query Frame = 1
Query:   76 MSLYEKKLNHCVEILNTFPKDCKSLTIHVEDYFKNL--NISEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNI-LDNKPT-KTRKAIPNTKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTYIVSDFKPKQDK----------KDPYFLMKEADRLQPACA----QREISQKTLEK--LNQIV--IEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERA-KALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNL 1707
            M+ YEK +   ++ L+ F     +    VE  F +L   +S +   F+++V +  ++Y K+L IV++ FY  DG     S+ +++ V+ +L IF+LEE+GF+ F S +++Q ++ M KFL F  +  NL +WI+ EW  +Y++  V    ++ L +  P++++ +++++ +  D  P  KT+  +  T P  F+L  P+P+ I MPE +P ++K + +P +TY     +PK+ K          +    L+ +A+  +  CA    QRE  ++ +EK   +Q V  I R  +L F  YK    P         +K NTATILRE  LY+ ++ K+ Q + KL +GA +  +F  WQ+ +++ DL E+++  E  +L GK+S+EEAIL R  L+QENK+     K+E A+ + +   E+ L EE+A K LVEQV  +Q+ VK+ +  + K +Q I +E+ EESR L +    EA+ E +R+ ++IA +RA+E   +   K++D T+I GYGL  EMS+ EL+ERL + K+  +    +KR+ I  +K+ K + I  T E + +CR+ +
Sbjct:    1 MTYYEKCIEIVIKQLDKFKPGKDNPEQFVETVFTSLQQTLSPQKFGFVLEVLSGCLEYHKLLTIVVDAFYARDGHTCLWSDYSLFEVICYLAIFQLEELGFQLFCSIIKSQPVRKMCKFLRFFFNPLNLSSWIKDEWSLIYETAHVMENWIDPLLRWQPEVQKLIKQLEGVPTDQIPVLKTKAKV--TVPKEFNLTVPRPRAITMPEPVPTMDKPRPVPQSTYK----EPKEQKLLQIIKTCNRRTAEELLLKANMEELQCAMPRVQREPQEQDVEKQLWHQSVPHIRRTPNLTF--YKPNNLP---------VKLNTATILREGALYQRQVEKELQRVDKLVDGAGDFSEFLKWQKKMQAQDLEEQLAAGECRRLQGKLSHEEAILARQNLMQENKQKADRQKEETAELMLQ-CAERRLQEEKAMKELVEQVTEAQKNVKIVQTKLVKGRQQIVQEVIEESRELLQRSAKEAKEEQKRRCELIAHLRAMETQPTRKGKLVDLTQIPGYGLEGEMSVVELRERLAMLKETQKREQEEKRDQIIQDKRAKSQMIQNTVEQISLCRAAM 549          
BLAST of cilia- and flagella-associated protein 99 vs. UniProt/SwissProt
Match: sp|D6REC4|CFA99_HUMAN (Cilia- and flagella-associated protein 99 OS=Homo sapiens OX=9606 GN=CFAP99 PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 2.969e-37
Identity = 95/254 (37.40%), Postives = 155/254 (61.02%), Query Frame = 1
Query:  949 LKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERA-KALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNL 1707
            +K NT  ILRE  LY+ ++ ++ Q + KL +GA +  +F  WQ+ +++ D  E+++  E  +L GK+S+EEA+L R  L+QENK+ V+  K++ AK + +   E+ L E+R+ K LVEQVI  Q+  K A+  + K +Q   +E  EESR L +     A+ E RR+ ++I+++RALE   +   K++D T+I GYGL  EMS+ EL+ERL L K+       +KR+ I   K  K +++    E + +CR+ +
Sbjct:   40 VKLNTTAILREGALYQRQVEQELQRVDKLVDGAGDFSEFFEWQKKMQAKDREEQLAASECRRLQGKLSHEEAVLARQSLMQENKQRVEQQKEQMAKLMLQRA-ERRLREDRSRKELVEQVIEGQKNAKAAQTKLAKGRQQTVQEAIEESRGLLQRRAQAAQEEQRRRCELISQLRALETQPTRKGKLVDLTQIPGYGLEGEMSIVELRERLALLKENQRRKEEEKRDQIIQGKHTKSQELQNMVEQISLCRAAM 292          
BLAST of cilia- and flagella-associated protein 99 vs. UniProt/SwissProt
Match: sp|A8IUG5|CFA99_CHLRE (Cilia- and flagella-associated protein 99 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP99 PE=1 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 4.364e-21
Identity = 154/566 (27.21%), Postives = 264/566 (46.64%), Query Frame = 1
Query:   88 EKKLNHCVEILNTFPKDCKSLTIHVEDYFKNLNISEK-DKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRK--------------AIPNTKPAPFDLHKPKPKRIPM---------------PELIPEIEKVKEIPSTTYIVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKT-LEKLNQ-IVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKAL-VEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEE----MLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIA-GYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAE 1671
