Tubulin alpha chain

Overview
NameTubulin alpha chain
Smed IDSMED30014215
Length (bp)1811
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014215

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30014215SMESG000020613.1 PL06021A2E10_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1C (tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:20768])

HSP 1 Score: 402.134 bits (1032), Expect = 1.382e-134
Identity = 186/374 (49.73%), Postives = 283/374 (75.67%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEE 1474
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ LT +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++A+A+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  +    E   EE
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSADGEDEGEE 448          

HSP 2 Score: 84.7297 bits (208), Expect = 7.837e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA4A (tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:12407])

HSP 1 Score: 400.593 bits (1028), Expect = 2.798e-134
Identity = 187/374 (50.00%), Postives = 285/374 (76.20%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS-----EEDDAKE 1459
            IDEIR GPYR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+      +ED+ +E
Sbjct:   60 IDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE 433          

HSP 2 Score: 60.4622 bits (145), Expect = 4.935e-9
Identity = 29/66 (43.94%), Postives = 42/66 (63.64%), Query Frame = 3
Query:   84 ISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            + +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D++
Sbjct:    1 MGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFTTFFCETGAGKHVPRAVFVDLEPTVIDEI 63          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA4A (tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:12407])

HSP 1 Score: 400.979 bits (1029), Expect = 3.504e-134
Identity = 187/374 (50.00%), Postives = 285/374 (76.20%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS-----EEDDAKE 1459
            IDEIR GPYR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+      +ED+ +E
Sbjct:   75 IDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE 448          

HSP 2 Score: 82.4185 bits (202), Expect = 5.189e-16
Identity = 40/81 (49.38%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQ+ +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D++
Sbjct:    1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFTTFFCETGAGKHVPRAVFVDLEPTVIDEI 78          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1A (tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:20766])

HSP 1 Score: 399.438 bits (1025), Expect = 5.282e-134
Identity = 183/362 (50.55%), Postives = 278/362 (76.80%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+ 
Sbjct:   40 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVG 401          
BLAST of Tubulin alpha chain vs. Ensembl Human
Match: TUBA1B (tubulin alpha 1b [Source:HGNC Symbol;Acc:HGNC:18809])

HSP 1 Score: 398.667 bits (1023), Expect = 2.711e-133
Identity = 183/362 (50.55%), Postives = 279/362 (77.07%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+ 
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVG 436          

HSP 2 Score: 85.1149 bits (209), Expect = 7.785e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-9 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:Q20221])

HSP 1 Score: 397.897 bits (1021), Expect = 2.409e-133
Identity = 186/373 (49.87%), Postives = 283/373 (75.87%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS-------EEDD 1450
            IDEIRTG Y+ LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++RVR++VE C GL+GF +F+SFGGGTGSGF+AL++ERL+V++ KK   + C++P+ +++TS VEPYN++L T   ++H+D     DNE++YDIC  +LD+ RPTY+ LNR++AQ+ S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ +T +++T+  F+   Q+V C+   G++M CCL YRG+V PK+VN ++  +K +  I+FV+WCPT FK+GIN QPP  V  +++++  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+        EEDD
Sbjct:   80 IDEIRTGTYKTLFHPEQLLTGKEDAANNYARGHYTIGKEIIDVVMDRVRRLVENCRGLQGFLVFHSFGGGTGSGFTALLMERLSVDYGKKSKLEFCIYPAPQVSTSMVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLDLARPTYTNLNRLIAQVISSVTASLRFDGALNVDLTEFQTNLVPYPRIHFPLTTYAPIISAEKAYHEQMTVAEITQQCFEPGAQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAIASVKTKRSIQFVDWCPTGFKVGINYQPPTVVPGADLSKLQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGLDAGEPDEEDD 452          

HSP 2 Score: 83.5741 bits (205), Expect = 9.475e-17
Identity = 39/80 (48.75%), Postives = 53/80 (66.25%), Query Frame = 3
Query:   42 REIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            RE+I  H+GQAGVQ+ +  WE +C EHGIQ DG +      G +DD   SF  FF E  +G+ VPRAI +DLEP+ +D++
Sbjct:    7 REVISIHVGQAGVQMGNACWELYCLEHGIQPDGMINEEDSLGVDDD---SFNTFFSETMAGKHVPRAIMVDLEPTPIDEI 83          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-4 (Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:G5EDD4])

HSP 1 Score: 387.882 bits (995), Expect = 1.614e-129
Identity = 179/374 (47.86%), Postives = 284/374 (75.94%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEE 1474
            +DEIRTG Y+KLFHP+ ++TG EDAANN+ARGH+T+GK  ID T++R+R++ + C GL+GFF+F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LD+ RP+Y+ LNRI++Q+ S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ +Y PL+S++K  H+ L+ +D+T + F+ +NQ+V C+   G++M  CL YRG+V PK+VN ++  IK +  ++FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L  KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+    D+ E + E+
Sbjct:   73 VDEIRTGNYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTTLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICKRNLDVDRPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLASYTPLISAEKAYHEALSVNDITNSCFEPANQMVKCDPRNGKYMAVCLLYRGDVVPKDVNTAITAIKTKRSVQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGA--DSNEGLEED 444          

HSP 2 Score: 88.1965 bits (217), Expect = 2.612e-18
Identity = 38/77 (49.35%), Postives = 56/77 (72.73%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE+I  H+GQAGVQI +  WE +C EHGIQ DG + +  + +E  SF  FF +  +G++VPR+I +DLEP+V+D++
Sbjct:    1 MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPSE-QQNEGGSFTTFFSDTGNGRYVPRSIFVDLEPTVVDEI 76          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: mec-12 (Tubulin alpha-3 chain Detyrosinated tubulin alpha-3 chain [Source:UniProtKB/Swiss-Prot;Acc:P91910])

HSP 1 Score: 387.497 bits (994), Expect = 2.712e-129
Identity = 181/372 (48.66%), Postives = 281/372 (75.54%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEEL---SEEDDAKE 1459
            IDEIRTG YR LFHP+ L+TG EDAANN+ARGH+TIGK  ID T++R+R++ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RP+Y+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ T++P++S++K  H+ L+ +++T   F+  NQ+V C+   G++M  CL +RG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+   S ED+ +E
Sbjct:   75 IDEIRTGTYRSLFHPEQLITGKEDAANNYARGHYTIGKEIIDLTLDRIRRLADNCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKAKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCSFMVDNEAIYDICRRNLDIERPSYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATFSPVISAEKAYHEQLSVAEITNMCFEPHNQMVKCDPRHGKYMAVCLLFRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGVDSMEDNGEE 446          

HSP 2 Score: 88.1965 bits (217), Expect = 2.483e-18
Identity = 43/81 (53.09%), Postives = 55/81 (67.90%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE+I  HIGQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  SG+ VPRA+ +DLEP+V+D++
Sbjct:    1 MREVISIHIGQAGVQIGNACWELYCLEHGIQPDGQMPSDKSLGGSDD---SFSTFFSETGSGRHVPRAVMVDLEPTVIDEI 78          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 386.726 bits (992), Expect = 4.704e-129
Identity = 177/366 (48.36%), Postives = 278/366 (75.96%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDD 1450
            +DEIRTG Y+KLFHP+ ++TG EDAANN+ARGH+T+GK  ID  ++R+R++ + C GL+GFF+F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LD+ RP+Y+ LNRI++Q+ S+++ S+RF+G LN D+++  TNLVPYPRIHFP+  Y PL+S++K  H+ L+ SD+T + F+ +NQ+V C+   G++M  CL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L  KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+  + +
Sbjct:   73 VDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADSN 438          

HSP 2 Score: 90.1225 bits (222), Expect = 5.362e-19
Identity = 39/77 (50.65%), Postives = 55/77 (71.43%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE+I  H+GQAGVQI +  WE +C EHGIQ DG +      +E +SF  FF +  SG++VPR+I +DLEP+V+D++
Sbjct:    1 MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPTQ-STNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEI 76          
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Match: tba-2 (Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Prot;Acc:P34690])

HSP 1 Score: 386.726 bits (992), Expect = 4.704e-129
Identity = 177/366 (48.36%), Postives = 278/366 (75.96%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDD 1450
            +DEIRTG Y+KLFHP+ ++TG EDAANN+ARGH+T+GK  ID  ++R+R++ + C GL+GFF+F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LD+ RP+Y+ LNRI++Q+ S+++ S+RF+G LN D+++  TNLVPYPRIHFP+  Y PL+S++K  H+ L+ SD+T + F+ +NQ+V C+   G++M  CL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L  KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+  + +
Sbjct:   73 VDEIRTGTYKKLFHPEQMITGKEDAANNYARGHYTVGKELIDTVLDRIRRLADNCSGLQGFFVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDVERPSYTNLNRIISQVVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLAAYTPLISAEKAYHEALSVSDITNSCFEPANQMVKCDPRHGKYMAVCLLYRGDVVPKDVNTAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVPRAVCMLSNTTAIAEAWSRLDYKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALEKDYEEVGADSN 438          