            EK +  C +I  +F     +L  HV++    L++    D  FI  V   +++Y+++L  +++ FY  +G      + ++Y +  +L IFRLEE+ F  F+  ++    Q MY  L ++ +   +   +  +W KLYD  FV +E+++     L   +   +EM   L+ K T +RK              A   T P PF+L +PKP+ +P+               P   P  E+V    +     +  + K  K  P+ L             R + + T ++K+ + +  ER ++L F   ++          ++Q++ N A ILRE  LY  +  ++   LK+ E    +   F AWQ ++   D + + + +E+ +     + E AI  R    + N EL +  K+E AKRI++  K     + R  AL  + V+ +++ V+ A   V+K  Q   R  AEE RR Q+E        A  EM  + D+I +++ALE       K  DPTE    +GLL  MSL EL+ERL ++K++  E   ++R  I   KQE++  + E
Sbjct:   43 EKLMAACEKIYKSFNPAQVTLDTHVDNCIGQLSVHNSFDDSFIRQVVYGTVRYRRLLGALMDSFYHYNGGAASREDVDMYKLYSYLTIFRLEELNFSNFQRLVDAMTPQKMYVLLKYMFNPQYMREVVREDWLKLYDKEFV-DEIID----RLLSWKSESKEMLGRLEYKVTLSRKEDDEKETLGTGYAAARSTTVPQPFNLTQPKPRPLPVEDPPPPPIRAKPAPRPREGPTKEEVALAAAREANRAAAERKAAKAAPFKL-------------RVLERPTNIDKIREELEAERTRELTFKGIRAA---PPPPVPNAQVRLNAAAILREDALYRRKQQEEADALKRYEAELRDASSFKAWQNAMLEQDEAARAASVERRRQEMAAAQENAIRARMAAQEANAELARAAKEE-AKRIEEDLKRDREEQARLNALRRDAVVEARQNVQAA---VEKMSQE-RRLAAEEERRKQQEDARARAEVAAREMAERRDIILQLKALEKVPKQRVKEFDPTETGPDHGLLETMSLVELRERLNVAKRRQREEEERQRAEILRQKQERESALLE 582          
BLAST of cilia- and flagella-associated protein 99 vs. TrEMBL
Match: A0A2R2MSK6 (cilia- and flagella-associated protein 99 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106177570 PE=4 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 8.432e-104
Identity = 215/553 (38.88%), Postives = 347/553 (62.75%), Query Frame = 1
Query:   76 MSLYEKKL-NHCVEILNTFPKDCKSLTIHVEDYFKNL-NISEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPNTKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTY-------IVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNL 1707
            MSL  K+L  HCVE+L+TF  + +S+  HV +Y   L NI + D+ FI +VF+  ++Y  +L +V++ FY   G++   SE N+Y VL +L +FRL+E+    ++ ++++Q +  MYKFLNF  D+ NL TWI+ EW KLY+  FV+  L++ L + LP+L+  ++++ + + NK    ++ IP T+P  F+L +P+P+ +PMPE IP++EK K +P TTY       I+ + K    +K    LM E+ R Q ACA  E S KT  +L  I+ E+E  L+F+++K+ P P   S+ +  +K N ATILRE KL++ R  ++ ++L++LE GA +   F  WQQ +R  D+  +++++E+ +L GK+S+E+AIL R  LI++NK+ V  +K+E    ++++ ++K   E+  + LVEQ +   +  K AK  ++  K+ I +++ EES+ L  + L EAEAEMRRK+++I +IRA+E   +   K +D T+ AGYGLL E SLAELKERL L K    E   +KR+ I  +K+ K + +  T E +   RS +
Sbjct:    1 MSLAHKQLLEHCVEVLDTFQPELRSVEQHVNNYMAKLKNIEDSDQTFITEVFSGCVRYDSVLNVVLDGFYIRSGKSSLRSESNLYKVLTYLALFRLDELEVAHYRKFVKSQDVNKMYKFLNFFMDDKNLRTWIKDEWNKLYERPFVQMTLLSPLLRWLPELQEMIQQLADKIANKVKPKKQIIPTTEPKAFNLTQPRPRSVPMPEPIPKLEKHKPVPKTTYQDPKQKRIIEENKVMNRRKAEERLM-ESSRYQFACANPEKSDKTRHRLQSILAEQESKLEFDKHKANPLPNFVSE-NIPIKLNAATILREGKLFQKREEEELRKLERLEAGAKDASDFLRWQQEMRKQDMDRQLAEIEQRRLEGKLSHEDAILARQNLIKDNKQKVTEMKEEAKAIMQEYLEKKFKEEQEMRVLVEQTMEGHQNTKEAKKKLKDYKRKIVQDVNEESKELMRQALEEAEAEMRRKMEIIQQIRAMEAVPAIRVKFVDFTKTAGYGLLSEFSLAELKERLALMKMAEREAEEEKRDEILASKEAKDQLLMNTLETISKHRSEM 551          
BLAST of cilia- and flagella-associated protein 99 vs. TrEMBL
Match: A0A1S3K0F9 (cilia- and flagella-associated protein 99 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106177570 PE=4 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 7.414e-103
Identity = 215/553 (38.88%), Postives = 347/553 (62.75%), Query Frame = 1
Query:   76 MSLYEKKL-NHCVEILNTFPKDCKSLTIHVEDYFKNL-NISEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPNTKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTY-------IVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNL 1707
            MSL  K+L  HCVE+L+TF  + +S+  HV +Y   L NI + D+ FI +VF+  ++Y  +L +V++ FY   G++   SE N+Y VL +L +FRL+E+    ++ ++++Q +  MYKFLNF  D+ NL TWI+ EW KLY+  FV+  L++ L + LP+L+  ++++ + + NK    ++ IP T+P  F+L +P+P+ +PMPE IP++EK K +P TTY       I+ + K    +K    LM E+ R Q ACA  E S KT  +L  I+ E+E  L+F+++K+ P P   S+ +  +K N ATILRE KL++ R  ++ ++L++LE GA +   F  WQQ +R  D+  +++++E+ +L GK+S+E+AIL R  LI++NK+ V  +K+E    ++++ ++K   E+  + LVEQ +   +  K AK  ++  K+ I +++ EES+ L  + L EAEAEMRRK+++I +IRA+E   +   K +D T+ AGYGLL E SLAELKERL L K    E   +KR+ I  +K+ K + +  T E +   RS +
Sbjct:    1 MSLAHKQLLEHCVEVLDTFQPELRSVEQHVNNYMAKLKNIEDSDQTFITEVFSGCVRYDSVLNVVLDGFYIRSGKSSLRSESNLYKVLTYLALFRLDELEVAHYRKFVKSQDVNKMYKFLNFFMDDKNLRTWIKDEWNKLYERPFVQMTLLSPLLRWLPELQEMIQQLADKIANKVKPKKQIIPTTEPKAFNLTQPRPRSVPMPEPIPKLEKHKPVPKTTYQDPKQKRIIEENKVMNRRKAEERLM-ESSRYQFACANPEKSDKTRHRLQSILAEQESKLEFDKHKANPLPNFVSE-NIPIKLNAATILREGKLFQKREEEELRKLERLEAGAKDASDFLRWQQEMRKQDMDRQLAEIEQRRLEGKLSHEDAILARQNLIKDNKQKVTEMKEEAKAIMQEYLEKKFKEEQEMRVLVEQTMEGHQNTKEAKKKLKDYKRKIVQDVNEESKELMRQALEEAEAEMRRKMEIIQQIRAMEAVPAIRVKFVDFTKTAGYGLLSEFSLAELKERLALMKMAEREAEEEKRDEILASKEAKDQLLMNTLETISKHRSEM 551          
BLAST of cilia- and flagella-associated protein 99 vs. TrEMBL
Match: A0A2R2MS83 (cilia- and flagella-associated protein 99 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106177570 PE=4 SV=1)

HSP 1 Score: 337.035 bits (863), Expect = 2.425e-102
Identity = 214/553 (38.70%), Postives = 347/553 (62.75%), Query Frame = 1
Query:   76 MSLYEKKL-NHCVEILNTFPKDCKSLTIHVEDYFKNL-NISEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPNTKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTY-------IVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNL 1707
            MSL  K+L  HCVE+L+TF  + +S+  HV +Y   L NI + D+ FI +VF+  ++Y  +L +V++ FY   G++   SE N+Y VL +L +FRL+E+    ++ ++++Q +  MYKFLNF  D+ NL TWI+ EW KLY+  FV+  L++ L + LP+L+  ++++ + + NK    ++ IP T+P  F+L +P+P+ +PMPE IP++EK K +P TTY       I+ + K    +K    LM E+ R Q ACA  E S KT  +L  I+ E+E  L+F+++K+ P P   S+ +  +K N A+ILRE KL++ R  ++ ++L++LE GA +   F  WQQ +R  D+  +++++E+ +L GK+S+E+AIL R  LI++NK+ V  +K+E    ++++ ++K   E+  + LVEQ +   +  K AK  ++  K+ I +++ EES+ L  + L EAEAEMRRK+++I +IRA+E   +   K +D T+ AGYGLL E SLAELKERL L K    E   +KR+ I  +K+ K + +  T E +   RS +
Sbjct:    1 MSLAHKQLLEHCVEVLDTFQPELRSVEQHVNNYMAKLKNIEDSDQTFITEVFSGCVRYDSVLNVVLDGFYIRSGKSSLRSESNLYKVLTYLALFRLDELEVAHYRKFVKSQDVNKMYKFLNFFMDDKNLRTWIKDEWNKLYERPFVQMTLLSPLLRWLPELQEMIQQLADKIANKVKPKKQIIPTTEPKAFNLTQPRPRSVPMPEPIPKLEKHKPVPKTTYQDPKQKRIIEENKVMNRRKAEERLM-ESSRYQFACANPEKSDKTRHRLQSILAEQESKLEFDKHKANPLPNFVSE-NIPIKLNAASILREGKLFQKREEEELRKLERLEAGAKDASDFLRWQQEMRKQDMDRQLAEIEQRRLEGKLSHEDAILARQNLIKDNKQKVTEMKEEAKAIMQEYLEKKFKEEQEMRVLVEQTMEGHQNTKEAKKKLKDYKRKIVQDVNEESKELMRQALEEAEAEMRRKMEIIQQIRAMEAVPAIRVKFVDFTKTAGYGLLSEFSLAELKERLALMKMAEREAEEEKRDEILASKEAKDQLLMNTLETISKHRSEM 551          
BLAST of cilia- and flagella-associated protein 99 vs. TrEMBL
Match: A0A210PYE8 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17394 PE=4 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 3.169e-97
Identity = 201/553 (36.35%), Postives = 329/553 (59.49%), Query Frame = 1
Query:   73 MMSL-YEKKLNHCVEILNTFPKDCKSLTIHVEDYFKNLNI-SEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPNTKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTY-------IVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISSQL--KTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICR 1698
            M SL + + L H V +L+T+ +D +S+  HV    K   I  E D+ FIV+VF+  ++Y  ++ ++ + F+  DG+N+  SE+N+Y V  +L  FRL+E+G E F+ ++  Q +  MY+FLNF  +E NL TW++  W K Y+  FV+  +++ +++ +P+L+  +  MK  +DNK    RK  P T+  PFD+ +P+P+ IP+PE IP++ K K  P + Y       ++   +    +K    LM EA R+Q ACA  E S KT E  N I+ E +  L F  +++KP P   S +S ++  K NT  ILRE  LY  R  K+ +  + LE GA +  +F+ WQ  +++ DL ++++ +E+ +L GK+S+EEAIL R  L++ NK+ V   ++E  K   +F  +K   E+  + LVEQ +   +  K A   +Q+ K+ I +++ EESR L ++ + EAE+EMRR++++I +IRA+E      QK +D T  +G+GLL EMS+AEL+ER+ L     EE   Q+R+ I  +KQ K +++ +T E +   R