HSP 2 Score: 90.1225 bits (222), Expect = 5.362e-19
Identity = 39/77 (50.65%), Postives = 55/77 (71.43%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE+I  H+GQAGVQI +  WE +C EHGIQ DG +      +E +SF  FF +  SG++VPR+I +DLEP+V+D++
Sbjct:    1 MREVISIHVGQAGVQIGNACWELYCLEHGIQPDGTMPTQ-STNEGESFTTFFSDTGSGRYVPRSIFVDLEPTVVDEI 76          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84B (gene:FBgn0003884 transcript:FBtr0081639)

HSP 1 Score: 396.356 bits (1017), Expect = 1.231e-132
Identity = 180/362 (49.72%), Postives = 278/362 (76.80%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            +DE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  +D  ++R+RK+ + C GL+GF IF+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +++T A F+ +NQ+V C+   G++M CC+ YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+ 
Sbjct:   75 VDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG 436          

HSP 2 Score: 84.7297 bits (208), Expect = 4.476e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVVDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub85E (gene:FBgn0003886 transcript:FBtr0082087)

HSP 1 Score: 395.586 bits (1015), Expect = 1.981e-132
Identity = 183/375 (48.80%), Postives = 283/375 (75.47%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEEE 1477
            +DE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  +D  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY  LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S +K  H+ LT +++T A F+ +NQ+V C+   G++M CC+ YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+    D+  ++ E+E
Sbjct:   75 VDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYMNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISVEKAYHEQLTVAEITNACFEPANQMVKCDPRRGKYMACCMLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFAEAREDLAALEKDYEEVG--IDSTTELGEDE 447          

HSP 2 Score: 85.1149 bits (209), Expect = 2.896e-17
Identity = 43/81 (53.09%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  HIGQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISVHIGQAGVQIGNACWELYCLEHGIQPDGHMPSDKTVGGGDD---SFSTFFSETGAGKHVPRAVFVDLEPTVVDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub84D (gene:FBgn0003885 transcript:FBtr0081538)

HSP 1 Score: 393.275 bits (1009), Expect = 1.742e-131
Identity = 180/362 (49.72%), Postives = 277/362 (76.52%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            +DE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  +D  ++R+RK+ + C GL+GF IF+SFGGGTGSGF++L++ERL+V++ KK   +  V+P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +++T A F+ +NQ+V  +   G++M CC+ YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+ 
Sbjct:   75 VDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYAPVISAEKAYHEQLSVAEITNACFEPANQMVKVDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG 436          

HSP 2 Score: 84.7297 bits (208), Expect = 4.242e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTVGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVVDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: alphaTub67C (gene:FBgn0087040 transcript:FBtr0076393)

HSP 1 Score: 369.777 bits (948), Expect = 3.471e-122
Identity = 178/374 (47.59%), Postives = 270/374 (72.19%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEE 1474
            ID++R G  R+L+HP+ L++G EDAANN+ARG ++IGK  ID   +R++KI E C  L+GF IF+S GGGTGSGF++L++ERL+ +++KK      V+PS +++T+ VEPYN LL T + +DH+D     DNE++YDIC  SL + RP Y  LNR++AQI S+ + S+RF G++N D+++  TNLVP+PRIHFP+  YAPL+S+++  H+    + LT A F+SSN +V C+   G+FM CC+ YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN + P FV   ++A+T ++  ML+N++AI+  F +L  KF+++F KR+F+HWYVGEGMEE E   + + + ++  D+EE+   D+A+E  +E+
Sbjct:   86 IDDVRNGCMRELYHPEQLISGKEDAANNYARGRYSIGKEVIDRVTSRLQKIAEQCDSLQGFLIFHSLGGGTGSGFTSLLVERLSTDYSKKCKLDFAVYPSPKVSTAVVEPYNALLTTHSTMDHSDCVFMVDNEAIYDICNNSLGVDRPAYRNLNRLIAQIVSSTTASLRFSGSMNVDLNEFQTNLVPFPRIHFPLVAYAPLMSAERSAHEQHAITTLTNACFESSNMMVKCDPRAGKFMACCMLYRGDVVPKDVNAAVSAIKSKRHIQFVDWCPTGFKIGINYEKPAFVPDGDLAKTSRACCMLSNTTAISVAFSNLSYKFDLMFKKRAFVHWYVGEGMEEGEFTEARENIAVLERDFEEVG-LDNAEEGGDED 458          

HSP 2 Score: 72.4034 bits (176), Expect = 3.859e-13
Identity = 37/89 (41.57%), Postives = 49/89 (55.06%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYE------------DDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE++   IGQ G+QI +  WE +  EHGI  DG+LK   E            D      R FF E  +G+ VPR+I +DLEP+V+D V
Sbjct:    1 MREVVSIQIGQCGIQIGNACWELYLLEHGINLDGSLKTKEELTASGSSASVGHDTSANDARTFFTETGNGKQVPRSIFVDLEPTVIDDV 89          
BLAST of Tubulin alpha chain vs. Ensembl Fly
Match: CG7794 (gene:FBgn0038565 transcript:FBtr0083540)

HSP 1 Score: 301.982 bits (772), Expect = 1.495e-96
Identity = 156/385 (40.52%), Postives = 239/385 (62.08%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKV-IYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEEELKQEDDVKN 1504
            IDEIRTG YR LFHPD L+TG +D+ +NFARG+  +    +D ++N +R++ + C  L GF +F + GGG+GSG    ++ERL  +F KK+ + +  V+PS  ++   VEPYN LL     +D  D+    DNE+LYDIC  +L++P PTY+ LNRI+AQ+ S+ + S RF G       ++ TNLVPYPRIH+P+  YAPL+        N++T+ LT   F  SNQ+V CN S G++M   L YRG++ P E+N +L  IKR    +FV+W PT FK+G++  PP +V   ++A T+++   ++N++ I   +  L+NKF+ L+ +R+F++ YVGEG+EE     + + +  +  DY E+    DA    +  +   E+D  N
Sbjct:   75 IDEIRTGSYRNLFHPDTLITGKDDSGSNFARGYNLMASELLDRSMNAIRRVADRCRNLRGFLVFRAIGGGSGSGLGTRIMERLVEDFGKKMTVVEFLVYPSPSISPVIVEPYNALLAAHFSMDCADVSFIVDNEALYDICANTLNVPAPTYTNLNRIIAQVVSSFTASQRFGGGSTVSFQELQTNLVPYPRIHYPLINYAPLVPISHSQFVNMSTAQLTGQCFQMSNQMVRCNPSHGKYMASVLLYRGDIAPNEINTALENIKRNRSFRFVDWSPTGFKIGVSPMPPYYVPGGDLAPTNRACVAISNNTNIRIAWCRLVNKFDKLYQRRAFVYHYVGEGLEEGNFNEASENICQLVHDYLEV----DASAPTSRRDSDPEEDSLN 455          

HSP 2 Score: 71.633 bits (174), Expect = 1.495e-96
Identity = 37/75 (49.33%), Postives = 46/75 (61.33%), Query Frame = 3
Query:   45 EIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            EII  HIGQAGVQI++  WE FC EHGI A+G L     DD   +F  F    P  Q  PR + ID EP+V+D++
Sbjct:    6 EIIQIHIGQAGVQIANACWELFCLEHGILANGRLTQSPMDDSFLTFFEFTSHQPCVQ--PRLVMIDTEPTVIDEI 78          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba1b (tubulin, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030822-1])

HSP 1 Score: 403.29 bits (1035), Expect = 2.589e-135
Identity = 189/374 (50.53%), Postives = 283/374 (75.67%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEE 1474
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++RVRK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ S++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  E    E   EE
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDLVLDRVRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGAESVEGEDEGEE 448          

HSP 2 Score: 85.1149 bits (209), Expect = 4.897e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba1b (tubulin, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030822-1])

HSP 1 Score: 403.29 bits (1035), Expect = 2.589e-135
Identity = 189/374 (50.53%), Postives = 283/374 (75.67%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEE 1474
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++RVRK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ S++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  E    E   EE
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDLVLDRVRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGAESVEGEDEGEE 448          

HSP 2 Score: 85.1149 bits (209), Expect = 4.897e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l3 (tubulin, alpha 8 like 3 [Source:ZFIN;Acc:ZDB-GENE-040801-77])

HSP 1 Score: 401.364 bits (1030), Expect = 1.648e-134
Identity = 186/364 (51.10%), Postives = 278/364 (76.37%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEE 1444
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R RK+ + C GL+GF IF+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +D+T A F+ SNQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  +
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTD 438          

HSP 2 Score: 83.5741 bits (205), Expect = 1.378e-16
Identity = 41/81 (50.62%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAG Q+ +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRAI +DLEP+V+D+V
Sbjct:    1 MRECISMHVGQAGAQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAIFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: tuba8l4 (tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-040426-860])

HSP 1 Score: 400.979 bits (1029), Expect = 2.433e-134
Identity = 186/364 (51.10%), Postives = 278/364 (76.37%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEE 1444
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R RK+ + C GL+GF IF+SFGGGTGSGF++L++ERL+V++ KK   +  V+P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +D+T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  +
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTD 438          

HSP 2 Score: 82.8037 bits (203), Expect = 2.134e-16
Identity = 40/81 (49.38%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAG Q+ +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISMHVGQAGAQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Match: si:ch73-199e17.1 (si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-8])

HSP 1 Score: 400.208 bits (1027), Expect = 5.075e-134
Identity = 184/362 (50.83%), Postives = 278/362 (76.80%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +D+T A F+ SNQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+ 
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDSVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG 436          

HSP 2 Score: 85.8853 bits (211), Expect = 2.570e-17
Identity = 43/81 (53.09%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAG QI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  SG+ VPRAI +DLEP+V+D+V
Sbjct:    1 MRECISVHVGQAGAQIGNACWELYCLEHGIQPDGQMPSDRSIGGGDD---SFNTFFSETASGKHVPRAIFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tubal3.1 (tubulin, alpha 4 [Source:NCBI gene;Acc:407878])

HSP 1 Score: 410.609 bits (1054), Expect = 5.401e-138
Identity = 191/364 (52.47%), Postives = 279/364 (76.65%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEE 1444
            IDE+RTGPYR LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++RVRK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  V+P+ R++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RP+Y+ LNR++AQI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TY+P++S++K  H+ L+  ++T A F+ SNQ+V C+   G++M CCL YRG+V PK+VN ++  IK R  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L NKF++++SKR+F+HWYVGEGMEE E   + ++M  +  DYEE+  E
Sbjct:   75 IDEVRTGPYRSLFHPEQLITGKEDAANNYARGHYTIGKELIDSVLDRVRKMADQCSGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSVYPAPRISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICNRNLDIERPSYTNLNRLIAQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVPEITNACFEYSNQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAIAAIKTRRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDNKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGRE 438          

HSP 2 Score: 78.5666 bits (192), Expect = 7.662e-15
Identity = 37/78 (47.44%), Postives = 51/78 (65.38%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDE-NQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQ+ +  WE +C EHG+Q DG + +       + SF  FF E  SG+ VPRA+ +DLE +V+D+V
Sbjct:    1 MRECISVHVGQAGVQMGNACWELYCLEHGLQPDGIMPSEKSATMVDSSFGTFFSETGSGKHVPRAVFVDLEQTVIDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba1c (tubulin alpha 1c [Source:NCBI gene;Acc:394675])

HSP 1 Score: 403.675 bits (1036), Expect = 2.582e-135
Identity = 187/374 (50.00%), Postives = 283/374 (75.67%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEE 1474
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RP+Y+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ LT +D+T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  +    E   EE
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSADAEDEGEE 448          

HSP 2 Score: 84.7297 bits (208), Expect = 7.564e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba3e (tubulin alpha 3e [Source:NCBI gene;Acc:548558])

HSP 1 Score: 400.593 bits (1028), Expect = 5.771e-134
Identity = 188/364 (51.65%), Postives = 276/364 (75.82%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEE 1444
            I EIRTG YR LFHP+ L+TG EDAANN+ARGH+TIGK  +D  ++RVRK+ + C GL+GF IF+SFGGGTGSGF++L++ERL+V++ KK   +  V+P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TY+P++S++K  H+ L+  ++T A F+ SNQ+V C+   G++M CCL YRG+V PK+VN ++  IK R  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF++++SKR+F+HWYVGEGMEE E   + ++M  +  DYEE+  E
Sbjct:   78 IGEIRTGHYRSLFHPEQLITGKEDAANNYARGHYTIGKEIVDSVLDRVRKMADQCSGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSVYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICNRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVPEITNACFEYSNQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAIAAIKTRRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTE 441          

HSP 2 Score: 65.4698 bits (158), Expect = 1.247e-10
Identity = 29/66 (43.94%), Postives = 42/66 (63.64%), Query Frame = 3
Query:   72 AGVQISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            AGVQ+ +  WE +C EHGIQ DG + +      + SF  FF E  SG+ VPRA+ +DLE +V+ ++
Sbjct:   16 AGVQMGNACWELYCLEHGIQQDGIIPDEKTAATDSSFGTFFSETGSGKHVPRAVFVDLEQTVIGEI 81          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: tuba3e (tubulin alpha 3e [Source:NCBI gene;Acc:548558])

HSP 1 Score: 399.823 bits (1026), Expect = 9.581e-134
Identity = 188/364 (51.65%), Postives = 276/364 (75.82%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEE 1444
            I EIRTG YR LFHP+ L+TG EDAANN+ARGH+TIGK  +D  ++RVRK+ + C GL+GF IF+SFGGGTGSGF++L++ERL+V++ KK   +  V+P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TY+P++S++K  H+ L+  ++T A F+ SNQ+V C+   G++M CCL YRG+V PK+VN ++  IK R  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF++++SKR+F+HWYVGEGMEE E   + ++M  +  DYEE+  E
Sbjct:   74 IGEIRTGHYRSLFHPEQLITGKEDAANNYARGHYTIGKEIVDSVLDRVRKMADQCSGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSVYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICNRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLVTYSPIISAEKAYHEQLSVPEITNACFEYSNQMVKCDPRRGKYMACCLLYRGDVVPKDVNAAIAAIKTRRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTE 437          

HSP 2 Score: 80.1073 bits (196), Expect = 2.334e-15
Identity = 37/77 (48.05%), Postives = 50/77 (64.94%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  HIGQAGVQ+ +  WE +C EHGIQ DG + +      + SF  FF E  SG+ VPRA+ +DLE +V+ ++
Sbjct:    1 MRECISIHIGQAGVQMGNACWELYCLEHGIQQDGIIPDEKTAATDSSFGTFFSETGSGKHVPRAVFVDLEQTVIGEI 77          
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Match: pex1 (peroxisomal biogenesis factor 1 [Source:Xenbase;Acc:XB-GENE-985415])

HSP 1 Score: 399.438 bits (1025), Expect = 1.462e-133
Identity = 185/364 (50.82%), Postives = 279/364 (76.65%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEE 1444
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF IF+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ S++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  +
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTD 438          

HSP 2 Score: 85.1149 bits (209), Expect = 5.744e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1c (tubulin, alpha 1C [Source:MGI Symbol;Acc:MGI:1095409])

HSP 1 Score: 401.749 bits (1031), Expect = 1.129e-134
Identity = 188/374 (50.27%), Postives = 285/374 (76.20%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEEL----SEEDDAKEK 1462
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ LT +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+    +E DD  E+
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSAEGDDEGEE 448          

HSP 2 Score: 84.7297 bits (208), Expect = 5.527e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba4a (tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:1095410])

HSP 1 Score: 400.979 bits (1029), Expect = 2.406e-134
Identity = 187/374 (50.00%), Postives = 285/374 (76.20%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS-----EEDDAKE 1459
            IDEIR GPYR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+      +ED+ +E
Sbjct:   75 IDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE 448          

HSP 2 Score: 82.4185 bits (202), Expect = 3.562e-16
Identity = 40/81 (49.38%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQ+ +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D++
Sbjct:    1 MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFTTFFCETGAGKHVPRAVFVDLEPTVIDEI 78          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba4a (tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:1095410])

HSP 1 Score: 401.749 bits (1031), Expect = 3.385e-134
Identity = 187/374 (50.00%), Postives = 285/374 (76.20%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS-----EEDDAKE 1459
            IDEIR GPYR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+      +ED+ +E
Sbjct:  104 IDEIRNGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEE 477          

HSP 2 Score: 76.2554 bits (186), Expect = 3.364e-14
Identity = 36/74 (48.65%), Postives = 50/74 (67.57%), Query Frame = 3
Query:   60 HIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            H+GQAGVQ+ +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D++
Sbjct:   37 HVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFTTFFCETGAGKHVPRAVFVDLEPTVIDEI 107          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1b (tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:107804])

HSP 1 Score: 398.667 bits (1023), Expect = 1.861e-133
Identity = 183/362 (50.55%), Postives = 279/362 (77.07%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+ 
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVG 436          

HSP 2 Score: 85.1149 bits (209), Expect = 5.344e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Match: Tuba1a (tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869])

HSP 1 Score: 398.282 bits (1022), Expect = 2.718e-133
Identity = 183/362 (50.55%), Postives = 278/362 (76.80%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+ 
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVG 436          

HSP 2 Score: 84.7297 bits (208), Expect = 5.490e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P50258|TBAD_PHYPO (Tubulin alpha-1A chain OS=Physarum polycephalum OX=5791 GN=ALTA PE=1 SV=1)

HSP 1 Score: 405.601 bits (1041), Expect = 2.641e-135
Identity = 192/375 (51.20%), Postives = 283/375 (75.47%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEEE 1477
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  +D  ++RVRK+ + C GL+GF +F+S GGGTGSGF +L+LERL+V++ KK     CV+PS +++T+ VEPYN++L T +L++HTD+    DNE++YDIC  +LDI RPTY+ LNR+VAQ+ S+L+TS+RF+G LN DI++  TNLVPYPRIHF + +YAP++S++K  H+ LT +++T + F+ +N +  C+   G++M CCL YRG+V PK+VN S+  IK +  I+FV+WCPT FK GIN QPP  V   ++A+  ++V ML+N++AIA+ F  + +KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+  E  + E   +EE
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLCLDRVRKLADQCTGLQGFLVFHSVGGGTGSGFGSLLLERLSVDYGKKSKLDFCVYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAFMLDNEAIYDICKRALDIDRPTYTNLNRLVAQVISSLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLCSYAPVISAEKAYHEQLTVAEITNSVFEPANMMAKCDPRHGKYMACCLMYRGDVVPKDVNASVAVIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAE--SSEAGGDEE 447          