Sbjct:    1 MASLSHGQLLVHAVRVLDTYNRDMQSVEEHVNKCLKAQRIYDEGDQTFIVEVFSNCVRYWDLMKVITDGFFVKDGKNVLRSEENLYIVTSYLAFFRLDELGVEHFRKFVSAQDINKMYRFLNFCLNERNLLTWMKDGWEKFYEHTFVQTGILSPIQRWMPELQEMLTHMKAKIDNKIKPRRKTTPKTETRPFDITQPRPRSIPIPEAIPKLHKHKPPPRSLYDDPEEFDVLKRNRDVNRRKAEERLM-EASRIQFACANPEKSDKTKEIWNNIISEEDGKLDFERHRAKPTP---SFLSKEVPFKMNTTAILREGHLYSQREEKEIKRFENLEAGAKDKSEFEKWQNKMKTQDLEQELAAIERRRLEGKLSHEEAILARQNLMRTNKQKVLNHREETKKMFDEFLHQKFKEEQEMRTLVEQTMQGHKNAKDATKKIQEIKRKIVQDVNEESRELMKQAVEEAESEMRRRMELIHQIRAMEAVPIIRQKFVDLTATSGHGLLSEMSIAELRERMSLLATAEEELEEQRRDDILASKQAKDQKLLDTLETISRHR 549          
BLAST of cilia- and flagella-associated protein 99 vs. TrEMBL
Match: A0A267FQQ8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017297g1 PE=4 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 1.350e-96
Identity = 195/538 (36.25%), Postives = 321/538 (59.67%), Query Frame = 1
Query:   97 LNHCVEILNTFPKDCKSLTIHVEDYFKN-LNISEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPNTKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTYI----VSDFKPKQDKKDPYF--LMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQIS-SQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIV 1686
            L H  EIL++F     ++  H   YF   L   +  +V IV++FA  I+Y+K L  VI  FY  +GR +  SE+N+Y V  +L++FR+EE+G    K  + T + + +Y+FL+F+ +  +L+TW+  EW KLYD ++VENE+++ L++ LP L   +E ++  ++      ++ I  T+P PF L +PKP+ +PMPE +P +   + +PS+TY      +D   ++ K        + EA R +P CA    S+K   K+ +I  E+E+ L F+  KS P PK       + +K N A I+REW  Y     ++ + L  LE GAF+   F+AWQQ+ + ADL  ++++LE+ +L G++SYEEA++ R RL + N+ +V+  ++  A+R ++    +A  EE+ K  + +++A     + A    QK K     E  +E+  L ++   EA AE+RRK+++IAEIRA+E +Q+  +K LD TEIAG+G L EMS+AEL+ERL L+KQ+  + V +KR+ I + KQ K +++  T E++
Sbjct:   14 LQHSQEILDSFRSADMAVDAHANQYFDGVLPRDDPVRVTIVEIFAGCIRYEKALDTVITAFYNVEGRVVKRSEQNLYRVFAYLIVFRMEELGIPNLKKLIATLERKRIYRFLSFLLNRKHLYTWMLDEWAKLYDRVYVENEIISPLEEFLPQLEEILERLRVQIEEGLKSKKELIKPTEPQPFTLTEPKPRSVPMPEELPTLAPSRPVPSSTYERPQESADLAERRRKNREVAEQRLAEATRQRPRCADPGKSEKCERKIREIRAEQERALAFDAPKSNPMPKERQGAGQAAVKLNAAAIMREWARYREAEKREAERLGALEAGAFDKSAFEAWQQAQKEADLQSQLAELERRRLEGQLSYEEAVIARRRLAESNRAVVEKEREAAAERQEELAAMRAAEEEQLKQRMAEIMAGHAKARQAVRDAQKAKALSRAEQQQETEELLKQAYEEAAAELRRKMELIAEIRAIEATQAPREKRLDLTEIAGFGFLSEMSIAELRERLSLAKQRQTQEVEEKRDQILEEKQAKDEKLLHTMELI 551          
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Cavefish
Match: cfap99 (cilia and flagella associated protein 99 [Source:NCBI gene;Acc:103035029])

HSP 1 Score: 273.863 bits (699), Expect = 6.028e-82
Identity = 186/555 (33.51%), Postives = 319/555 (57.48%), Query Frame = 1
Query:  109 VEILNTFPKDCKSLTIHVEDYFKNL-NISEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPN-------TKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTY-------IVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNLQEKETYK 1728
            + +L+ +  D +S+   +ED  K L + S  D+ F +DV    + Y+++L +V+N  Y   G+++F +++  Y V+ +L +F LE++GFE+F   +++     M+KFL+F  +  NL TWI  EW + YD+ +VE+       K +  L R+  E++ +LD+   K  K+  +       T+P  FDL KPKP+ +P PE IP+ EK K +P+TT+       ++ + K K   K    L  EA+  Q  CA  + S+KT   ++QI    +  LKF+   +   P  +      ++ NT  ILRE  LY  ++ ++   L++L +G      F  WQ+ ++  DL E+++Q+E+ +L GKIS+EEA+L R R+++ N+    L K+E A+ ++++ +++   E+  K LV+QV    +  K AK+ + + KQ I RE++E+SR L ++ L EA+AE+ RK ++I +IRALE   S   K +D TE  G+ LLCEMSLAEL+ERL   +++ ++   +KR+ I + KQ K++ + E  + + I R+   + +  K