HSP 2 Score: 87.8113 bits (216), Expect = 4.210e-17
Identity = 41/81 (50.62%), Postives = 55/81 (67.90%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE+I  HIGQAG Q+ +  WE +C EHGIQ DG + +    GY DD   +F  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MREVISIHIGQAGTQVGNACWELYCLEHGIQPDGQMPSDKSVGYGDD---AFNTFFSETGAGKHVPRAVFLDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P08537|TBA_XENLA (Tubulin alpha chain OS=Xenopus laevis OX=8355 GN=tuba PE=2 SV=2)

HSP 1 Score: 405.216 bits (1040), Expect = 3.173e-135
Identity = 188/374 (50.27%), Postives = 283/374 (75.67%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEE 1474
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ LT +D+T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  +    E   EE
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSADAEDEGEE 448          

HSP 2 Score: 84.7297 bits (208), Expect = 4.007e-16
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P11480|TBAE_PHYPO (Tubulin alpha-2B chain OS=Physarum polycephalum OX=5791 GN=ALTBE PE=2 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 5.451e-135
Identity = 188/374 (50.27%), Postives = 280/374 (74.87%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEE 1474
            IDEIRTG YR+LFHP+ L+TG EDAANN+ARGH+T+GK  +D  ++RVRK+ + C GL+GF +F+S GGGTGSGF +L+LERL+V++ KK     CV+PS +++T+ VEPYN++L T  L++HTD+    DNE++YD+C  SLDI RP+Y+ LNR+VAQ+ S+L+TS+RF+G LN DI++  TNLVPYPRIHF + +YAP++S++K  H+ L+ ++LT   FD S+ +  C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK GIN QPP  V   ++A+  +++ M++N++AIA+ F  + +KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+  E    +  +EE
Sbjct:   75 IDEIRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKELVDLCLDRVRKLADQCSGLQGFLVFHSVGGGTGSGFGSLLLERLSVDYGKKSKLDFCVYPSPQVSTAVVEPYNSVLSTHGLLEHTDVAFMLDNEAIYDLCKRSLDIERPSYANLNRLVAQVISSLTTSLRFDGALNVDITEFQTNLVPYPRIHFMLASYAPVISAEKAFHEQLSVAELTNTVFDPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAVIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRALCMISNTTAIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEVEFSEAREDLAALEKDYEEVGAETAEDDGADEE 448          

HSP 2 Score: 83.5741 bits (205), Expect = 1.062e-15
Identity = 40/81 (49.38%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MREI+  HIGQAG Q+ +  WE +C EHGI+ DG + +    G  DD   +F  FF E  SG+ VPRAI +DLEP+V+D++
Sbjct:    1 MREILSIHIGQAGAQVGNACWELYCLEHGIKPDGQMPSDKSVGGGDD---AFNTFFSETSSGKHVPRAIFLDLEPTVIDEI 78          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|Q9BQE3|TBA1C_HUMAN (Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=TUBA1C PE=1 SV=1)

HSP 1 Score: 402.134 bits (1032), Expect = 6.639e-134
Identity = 186/374 (49.73%), Postives = 283/374 (75.67%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEE 1474
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ LT +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++A+A+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  +    E   EE
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAVAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSADGEDEGEE 448          

HSP 2 Score: 84.7297 bits (208), Expect = 3.764e-16
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Match: sp|P68373|TBA1C_MOUSE (Tubulin alpha-1C chain OS=Mus musculus OX=10090 GN=Tuba1c PE=1 SV=1)

HSP 1 Score: 401.749 bits (1031), Expect = 7.894e-134
Identity = 188/374 (50.27%), Postives = 285/374 (76.20%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEEL----SEEDDAKEK 1462
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ LT +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+    +E DD  E+
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSAEGDDEGEE 448          

HSP 2 Score: 84.7297 bits (208), Expect = 3.866e-16
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: Q7Z1L8 (Tubulin alpha chain OS=Schmidtea polychroa OX=50054 PE=2 SV=1)

HSP 1 Score: 421.394 bits (1082), Expect = 1.267e-138
Identity = 207/418 (49.52%), Postives = 297/418 (71.05%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEEELKQEDDVKNISTTGVKDHEEEEDELPLSDHEKNMYAHSDSDGE 1606
            +DEIRTG YR+LFHPD L+ G EDAA+NFARGHFTIGK+ ID  + ++RK+V+ C GLEGF + +S+GGGTGSGF  LMLE++ +E+ K++     ++P  +L+TSTVEPYN +L +   ++  +L   FDNES+YDIC  +LDI RPTYS LNR++AQI SA++ S+R+E +LNA++SQI+TNL+PYPRIHF +  Y+P++S+Q+  H+  +  +LTR  F+  +QL+  N+  G++M CCLQYRG++TP+ VNE++FEIKRR+DIKFV+WCPT FK+GINSQPP  +  S +A +  SV M+TNS+AI   + ++  KF +LF+KR+F+HWYVGEGMEE E   + D +  +  DY+E+       E  N+E+L +   V N+S + +K+     +    +D       H D D E
Sbjct:   74 VDEIRTGTYRQLFHPDSLINGEEDAASNFARGHFTIGKSIIDVAMAQLRKVVDNCDGLEGFLMISSYGGGTGSGFQTLMLEKIGIEYAKRLKISVVIYPCPKLSTSTVEPYNAVLTSHFTLEQGELSVFFDNESMYDICTKTLDINRPTYSNLNRLLAQIYSAITVSLRYESSLNANLSQIVTNLIPYPRIHFSMVNYSPIVSAQRAAHEQFSVVELTRNVFEPGSQLLRVNMKVGKYMSCCLQYRGDITPRAVNEAIFEIKRRTDIKFVDWCPTGFKIGINSQPPTLIPGSGLAPSKSSVTMITNSTAIVTMWENINKKFTLLFNKRAFVHWYVGEGMEEGEFNEAIDNISYLLKDYKEV-------EMTNDEDLNKA-TVTNVSHSNIKEVTSYHEPTIDADLGNVYIQHDDEDQE 483          

HSP 2 Score: 103.219 bits (256), Expect = 1.267e-138
Identity = 41/77 (53.25%), Postives = 62/77 (80.52%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            M+EIIC +IGQAG+Q+++ +WE FC EHGI ADG +++G  D ++++F  FF + PS Q+VPR +SIDLEP+V+D++
Sbjct:    1 MKEIICINIGQAGIQMANAIWELFCQEHGITADGKMRSGLTDGDSRAFNTFFFQSPSDQYVPRVLSIDLEPTVVDEI 77          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A0X3NMC8 (Tubulin alpha chain OS=Schistocephalus solidus OX=70667 GN=TBA1C PE=3 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 9.206e-136
Identity = 192/362 (53.04%), Postives = 281/362 (77.62%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            IDEIRTGPYR+LFHP+ L+TG EDAANN+ RGH+TIG+  I+ T+NR+RK+VE C GL+GF  ++SFGGGTGSGF++L+LERL++++ K+   Q  V+P+ +++T+ VEPYN++L + A ++H+D     DNE++YDIC  +LDI RPTY+ LNR++AQ+ S+++ S+RF G LN D+S+  TNLVPYPRIHFP+ TYAP+LS++KV H++L+  +L++A F+ ++QLV C+  +G+FM CC+ YRG+V PKEVN ++  IK R  I+FV+WCPT FK+GIN QPP  V   ++A   ++V ML+N++AI + +  L  KF+++F KR FLHWY GEGMEE E M++ ++M ++  DYEE++
Sbjct:   68 IDEIRTGPYRQLFHPEQLITGKEDAANNYGRGHYTIGRELIELTLNRIRKMVERCSGLQGFVTYHSFGGGTGSGFTSLLLERLSIDYGKRSKLQLSVYPAPQVSTTVVEPYNSILTSHATLEHSDCAFIVDNEAIYDICRRNLDIGRPTYTNLNRLIAQVISSITASLRFNGQLNVDLSEFQTNLVPYPRIHFPLVTYAPVLSAEKVHHEHLSVRELSQACFEPASQLVKCDPRQGKFMSCCMLYRGDVVPKEVNAAIASIKLRQTIQFVDWCPTGFKVGINHQPPTTVPGGDLAAVPRAVCMLSNTTAIVEAWARLGRKFDLMFGKRCFLHWYTGEGMEETEFMDAREDMVMLERDYEEMA 429          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A087VX24 (Tubulin alpha 1 chain OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000040900 PE=3 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 3.132e-135
Identity = 187/364 (51.37%), Postives = 281/364 (77.20%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEE 1444
            IDE+RTG YR+LFHPD L+TG EDAANN+ARGH+T+GK  +D  ++R RK+ + C GL+GF IF+S+GGG+GSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN +LCT + I+H+D C TFDNE+ YDIC  +LDI RPTY+ LNRI+AQ+ S+L++S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP +S++K  H+ LT  +LT A F+ +NQ+V C+   G++M CC+ YRG+V PKEVN S+  +K +  I+FV+WCPT FK+GIN QPP  V   ++A+  +++ M++N++AIA+ +  L +KF+++++KR F+HWYVGEGMEE E   + +++  +  DYEE+ ++
Sbjct:   75 IDEVRTGTYRQLFHPDQLITGKEDAANNYARGHYTVGKEMVDLVLDRTRKVADQCTGLQGFLIFHSYGGGSGSGFTSLLMERLSVDYGKKSKLEYSIYPAPQISTAVVEPYNAILCTHSTIEHSDCCFTFDNEACYDICRRNLDIERPTYTNLNRIIAQVCSSLTSSLRFDGALNVDVTEFQTNLVPYPRIHFPLVTYAPTVSAEKAYHEQLTVPELTNACFEPANQMVKCDPRHGKYMACCMLYRGDVAPKEVNASISTVKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRALCMISNTTAIAEAWARLDHKFDLMYAKRCFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGQD 438          