Sbjct:   11 ISLLDKYNPDEQSVDSFIEDSVKTLGDHSSGDQKFFIDVVYGCVVYRRLLDVVVNVLYNQTGKSLFKADRTQYVVVCYLAMFHLEDLGFEQFSRIIKSLDSSKMHKFLSFFFNVTNLTTWIHGEWSQFYDAAYVEH-------KWIAPLLRWRTEIEGLLDHLAKKMTKSSLSRNSPKKYTQPKEFDLTKPKPRPLPAPECIPQQEKAKPVPATTHRTPKEPNVLEESKQKNHLKAQQVLY-EANIQQFRCANPQTSEKTKNTVSQIQQSYDAKLKFDNVYTSGTPATHKMNDLPIRMNTTAILREGALYNRQMEEELNRLERLMQGGNEPSVFLQWQREMKEKDLQEELAQVERRRLEGKISHEEALLARQRVLELNQHKAHLKKEETAELMRRYAEKRLTEEKEIKELVQQVANGHKNSKAAKMKLHELKQCIVREVSEQSRELLQQALEEAQAELSRKFELIRQIRALESVPSIRHKFVDDTETGGHDLLCEMSLAELRERLARLREEEQQEQEEKRQKILEEKQSKEQLLLEQLDTIAIRRAGAGQAQARK 557          
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Cavefish
Match: cfap99 (cilia and flagella associated protein 99 [Source:NCBI gene;Acc:103035029])

HSP 1 Score: 257.684 bits (657), Expect = 2.497e-76
Identity = 183/555 (32.97%), Postives = 311/555 (56.04%), Query Frame = 1
Query:  109 VEILNTFPKDCKSLTIHVEDYFKNL-NISEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPN-------TKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTY-------IVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNLQEKETYK 1728
            + +L+ +  D +S+   +ED  K L + S  D+ F +DV    + Y+++L +V+N  Y   G+++F +++  Y V+ +L +F LE++GFE+F   +++     M+KFL+F  +  NL TWI  EW + YD+ +VE+       K +  L R+  E++ +LD+   K  K+  +       T+P  FDL KPKP+ +P PE IP+ EK K +P+TT+       ++ + K K   K    L  EA+  Q  CA  + S+KT  K+N + I                           + NT  ILRE  LY  ++ ++   L++L +G      F  WQ+ ++  DL E+++Q+E+ +L GKIS+EEA+L R R+++ N+    L K+E A+ ++++ +++   E+  K LV+QV    +  K AK+ + + KQ I RE++E+SR L ++ L EA+AE+ RK ++I +IRALE   S   K +D TE  G+ LLCEMSLAEL+ERL   +++ ++   +KR+ I + KQ K++ + E  + + I R+   + +  K
Sbjct:   11 ISLLDKYNPDEQSVDSFIEDSVKTLGDHSSGDQKFFIDVVYGCVVYRRLLDVVVNVLYNQTGKSLFKADRTQYVVVCYLAMFHLEDLGFEQFSRIIKSLDSSKMHKFLSFFFNVTNLTTWIHGEWSQFYDAAYVEH-------KWIAPLLRWRTEIEGLLDHLAKKMTKSSLSRNSPKKYTQPKEFDLTKPKPRPLPAPECIPQQEKAKPVPATTHRTPKEPNVLEESKQKNHLKAQQVLY-EANIQQFRCANPQTSEKT--KMNDLPI---------------------------RMNTTAILREGALYNRQMEEELNRLERLMQGGNEPSVFLQWQREMKEKDLQEELAQVERRRLEGKISHEEALLARQRVLELNQHKAHLKKEETAELMRRYAEKRLTEEKEIKELVQQVANGHKNSKAAKMKLHELKQCIVREVSEQSRELLQQALEEAQAELSRKFELIRQIRALESVPSIRHKFVDDTETGGHDLLCEMSLAELRERLARLREEEQQEQEEKRQKILEEKQSKEQLLLEQLDTIAIRRAGAGQAQARK 528          
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Medaka
Match: cfap99 (cilia and flagella associated protein 99 [Source:NCBI gene;Acc:101156371])

HSP 1 Score: 154.451 bits (389), Expect = 2.600e-39
Identity = 155/557 (27.83%), Postives = 275/557 (49.37%), Query Frame = 1
Query:   85 YEKKLNHCVEILNTFPKDCKSLTIHVEDYFKNLNISEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPNTK-------PAPFDLHKPKPKRIPMPELIPEIEKVKEIPST-------TYIVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNLQE 1713
            Y   +   + +L+TF    +SL   +E+  ++L    + + FI+D+F+  I+ +K L +V+N FY T+G+ +   ++N + ++ +L     +        + +E+  ++NMY FLNF    +NL + I+ EW  + D+ FVE   +N        L R+  E+ N+L     KT +  P  K       P  F   KPKP+ + +PEL PE EK K +PS+        +I+ + K K+ +K   F      +++     +  S +  EKL   +                     S  S  +K N A ILR   L + ++ ++ Q  + L +G      F  WQ+ + + D   ++   EK +L  +I  E   L R++++  N++  Q  K+E A+ +++  +E+   E++ K LV+QV  S +  K AK  ++K KQ I +E++EES+ L  +   E +AE+ ++ +MI E  A +          D T+ AG+GLL EM LAEL+ RL L K + +E   ++R  I   KQ++++ + +  E +++    L E
Sbjct:    5 YGSLVKKAIGLLDTFGSKIQSLDAFMEEALQDL----QQRNFILDIFSGCIENKKQLDVVVNAFYATNGKLMSRRDRNQFVMICYLTFSLDDLGLQNF-SNMIESIGIKNMYTFLNFYF--SNLTSSIKHEWSSIIDAAFVEEHWIN-------PLLRWRPEIYNLLSQLAAKTSQDNPKKKVTTKVTVPQEFSFSKPKPRLLSVPELPPEHEKTKPVPSSIHRSPKEMHILKEIKEKKHQKAELFYEANLKQIRMENPLKSESSEVFEKLWSRL---------------------SAGSFSVKLNKAAILRREALCDQQLEQELQRQEWLMQGGLEPSAFLQWQREMLTRD---QLPMTEKKQLEAQIRDERIALAREQIMDRNQKTAQQTKEEIAQLMQEIAEERIQEEQKKKELVQQVAESHKNTKEAKEKLKKLKQTIVKEVSEESQELLFQAFEEKQAELCKRFEMIHENHAKQSLPRIRLNPFDDTKTAGHGLLEEMPLAELRLRLDLLKMERQEEEQERRMHILQEKQKQEELLQKRLEAIELHSRALAE 523          