HSP 2 Score: 81.2629 bits (199), Expect = 1.579e-12
Identity = 41/81 (50.62%), Postives = 52/81 (64.20%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  HIGQ G QI +  WE +C EHGIQ DG + +    G  DD   S+  FF E  +G+ VPRAI +DLEP+V+D+V
Sbjct:    1 MRECISIHIGQGGCQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SYSTFFSETGAGKHVPRAIFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A068WVQ1 (Tubulin alpha 1 chain OS=Echinococcus granulosus OX=6210 GN=EgrG_000040900 PE=3 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 3.132e-135
Identity = 187/364 (51.37%), Postives = 281/364 (77.20%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEE 1444
            IDE+RTG YR+LFHPD L+TG EDAANN+ARGH+T+GK  +D  ++R RK+ + C GL+GF IF+S+GGG+GSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN +LCT + I+H+D C TFDNE+ YDIC  +LDI RPTY+ LNRI+AQ+ S+L++S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP +S++K  H+ LT  +LT A F+ +NQ+V C+   G++M CC+ YRG+V PKEVN S+  +K +  I+FV+WCPT FK+GIN QPP  V   ++A+  +++ M++N++AIA+ +  L +KF+++++KR F+HWYVGEGMEE E   + +++  +  DYEE+ ++
Sbjct:   75 IDEVRTGTYRQLFHPDQLITGKEDAANNYARGHYTVGKEMVDLVLDRTRKVADQCTGLQGFLIFHSYGGGSGSGFTSLLMERLSVDYGKKSKLEYSIYPAPQISTAVVEPYNAILCTHSTIEHSDCCFTFDNEACYDICRRNLDIERPTYTNLNRIIAQVCSSLTSSLRFDGALNVDVTEFQTNLVPYPRIHFPLVTYAPTVSAEKAYHEQLTVPELTNACFEPANQMVKCDPRHGKYMACCMLYRGDVAPKEVNASISTVKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRALCMISNTTAIAEAWARLDHKFDLMYAKRCFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGQD 438          

HSP 2 Score: 81.2629 bits (199), Expect = 1.579e-12
Identity = 41/81 (50.62%), Postives = 52/81 (64.20%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  HIGQ G QI +  WE +C EHGIQ DG + +    G  DD   S+  FF E  +G+ VPRAI +DLEP+V+D+V
Sbjct:    1 MRECISIHIGQGGCQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SYSTFFSETGAGKHVPRAIFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. TrEMBL
Match: A0A1W5YQC0 (Alpha tubulin isotype 3 (Fragment) OS=Echinococcus granulosus OX=6210 PE=3 SV=1)

HSP 1 Score: 410.223 bits (1053), Expect = 5.482e-135
Identity = 187/362 (51.66%), Postives = 279/362 (77.07%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            IDE+RTG YR+LFHPD L+TG EDAANN+ARGH+T+GK  +D  ++R RK+ + C GL+GF IF+S+GGG+GSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN +LCT + I+H+D C TFDNE+ YDIC  +LDI RPTY+ LNRI+AQ+ S+L++S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP +S++K  H+ LT  +LT A F+ +NQ+V C+   G++M CC+ YRG+V PKEVN S+  +K +  I+FV+WCPT FK+GIN QPP  V   ++A+  +++ M++N++AIA+ +  L +KF+++++KR F+HWYVGEGMEE E   + +++  +  DYEE+ 
Sbjct:   60 IDEVRTGTYRQLFHPDQLITGKEDAANNYARGHYTVGKEMVDLVLDRTRKVADQCTGLQGFLIFHSYGGGSGSGFTSLLMERLSVDYGKKSKLEYSIYPAPQISTAVVEPYNAILCTHSTIEHSDCCFTFDNEACYDICRRNLDIERPTYTNLNRIIAQVCSSLTSSLRFDGALNVDVTEFQTNLVPYPRIHFPLVTYAPTVSAEKAYHEQLTVPELTNACFEPANQMVKCDPRHGKYMACCMLYRGDVAPKEVNASISTVKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRALCMISNTTAIAEAWARLDHKFDLMYAKRCFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG 421          

HSP 2 Score: 62.3882 bits (150), Expect = 1.508e-6
Identity = 31/66 (46.97%), Postives = 42/66 (63.64%), Query Frame = 3
Query:   84 ISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            I +  WE +C EHGIQ DG + +    G  DD   S+  FF E  +G+ VPRAI +DLEP+V+D+V
Sbjct:    1 IGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SYSTFFSETGAGKHVPRAIFVDLEPTVIDEV 63          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000042562.1 (tubulin alpha chain [Source:NCBI gene;Acc:103038315])

HSP 1 Score: 402.134 bits (1032), Expect = 6.692e-135
Identity = 187/364 (51.37%), Postives = 278/364 (76.37%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEE 1444
            IDEIRTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R RK+ + C GL+GF IF+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +D+T A F+ SNQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  +
Sbjct:   75 IDEIRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPSNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTD 438          

HSP 2 Score: 82.8037 bits (203), Expect = 1.793e-16
Identity = 40/81 (49.38%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAG Q+ +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRAI +DLEP+V+D++
Sbjct:    1 MRECISMHVGQAGAQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAIFVDLEPTVIDEI 78          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000008906.2 (pep primary_assembly:Astyanax_mexicanus-2.0:22:14648029:14653607:-1 gene:ENSAMXG00000008652.2 transcript:ENSAMXT00000008906.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 400.979 bits (1029), Expect = 2.226e-134
Identity = 186/378 (49.21%), Postives = 283/378 (74.87%), Query Frame = 2
Query:  341 RIYKIDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEE 1474
              + +DE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN +L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ LT +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  +    E   EE
Sbjct:   74 HFFHLDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLTDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSLEGEDEGEE 451          

HSP 2 Score: 69.3218 bits (168), Expect = 3.776e-12
Identity = 38/80 (47.50%), Postives = 48/80 (60.00%), Query Frame = 3
Query:   42 REIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            RE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ + L    LD+V
Sbjct:    5 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFLYLHFFHLDEV 81          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: si:ch73-199e17.1 (tubulin alpha chain-like [Source:NCBI gene;Acc:103038622])

HSP 1 Score: 400.208 bits (1027), Expect = 3.860e-134
Identity = 185/369 (50.14%), Postives = 279/369 (75.61%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKE 1459
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +D+T A F+  NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  +    E
Sbjct:   74 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEVIDAVLDRIRKLTDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRKNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPCNQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDSMGDE 442          

HSP 2 Score: 85.8853 bits (211), Expect = 2.045e-17
Identity = 39/77 (50.65%), Postives = 51/77 (66.23%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAG QI +  WE +C EHGIQ DG + +      + SF  FF E  +G+ VPRAI +DLEP+V+D+V
Sbjct:    1 MRECISVHVGQAGAQIGNACWELYCLEHGIQPDGHMPSEKIPRGDDSFNTFFSETGTGKHVPRAIFVDLEPTVIDEV 77          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: ENSAMXT00000004574.2 (pep primary_assembly:Astyanax_mexicanus-2.0:22:14648029:14655015:-1 gene:ENSAMXG00000008652.2 transcript:ENSAMXT00000004574.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 400.979 bits (1029), Expect = 4.324e-134
Identity = 186/378 (49.21%), Postives = 283/378 (74.87%), Query Frame = 2
Query:  341 RIYKIDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEE 1474
              + +DE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN +L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ LT +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  +    E   EE
Sbjct:   98 HFFHLDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLTDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNAILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSLEGEDEGEE 475          

HSP 2 Score: 69.707 bits (169), Expect = 3.853e-12
Identity = 38/80 (47.50%), Postives = 48/80 (60.00%), Query Frame = 3
Query:   42 REIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            RE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ + L    LD+V
Sbjct:   29 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFLYLHFFHLDEV 105          
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Match: tuba1a (tubulin alpha chain [Source:NCBI gene;Acc:103037973])

HSP 1 Score: 399.438 bits (1025), Expect = 1.220e-133
Identity = 184/362 (50.83%), Postives = 278/362 (76.80%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ S++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+ 
Sbjct:   86 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVG 447          

HSP 2 Score: 82.4185 bits (202), Expect = 2.819e-16
Identity = 41/80 (51.25%), Postives = 53/80 (66.25%), Query Frame = 3
Query:   42 REIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            RE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:   13 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVIDEV 89          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: TUBA3C (tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:12408])

HSP 1 Score: 306.605 bits (784), Expect = 1.899e-102
Identity = 143/277 (51.62%), Postives = 216/277 (77.98%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSF 1183
            +DE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  +D  ++R+RK+ + C GL+GF IF+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +++T A F+ +NQ+V C+   G++M CC+ YRG+V PK+VN ++  IK +  I+FV+WCPT F
Sbjct:   75 VDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCMLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGF 351          