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Medaka
Match: cfap99 (cilia and flagella associated protein 99 [Source:NCBI gene;Acc:101156371])

HSP 1 Score: 149.828 bits (377), Expect = 6.905e-38
Identity = 140/480 (29.17%), Postives = 246/480 (51.25%), Query Frame = 1
Query:  172 FKNLNISEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPNTK-------PAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTYIVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSK 1590
             +N+N+ +++  FI+D+F+  I+ +K L +V+N FY T+G+ +   ++N + ++ +L     +        + +E+  ++NMY FLNF    +NL + I+ EW  + D+ FVE   +N        L R+  E+ N+L     KT +  P  K       P  F   KPKP+ + +PEL PE EK K +PS+ +        +  K+ + L             +EI +K  +K  ++  E   +LK    ++    +++   S  +K N A ILR   L + ++ ++ Q  + L +G      F  WQ+ + + D   ++   EK +L  +I  E   L R++++  N++  Q  K+E A+ +++  +E+   E++ K LV+QV  S +  K AK  ++K KQ I +E++EES+ L  +   E +AE+ ++ +MI E  A +          D T+ AG+GLL EM LAEL+ RL L K
Sbjct:    8 LQNINVQQRN--FILDIFSGCIENKKQLDVVVNAFYATNGKLMSRRDRNQFVMICYLTFSLDDLGLQNF-SNMIESIGIKNMYTFLNFYF--SNLTSSIKHEWSSIIDAAFVEEHWIN-------PLLRWRPEIYNLLSQLAAKTSQDNPKKKVTTKVTVPQEFSFSKPKPRLLSVPELPPEHEKTKPVPSSIH--------RSPKEMHIL-------------KEIKEKKHQKAEELFYE--ANLKQIRMENPLKSESSEAGSFSVKLNKAAILRREALCDQQLEQELQRQEWLMQGGLEPSAFLQWQREMLTRD---QLPMTEKKQLEAQIRDERIALAREQIMDRNQKTAQQTKEEIAQLMQEIAEERIQEEQKKKELVQQVAESHKNTKEAKEKLKKLKQTIVKEVSEESQELLFQAFEEKQAELCKRFEMIHENHAKQSLPRIRLNPFDDTKTAGHGLLEEMPLAELRLRLDLLK 449          
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Medaka
Match: cfap99 (cilia and flagella associated protein 99 [Source:NCBI gene;Acc:101156371])

HSP 1 Score: 149.828 bits (377), Expect = 7.286e-38
Identity = 140/480 (29.17%), Postives = 246/480 (51.25%), Query Frame = 1
Query:  172 FKNLNISEKDKVFIVDVFAESIKYQKILMIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPNTK-------PAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTYIVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSK 1590
             +N+N+ +++  FI+D+F+  I+ +K L +V+N FY T+G+ +   ++N + ++ +L     +        + +E+  ++NMY FLNF    +NL + I+ EW  + D+ FVE   +N        L R+  E+ N+L     KT +  P  K       P  F   KPKP+ + +PEL PE EK K +PS+ +        +  K+ + L             +EI +K  +K  ++  E   +LK    ++    +++   S  +K N A ILR   L + ++ ++ Q  + L +G      F  WQ+ + + D   ++   EK +L  +I  E   L R++++  N++  Q  K+E A+ +++  +E+   E++ K LV+QV  S +  K AK  ++K KQ I +E++EES+ L  +   E +AE+ ++ +MI E  A +          D T+ AG+GLL EM LAEL+ RL L K
Sbjct:    8 LQNINVQQRN--FILDIFSGCIENKKQLDVVVNAFYATNGKLMSRRDRNQFVMICYLTFSLDDLGLQNF-SNMIESIGIKNMYTFLNFYF--SNLTSSIKHEWSSIIDAAFVEEHWIN-------PLLRWRPEIYNLLSQLAAKTSQDNPKKKVTTKVTVPQEFSFSKPKPRLLSVPELPPEHEKTKPVPSSIH--------RSPKEMHIL-------------KEIKEKKHQKAEELFYE--ANLKQIRMENPLKSESSEAGSFSVKLNKAAILRREALCDQQLEQELQRQEWLMQGGLEPSAFLQWQREMLTRD---QLPMTEKKQLEAQIRDERIALAREQIMDRNQKTAQQTKEEIAQLMQEIAEERIQEEQKKKELVQQVAESHKNTKEAKEKLKKLKQTIVKEVSEESQELLFQAFEEKQAELCKRFEMIHENHAKQSLPRIRLNPFDDTKTAGHGLLEEMPLAELRLRLDLLK 449          
BLAST of cilia- and flagella-associated protein 99 vs. Planmine SMEST
Match: SMESG000025927.1 (SMESG000025927.1)

HSP 1 Score: 1026.54 bits (2653), Expect = 0.000e+0
Identity = 570/572 (99.65%), Postives = 570/572 (99.65%), Query Frame = 1