HSP 2 Score: 84.7297 bits (208), Expect = 1.899e-102
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVVDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001139.1 (pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 gene:ENSPMAG00000001018.1 transcript:ENSPMAT00000001139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 234.958 bits (598), Expect = 3.266e-72
Identity = 118/261 (45.21%), Postives = 183/261 (70.11%), Query Frame = 2
Query:  401 MLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSF 1183
            M++ G E  ++   RG    G+      + R R   E C GL+GF +F+SFGGGTGSGF++L++ERL+ ++ KK   + C++P+ +++T+ VEPYN +L T   ++H+D     DNE++YDIC   LDI  P+Y  LNR++AQ+ S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +++T A F+ SNQ+V C+   G++M CCL YRG++ PK+VN ++  IK R  ++FV+WCPT F
Sbjct:   96 MMLAGREVRSSRIWRGQKGGGRKICSRVLRRNRPQSERCTGLQGFLLFHSFGGGTGSGFTSLLMERLSADYGKKSKLEFCIYPAPQVSTAVVEPYNAILTTHTTLEHSDCSFMVDNEAIYDICRKKLDIDFPSYFNLNRLIAQMVSSITASLRFDGALNVDLNEFQTNLVPYPRIHFPLTTYAPVISAEKAYHEQLSVAEITNACFEPSNQMVKCDPRNGKYMACCLLYRGDIVPKDVNTAIAIIKSRRAVRFVDWCPTGF 356          

HSP 2 Score: 77.7962 bits (190), Expect = 1.003e-15
Identity = 39/77 (50.65%), Postives = 49/77 (63.64%), Query Frame = 3
Query:   42 REIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDE--NQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQ 266
            R+ I  HIGQAGVQ+ +  WE +C EHGI+ DG L    +     + SF  FF E  SG+ VPRAI IDLEPSV+ +
Sbjct:    3 RDCISIHIGQAGVQMGNACWELYCLEHGIKPDGHLATHPDVTSVVDSSFNTFFSETGSGKHVPRAIFIDLEPSVIGE 79          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: tubb2 (tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GENE-050522-384])

HSP 1 Score: 212.616 bits (540), Expect = 1.474e-63
Identity = 117/329 (35.56%), Postives = 191/329 (58.05%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCV-FPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKR 1336
            +D +R+GP+ ++F PD  V G   A NN+A+GH+T G   +D  ++ VRK  E C  L+GF + +S GGGTGSG   L++ ++  E+  +V+Y      PS +++ + VEPYN  L    L+++TD     DNE+LYDIC  +L +  PTY  LN +V+   S ++T +RF G LNAD+ ++  N+VP+PR+HF +  +APL S     ++ LT  +LT+  FDS N + +C+   GR++     +RG ++ KEV+E +  ++ ++   FVEW P + K  +   PP             S   + NS+AI + F+ +  +F  +F ++
Sbjct:   55 MDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYIIQVLYTVVASGPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPP--------RGLKMSATFIGNSTAIQELFKRISEQFTAMFRRK 375          

HSP 2 Score: 48.1358 bits (113), Expect = 3.270e-6
Identity = 22/57 (38.60%), Postives = 32/57 (56.14%), Query Frame = 3
Query:   99 WETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            WE    EHGI   G+  +G  D + +    ++ E   G++VPRAI +DLEP  +D V
Sbjct:    3 WEVISDEHGIDPTGSY-HGDSDLQLERINVYYNEASGGKYVPRAILVDLEPGTMDSV 58          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001368.1 (pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-1 gene:ENSPMAG00000001230.1 transcript:ENSPMAT00000001368.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.354 bits (355), Expect = 1.320e-36
Identity = 116/404 (28.71%), Postives = 185/404 (45.79%), Query Frame = 2
Query:  320 TNRKLK*RIYKID-------EIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPS--DRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDIC----------------------CGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVG-EGMEEAEIMNSFDEMRLITLDYEEL 1435
            T R LK R   ID       E+  GP R +F    L+T    + NN+A G+   G  + +  + R+R   E C  L+ FF+ +S GGGTGSG    +L  L  EF     +   ++PS  D + TS   PYN++L    L +H D     +N++L DI                        G L      +  +N IVA +   +++S RFEG+LN D+++I  NLVP+PR+H+ + +  PL +   V         +   AF   NQL+  +     ++ C L  RGNV   +V  ++  +K    + FV+W    +K G+ S PP     S +A        L N++ +   F  +  +F  L+ +++ LH Y   EGME +    +   +  +  +Y +L
Sbjct:   67 TIRSLKARAVLIDMEEGVVNELLQGPLRDVFDQKQLITDVSGSGNNWAVGNKVYGAQFREKILERLRVTAEHCDSLQCFFLIHSMGGGTGSGLGTFVLRLLEDEFPDVHRFVMALYPSAEDDVVTS---PYNSVLAMRELTEHADCVLPIENQALVDIVNKINHAAALGKSVRSQTTLSSSHGCLKGQEKPFDTMNNIVANLMLNMTSSSRFEGSLNVDLNEITMNLVPFPRLHYLVSSLTPLYALADVALPPRRLDQMFSDAFSKENQLLRVDPRRSLYLACALMVRGNVQLSDVRRNIERLK--PSLHFVDWNEEGWKTGLCSVPPVGYPHSLLA--------LANNTCVKHTFADIQERFARLYRRKAHLHHYTDVEGMELSCFTEAASSLASVIEEYNQL 457          
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005307.1 (pep scaffold:Pmarinus_7.0:GL485425:14485:17012:-1 gene:ENSPMAG00000004835.1 transcript:ENSPMAT00000005307.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 2.590e-32
Identity = 40/80 (50.00%), Postives = 51/80 (63.75%), Query Frame = 3
Query:   42 REIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            RE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+  V
Sbjct:    2 RECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSEKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVVGAV 78          

HSP 2 Score: 78.5666 bits (192), Expect = 2.590e-32
Identity = 31/52 (59.62%), Postives = 43/52 (82.69%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIV 508
            +  +RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  +D  ++R+RK+V
Sbjct:   75 VGAVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIVDLVLDRIRKLV 126          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB3 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; expressed at lower level than Tub1p; TUB3 has a paralog, TUB1, that arose from the whole genome duplication [Source:SGD;Acc:S000004593])

HSP 1 Score: 357.836 bits (917), Expect = 1.168e-118
Identity = 166/369 (44.99%), Postives = 266/369 (72.09%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKE 1459
            IDE+RTG +++LFHP+ L+ G EDAANN+ARGH+T+G+  +D    R+RK+ + C GL+GF   +S GGGTGSG  +L+LE L+ E+ KK   +  V+P+ +L+TS VEPYNT+L T   ++H D     DNE++YDIC  +L I RP++S LN ++AQ+ S+++ S+RF+G+LN D+++  TNLVPYPRIHFP+ +YAP+LS ++  H++ + S++T A F+  NQ+V C+ ++G++M  CL YRG+V  ++V  ++ ++K +  ++ V+WCPT FK+GI  +PP  +  SE+A  D++V ML+N++AIA  ++ +  KF+++++KR+F+HWYVGEGMEE E   + +++  +  DY E+  +  A+E
Sbjct:   76 IDEVRTGRFKELFHPEQLINGKEDAANNYARGHYTVGREIVDEVEERIRKMADQCDGLQGFLFTHSLGGGTGSGLGSLLLENLSYEYGKKSKLEFAVYPAPQLSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDICKRNLGISRPSFSNLNGLIAQVISSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYAPILSKKRATHESNSVSEITNACFEPGNQMVKCDPTKGKYMANCLLYRGDVVTRDVQRAVEQVKNKKTVQMVDWCPTGFKIGICYEPPSVIPSSELANVDRAVCMLSNTTAIADAWKRIDQKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYAEE 444          

HSP 2 Score: 82.0333 bits (201), Expect = 4.111e-17
Identity = 38/79 (48.10%), Postives = 53/79 (67.09%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDEN--QSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE+I  ++GQAG QI +  WE +  EHGI+ DG L++G    +   + F  FF E   G+FVPRAI +DLEP+V+D+V
Sbjct:    1 MREVISINVGQAGCQIGNACWELYSLEHGIKEDGHLEDGLSKPKGGEEGFSTFFHETGYGKFVPRAIYVDLEPNVIDEV 79          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB1 (Alpha-tubulin; associates with beta-tubulin (Tub2p) to form tubulin dimer, which polymerizes to form microtubules; relative distribution to nuclear foci increases upon DNA replication stress; TUB1 has a paralog, TUB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004550])

HSP 1 Score: 355.525 bits (911), Expect = 1.170e-117
Identity = 163/370 (44.05%), Postives = 268/370 (72.43%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEK 1462
            IDE+R GPY+ LFHP+ L++G EDAANN+ARGH+T+G+  +   ++R+RK+ + C GL+GF   +S GGGTGSG  +L+LE L+ E+ KK   +  V+P+ +++TS VEPYNT+L T   ++H D     DNE++YD+C  +LDIPRP+++ LN ++AQ+ S+++ S+RF+G+LN D+++  TNLVPYPRIHFP+ +Y+P+LS  K  H++ + S++T A F+  NQ+V C+  +G++M  CL YRG+V  ++V  ++ ++K +  ++ V+WCPT FK+GI  +PP     S++A  D++V ML+N+++IA+ ++ +  KF+++++KR+F+HWYVGEGMEE E   + +++  +  DY E+  +  A+E+
Sbjct:   76 IDEVRNGPYKDLFHPEQLISGKEDAANNYARGHYTVGREILGDVLDRIRKLADQCDGLQGFLFTHSLGGGTGSGLGSLLLEELSAEYGKKSKLEFAVYPAPQVSTSVVEPYNTVLTTHTTLEHADCTFMVDNEAIYDMCKRNLDIPRPSFANLNNLIAQVVSSVTASLRFDGSLNVDLNEFQTNLVPYPRIHFPLVSYSPVLSKSKAFHESNSVSEITNACFEPGNQMVKCDPRDGKYMATCLLYRGDVVTRDVQRAVEQVKNKKTVQLVDWCPTGFKIGICYEPPTATPNSQLATVDRAVCMLSNTTSIAEAWKRIDRKFDLMYAKRAFVHWYVGEGMEEGEFTEAREDLAALERDYIEVGADSYAEEE 445          

HSP 2 Score: 82.0333 bits (201), Expect = 4.045e-17
Identity = 38/79 (48.10%), Postives = 53/79 (67.09%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDEN--QSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE+I  ++GQAG QI +  WE +  EHGI+ DG L++G    +   + F  FF E   G+FVPRAI +DLEP+V+D+V
Sbjct:    1 MREVISINVGQAGCQIGNACWELYSLEHGIKPDGHLEDGLSKPKGGEEGFSTFFHETGYGKFVPRAIYVDLEPNVIDEV 79          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB2 (Beta-tubulin; associates with alpha-tubulin (Tub1p and Tub3p) to form tubulin dimer, which polymerizes to form microtubules; mutation in human ortholog is associated with congenital fibrosis of the extraocular muscles (CFEOM) with polymicrogyria [Source:SGD;Acc:S000001857])

HSP 1 Score: 233.417 bits (594), Expect = 2.066e-77
Identity = 128/376 (34.04%), Postives = 217/376 (57.71%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSE---EDDAKEKVNE 1471
            ID +R      LF PD  + G   A N +A+GH+T G   +D  ++ +R+  E C  L+GF I +S GGGTGSG   L++ ++  EF  +++    V PS + + + VEPYN  L    L++H+D     DNE+LYDIC  +L + +P+Y  LN +V+ + S ++TS+R+ G LN+D+ ++  NLVP+PR+HF +  YAPL +      ++LT  +LT+  FD+ N + + +   GR++     +RG V+ KEV + + +++ ++   FVEW P + +  + S  P  +        D +   + NS++I + F+ + ++F  +F +++FLHWY  EGM+E E   +   M  +  +Y++  E   EDD  E+V+E
Sbjct:   73 IDAVRNSAIGNLFRPDNYIFGQSSAGNVWAKGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVLPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIPNNVQTAVCSVAPQGL--------DMAATFIANSTSIQELFKRVGDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSEYQQYQEATVEDD--EEVDE 438          

HSP 2 Score: 73.9442 bits (180), Expect = 2.066e-77
Identity = 34/77 (44.16%), Postives = 49/77 (63.64%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MREII    GQ G QI +  WET C EHG+  +G   +G++D + +    +F E  SG++VPR+I++DLEP  +D V
Sbjct:    1 MREIIHISTGQCGNQIGAAFWETICGEHGLDFNGTY-HGHDDIQKERLNVYFNEASSGKWVPRSINVDLEPGTIDAV 76          
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Match: TUB4 (Gamma-tubulin; involved in nucleating microtubules from both the cytoplasmic and nuclear faces of the spindle pole body; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004202])

HSP 1 Score: 118.627 bits (296), Expect = 1.494e-35
Identity = 98/351 (27.92%), Postives = 177/351 (50.43%), Query Frame = 2
Query:  377 YRKLFHP--DMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSS---QKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWY-VGEGMEEAE-IMNSFDEMR 1408
            +R  F P    + +    A N++A G + IG    D  +N++ K ++     EGF + +S  GGTGSG  + +LE L   + KK++    VFP+ R +   V+ YNT+L    LI+ +D    FDN SL +I       P       N++++ I S+++ S+RF   + + +S I + L+P P +HF   ++ P  S      + H+  ++ D+     D SN LVS  ++   +        GNV P++++ ++ ++++R  IKF  W  ++  + I  + P    +    + + S  ML+N S +   F +  N F+ +F+K +FL+ Y VG+  +  + + + F E R
Sbjct:   83 FRGFFDPRNTWVASDGASAGNSWANG-YDIGTRNQDDILNKIDKEIDSTDNFEGFQLLHSVAGGTGSGLGSNLLEALCDRYPKKILTTYSVFPA-RSSEVVVQSYNTILALRRLIEDSDATVVFDNASLLNISGKVFRNPNIDLQHTNQLISTIISSVTNSIRFPSYMYSSMSSIYSTLIPSPELHFLSPSFTPFTSDYIHDDIAHKGHSSYDVMLDLLDPSNSLVSTAMNNPTYFNVYNTIIGNVEPRQISRAMTKLQQR--IKFPSWSSSAMHVNIGRRSPYLPLQPN--ENEVSGMMLSNMSTVVNVFENACNTFDKVFAKGAFLNNYNVGDLFQSMQNVQDEFAESR 427          

HSP 2 Score: 48.521 bits (114), Expect = 1.494e-35
Identity = 28/78 (35.90%), Postives = 39/78 (50.00%), Query Frame = 3
Query:   45 EIICGHIGQAGVQISSTVWETFCTEHGIQADGALK---NGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            EII    GQ G  +   +W     EH I  DG  +   +  E D++   + FF+E    +F PRAI +D EPSV+  V
Sbjct:    4 EIITLQAGQCGNHVGKFLWSQLAKEHAIGTDGLSQLPDSSTERDDDT--KPFFRENSRNKFTPRAIMMDSEPSVIADV 79          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO40781 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6A0])

HSP 1 Score: 399.438 bits (1025), Expect = 1.856e-134
Identity = 185/362 (51.10%), Postives = 280/362 (77.35%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            IDEIRTG YR+LFHP+ L+TG EDAANN+ARGH+T+GK++ID  ++R+RK+ + C GL+GF IF+SFGGGTGSGFS+L++ERL+V++ KK   +  V+P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ LT +++T + F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+ 
Sbjct:   60 IDEIRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKDHIDNVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAVYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNSCFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG 421          

HSP 2 Score: 62.7734 bits (151), Expect = 1.901e-10
Identity = 30/66 (45.45%), Postives = 42/66 (63.64%), Query Frame = 3
Query:   84 ISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            + +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEPSV+D++
Sbjct:    1 MGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPSVIDEI 63          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO46332 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQB6])

HSP 1 Score: 399.438 bits (1025), Expect = 3.174e-134
Identity = 185/376 (49.20%), Postives = 283/376 (75.27%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEEEL 1480
            IDEIRTG YR+LFHP+ +VTG EDAANN+ARGH+T+GK  ID  ++++RK+ + C GL+GF +F+SFGGGTGSGFS+L++ERL+V++ K+   +  V+P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++ + K  H+N++ +++T A F+ SNQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+  +      V+E+E 
Sbjct:   75 IDEIRTGTYRQLFHPEQMVTGKEDAANNYARGHYTVGKELIDVVLDKIRKLADQCTGLQGFLVFHSFGGGTGSGFSSLLMERLSVDYGKRSKLEFAVYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSVTASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVIGADKAYHENMSVAEITSACFEPSNQMVKCDPRYGKYMACCLLYRGDVVPKDVNSAIAAIKMKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGADSPDDSVVDEDEF 450          

HSP 2 Score: 87.4261 bits (215), Expect = 2.279e-18
Identity = 39/78 (50.00%), Postives = 53/78 (67.95%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDE-NQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE +  H+GQAGVQI +  WE +C EHGIQ DG + +    D  + SF  FF E  SG+ VPRA+ +DLEP+V+D++
Sbjct:    1 MRECLSIHVGQAGVQIGNACWELYCLEHGIQPDGHMPSDQSADRCDDSFSTFFSETASGKHVPRAVFVDLEPTVIDEI 78          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO44766 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUX0])

HSP 1 Score: 397.127 bits (1019), Expect = 7.540e-134
Identity = 184/362 (50.83%), Postives = 275/362 (75.97%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            +DE+R G YR LFHPD L+TG EDAANN+ARGH+T+GK +ID T+ ++RK+ + C GL+GF IF+SFGGGTGSGFS+L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ LT +D+T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN Q P  V   ++A+  +SV ML+N++AIA  +  L +KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+ 
Sbjct:   40 VDEVRMGTYRDLFHPDQLITGKEDAANNYARGHYTVGKEHIDLTLEKIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQQPTAVPGGDLAKVQRSVCMLSNTTAIADAWARLNHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG 401          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO44557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVD9])