Query:  256 MIVINRFYETDGRNIFLSEKNVYXXXXXXXXXXXXXXXXXXXKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPNTKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTYIVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNLQEKETYKAPIQPISLENLDENKLKEIKTLQAQLEEXXXXXXXXXXXXXXSNRIAXXXXXXXXXXXXLEKYPIKSQSDTVERMKQILSV 1971
            MIVINRFYE DGRNIFLSEKNVYFVLLFLLIFRLEEIGFEEFKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPNTKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTYIVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNLQEKETYKAPIQPISLENLDENKLKEIKTLQAQLEEKRSQRKQQRQDQIKSNRIASSDKSV KSSGVLEKYPIKSQSDTVERMKQILSV
Sbjct:    1 MIVINRFYEKDGRNIFLSEKNVYFVLLFLLIFRLEEIGFEEFKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELMNGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPNTKPAPFDLHKPKPKRIPMPELIPEIEKVKEIPSTTYIVSDFKPKQDKKDPYFLMKEADRLQPACAQREISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATILREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQLEKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALNEERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIEAEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKERLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNLQEKETYKAPIQPISLENLDENKLKEIKTLQAQLEEKRSQRKQQRQDQIKSNRIASSDKSVVKSSGVLEKYPIKSQSDTVERMKQILSV 572          
The following BLAST results are available for this feature:
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CFAP999.750e-6230.73cilia and flagella associated protein 99 [Source:H... [more]
CFAP995.588e-6130.73cilia and flagella associated protein 99 [Source:H... [more]
back to top
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cfap995.904e-8633.03cilia and flagella associated protein 99 [Source:Z... [more]
back to top
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CFAP993.019e-5933.46cilia and flagella associated protein 99 [Source:N... [more]
back to top
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Cfap991.246e-7233.69cilia and flagella associated protein 99 [Source:M... [more]
back to top
BLAST of cilia- and flagella-associated protein 99 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|D6REC4|CFA99_HUMAN2.969e-3737.40Cilia- and flagella-associated protein 99 OS=Homo ... [more]
sp|A8IUG5|CFA99_CHLRE4.364e-2127.21Cilia- and flagella-associated protein 99 OS=Chlam... [more]
back to top
BLAST of cilia- and flagella-associated protein 99 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2R2MSK68.432e-10438.88cilia- and flagella-associated protein 99 isoform ... [more]
A0A1S3K0F97.414e-10338.88cilia- and flagella-associated protein 99 isoform ... [more]
A0A2R2MS832.425e-10238.70cilia- and flagella-associated protein 99 isoform ... [more]
A0A210PYE83.169e-9736.35Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
A0A267FQQ81.350e-9636.25Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cfap996.028e-8233.51cilia and flagella associated protein 99 [Source:N... [more]
cfap992.497e-7632.97cilia and flagella associated protein 99 [Source:N... [more]
back to top
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of cilia- and flagella-associated protein 99 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cfap992.600e-3927.83cilia and flagella associated protein 99 [Source:N... [more]
cfap996.905e-3829.17cilia and flagella associated protein 99 [Source:N... [more]
cfap997.286e-3829.17cilia and flagella associated protein 99 [Source:N... [more]
back to top
BLAST of cilia- and flagella-associated protein 99 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000025927.10.000e+099.65SMESG000025927.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014219 ID=SMED30014219|Name=cilia- and flagella-associated protein 99|organism=Schmidtea mediterranea sexual|type=transcript|length=2115bp
TTTTATTTTATATTTATTACAATTAGTAGATAAAGTTTATTTTTATAAGG
AATTAGCATTGCAAATAATTTAATGATGTCTTTATATGAAAAAAAATTGA
ATCACTGTGTTGAAATATTGAATACGTTCCCAAAAGATTGCAAATCTTTA
ACAATACACGTTGAAGATTATTTCAAAAATTTAAACATAAGTGAAAAAGA
TAAAGTATTTATTGTTGATGTATTTGCTGAATCAATAAAATACCAAAAAA
TATTGATGATTGTTATTAATCGATTTTATGAAACAGACGGAAGAAATATT
TTTCTCAGTGAGAAAAATGTTTATTTCGTGTTGCTGTTTCTGCTAATTTT
TCGGCTCGAAGAAATTGGTTTTGAAGAATTTAAATCGTATTTGGAAACCC
AGAAATTACAAAATATGTACAAATTTTTGAATTTTGTAACTGATGAAAAT
AATTTGTTCACATGGATCGAATTGGAATGGAGAAAATTATACGATTCTAT
TTTCGTTGAAAATGAGCTTATGAATGGCTTGAAAAAGTCATTGCCAGATT
TAAGAAGATATGTGGAGGAAATGAAAAATATTCTTGATAATAAACCAACG
AAAACTCGTAAAGCCATTCCTAATACAAAGCCCGCGCCATTTGATCTGCA
TAAACCGAAGCCAAAGCGAATACCGATGCCAGAATTGATTCCAGAAATTG
AGAAAGTAAAAGAAATTCCATCAACAACCTATATAGTGTCAGATTTCAAA
CCAAAACAAGATAAAAAGGATCCATACTTCCTCATGAAAGAAGCCGACAG
ATTGCAACCGGCTTGTGCTCAAAGAGAAATCTCCCAAAAAACACTGGAAA
AATTAAACCAAATTGTAATTGAGCGAGAAAAAGATTTAAAATTTAATGAA
TACAAATCAAAACCGGCACCAAAAAACAATTCACAAATTTCAAGTCAATT
GAAAACTAACACGGCAACGATTTTAAGGGAATGGAAATTGTACGAAACTA
GAATAACAAAGAAGAATCAAGAACTTAAAAAATTGGAAGAAGGTGCGTTT
AATACTCAACAATTTGATGCTTGGCAGCAATCACTGCGATCTGCTGATTT
GTCCGAGAAAATTTCCCAATTAGAAAAACTGAAACTGGCCGGTAAAATCA
GCTACGAAGAGGCAATTCTCAAACGGGATAGATTAATCCAAGAAAACAAA
GAACTTGTTCAATTATTAAAAAAGGAGAACGCGAAACGCATCAAAAAATT
TTTCAAAGAAAAAGCTCTTAATGAAGAAAGGGCCAAAGCGTTAGTGGAGC
AAGTTATCGCGTCTCAAGAAGGTGTAAAAGTGGCAAAATTGACAGTTCAG
AAAAAGAAACAAGCGATTGCCAGAGAAATTGCTGAAGAATCTCGTCGTTT
GCAAGAGGAAATGCTAATTGAAGCTGAAGCTGAAATGAGACGAAAAATTG
ACATGATTGCCGAAATCAGAGCCTTGGAAGATAGCCAGTCCAGTAACCAA
AAGATATTAGATCCCACGGAAATTGCCGGTTATGGATTGCTCTGTGAAAT
GTCTCTGGCAGAACTGAAAGAACGATTAATATTATCAAAGCAGAAATATG
AAGAGAATGTCAATCAAAAACGAGAAATGATTTCGGATAATAAACAAGAA
AAACAAAAACAAATTGCAGAAACTTTTGAAATAGTAAAAATTTGTCGGAG
TAATCTACAAGAAAAAGAAACCTACAAGGCTCCTATTCAACCAATCTCAT
TGGAAAATCTCGATGAAAACAAATTGAAAGAAATCAAAACCCTTCAAGCT
CAATTGGAAGAGAAACGCTCTCAACGTAAACAACAACGTCAAGATCAAAT
CAAATCTAATCGAATTGCATCATCAGACAAATCTGTGGGGAAATCTAGTG
GGGTATTGGAAAAATATCCGATAAAATCTCAATCAGACACCGTTGAAAGG
ATGAAACAAATTTTGTCTGTTTGATGATTTGTAAGTTACAAAGGGATGTT
GAGGTGTGATTTATCAACTCGTTAACCGTATTATAAAACATTTTTAATGT
TAATACAGGCTGAGAAGTGCACAAATTGATTCGAATTTCCTATTGTTCAT
TTATTAGTATCGTGC
back to top

protein sequence of SMED30014219-orf-1

>SMED30014219-orf-1 ID=SMED30014219-orf-1|Name=SMED30014219-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=634bp
MMSLYEKKLNHCVEILNTFPKDCKSLTIHVEDYFKNLNISEKDKVFIVDV
FAESIKYQKILMIVINRFYETDGRNIFLSEKNVYFVLLFLLIFRLEEIGF
EEFKSYLETQKLQNMYKFLNFVTDENNLFTWIELEWRKLYDSIFVENELM
NGLKKSLPDLRRYVEEMKNILDNKPTKTRKAIPNTKPAPFDLHKPKPKRI
PMPELIPEIEKVKEIPSTTYIVSDFKPKQDKKDPYFLMKEADRLQPACAQ
REISQKTLEKLNQIVIEREKDLKFNEYKSKPAPKNNSQISSQLKTNTATI
LREWKLYETRITKKNQELKKLEEGAFNTQQFDAWQQSLRSADLSEKISQL
EKLKLAGKISYEEAILKRDRLIQENKELVQLLKKENAKRIKKFFKEKALN
EERAKALVEQVIASQEGVKVAKLTVQKKKQAIAREIAEESRRLQEEMLIE
AEAEMRRKIDMIAEIRALEDSQSSNQKILDPTEIAGYGLLCEMSLAELKE
RLILSKQKYEENVNQKREMISDNKQEKQKQIAETFEIVKICRSNLQEKET
YKAPIQPISLENLDENKLKEIKTLQAQLEEKRSQRKQQRQDQIKSNRIAS
SDKSVGKSSGVLEKYPIKSQSDTVERMKQILSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039341CFAP99
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 499..526
NoneNo IPR availableCOILSCoilCoilcoord: 434..454
NoneNo IPR availableCOILSCoilCoilcoord: 564..591
NoneNo IPR availableCOILSCoilCoilcoord: 361..388
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 593..607
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 580..612
IPR039341Cilia- and flagella-associated protein 99PANTHERPTHR34649FAMILY NOT NAMEDcoord: 5..629