HSP 1 Score: 397.127 bits (1019), Expect = 1.497e-133
Identity = 183/362 (50.55%), Postives = 277/362 (76.52%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            +DE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R RK+ + C GL+GF IF+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN S+  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+ 
Sbjct:   60 VDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRCRKLADQCTGLQGFLIFHSFGGGTGSGFASLLMERLSVDYGKKSKLEFAIYPAPQISTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIDRPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSSIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG 421          

HSP 2 Score: 62.003 bits (149), Expect = 3.020e-10
Identity = 30/66 (45.45%), Postives = 42/66 (63.64%), Query Frame = 3
Query:   84 ISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            + +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVVDEV 63          
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Match: EDO44804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT1])

HSP 1 Score: 396.741 bits (1018), Expect = 3.112e-133
Identity = 182/362 (50.28%), Postives = 278/362 (76.80%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            +DE+RTG YR+LFHP+ L+TG EDAANN+ARGH+T+GK  +D  ++R+RK+ + C GL+GF IF+SFGGGTGSGFS+L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ LT +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+ 
Sbjct:   75 VDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEIVDLVLDRIRKLADQCTGLQGFLIFHSFGGGTGSGFSSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLTVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVG 436          

HSP 2 Score: 84.7297 bits (208), Expect = 1.859e-17
Identity = 42/81 (51.85%), Postives = 54/81 (66.67%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRA+ +DLEP+V+D+V
Sbjct:    1 MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAVFVDLEPTVVDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000003572.2 (tubulin alpha chain [Source:NCBI gene;Acc:101171518])

HSP 1 Score: 405.216 bits (1040), Expect = 4.301e-136
Identity = 189/374 (50.53%), Postives = 282/374 (75.40%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEE 1474
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+T+GK  ID  ++R RK+ + C GL+GF IF+SFGGGTGSGF++L++ERL+V++ KK   +  V+P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +D+T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK R  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  +   +E   EE
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTVGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIASIKTRRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTDSVGEEDEGEE 448          

HSP 2 Score: 83.5741 bits (205), Expect = 1.196e-16
Identity = 41/81 (50.62%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAG Q+ +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRAI +DLEP+V+D+V
Sbjct:    1 MRECISMHVGQAGAQMGNACWELYCLEHGIQPDGRMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAIFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020157.2 (tubulin alpha-1A chain-like [Source:NCBI gene;Acc:101166346])

HSP 1 Score: 400.208 bits (1027), Expect = 9.871e-135
Identity = 187/373 (50.13%), Postives = 282/373 (75.60%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS----EEDDAKE 1459
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R RK+ + C GL+GF IF+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +D+T   F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + +++  +  DYEE+     E+DD +E
Sbjct:   40 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNTCFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGTDNVEDDDGEE 412          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000028969.1 (tubulin alpha-1C chain-like [Source:NCBI gene;Acc:101160296])

HSP 1 Score: 400.979 bits (1029), Expect = 1.597e-134
Identity = 187/374 (50.00%), Postives = 285/374 (76.20%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEE-----LSEEDDAKE 1459
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RP+Y+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ S++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE     L +ED+ +E
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKELIDVVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPSYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVSEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGADSLEDEDEGEE 448          

HSP 2 Score: 84.7297 bits (208), Expect = 5.252e-17
Identity = 43/81 (53.09%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAGVQI +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+  PRAI IDLEP+V+D+V
Sbjct:    1 MRECISVHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGRGDD---SFNTFFSETGAGKHSPRAIFIDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: ENSORLT00000020049.2 (tubulin alpha-1B chain [Source:NCBI gene;Acc:101159587])

HSP 1 Score: 399.438 bits (1025), Expect = 2.136e-134
Identity = 183/362 (50.55%), Postives = 279/362 (77.07%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELS 1438
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R+RK+ + C GL+GF +F+SFGGGTGSGF++L++ERL+V++ KK   +  ++P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR+++QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +++T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+ 
Sbjct:   40 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVKRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVG 401          
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Match: tuba8l3 (tubulin alpha chain [Source:NCBI gene;Acc:101168255])

HSP 1 Score: 400.208 bits (1027), Expect = 3.407e-134
Identity = 186/364 (51.10%), Postives = 278/364 (76.37%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEE 1444
            IDE+RTG YR+LFHP+ L+TG EDAANN+ARGH+TIGK  ID  ++R RK+ + C GL+GF IF+SFGGGTGSGF++L++ERL+V++ KK   +  V+P+ +++T+ VEPYN++L T   ++H+D     DNE++YDIC  +LDI RPTY+ LNR++ QI S+++ S+RF+G LN D+++  TNLVPYPRIHFP+ TYAP++S++K  H+ L+ +D+T A F+ +NQ+V C+   G++M CCL YRG+V PK+VN ++  IK +  I+FV+WCPT FK+GIN QPP  V   ++A+  ++V ML+N++AIA+ +  L +KF+++++KR+F+HWYVGEGMEE E   + ++M  +  DYEE+  +
Sbjct:   75 IDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLDRTRKLADQCTGLQGFLIFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFAVYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITASLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVADITNACFEPANQMVKCDPRHGKYMACCLLYRGDVVPKDVNSAIAAIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGTD 438          

HSP 2 Score: 83.5741 bits (205), Expect = 1.246e-16
Identity = 41/81 (50.62%), Postives = 53/81 (65.43%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN----GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE I  H+GQAG Q+ +  WE +C EHGIQ DG + +    G  DD   SF  FF E  +G+ VPRAI +DLEP+V+D+V
Sbjct:    1 MRECISMHVGQAGAQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDD---SFNTFFSETGAGKHVPRAIFVDLEPTVIDEV 78          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000020613.1 (SMESG000020613.1)

HSP 1 Score: 854.358 bits (2206), Expect = 0.000e+0
Identity = 431/432 (99.77%), Postives = 432/432 (100.00%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEEELKQEDDVKNISTTGVKDHEEEEDELPLSDHEKNMYAHSDSDGEFKPLKKDNNDDYDF 1648
            +DEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEGFFIFNSFGGGTGSGFSALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEEELKQEDDVKNISTTGVKDHEEEEDELPLSDHEKNMYAHSDSDGEFKPLKKDNNDDYDF
Sbjct:   74 LDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEGFFIFNSFGGGTGSGFSALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEEELKQEDDVKNISTTGVKDHEEEEDELPLSDHEKNMYAHSDSDGEFKPLKKDNNDDYDF 505          

HSP 2 Score: 163.31 bits (412), Expect = 1.332e-43
Identity = 75/77 (97.40%), Postives = 77/77 (100.00%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLD++
Sbjct:    1 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDEI 77          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000009421.1 (SMESG000009421.1)

HSP 1 Score: 438.728 bits (1127), Expect = 3.484e-149
Identity = 209/367 (56.95%), Postives = 287/367 (78.20%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDA 1453
            +DE+RTG YR L+HPD L++G EDAANN+ARGHFT+GK  ID T+ R+R+ V+MC  L+GFFI NSFGGGTGSGF AL++ER+ VE+TK+  +Q  + PS+ +AT+ VEPYN+LL   +  +H ++C   DNE++Y +   +LDI RPTY+ LNRI+AQ+ S+LS S+R+E  LNAD  QIITNLVPYPRIH+P+  Y+P++S ++  H+ L+T ++TR+ FD  +Q+VS  +S+GR+M CCLQYRGNVTPK+VN ++FEIKRR+D+KFVEWCPT FKLGIN QPP  V  SE+AQT +SV ML+N++A++Q + ++  KF++LFSKRSF+HWYVGEGMEE E   + DEM  +  DYEE++ ++  
Sbjct:   74 LDEVRTGAYRNLWHPDQLISGSEDAANNYARGHFTLGKLLIDATVERIRRAVDMCDRLQGFFIINSFGGGTGSGFGALLIERIGVEYTKRPKFQVVIVPSNHMATAVVEPYNSLLSLNSSTEHAEICNMTDNEAVYQLLTNTLDISRPTYNNLNRILAQVFSSLSVSLRYESLLNADFDQIITNLVPYPRIHYPVCNYSPIVSVRRAEHEQLSTHEITRSIFDDQSQMVSIKISDGRYMACCLQYRGNVTPKDVNNAVFEIKRRTDVKFVEWCPTGFKLGINCQPPTAVPGSELAQTIRSVTMLSNTTAVSQIWGNIGRKFDVLFSKRSFVHWYVGEGMEEGEFNEAKDEMTSLIQDYEEIASDEGG 440          

HSP 2 Score: 110.153 bits (274), Expect = 3.484e-149
Identity = 48/77 (62.34%), Postives = 61/77 (79.22%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            M EIIC + GQAGVQ+S+  WE FC EHGIQA+G LK    + ++ +F+ FFQE+P GQ+VPRAISIDLEP+VLD+V
Sbjct:    1 MPEIICINTGQAGVQLSNAAWELFCIEHGIQANGLLKENLRNGDSMAFKTFFQEVPGGQYVPRAISIDLEPTVLDEV 77          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000010593.1 (SMESG000010593.1)

HSP 1 Score: 407.912 bits (1047), Expect = 7.600e-142
Identity = 211/414 (50.97%), Postives = 299/414 (72.22%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSE--EDDAKEKVNEEELKQEDDV---KNISTTGVKDHEEEEDELPLSDHEKNM 1579
            IDEIR+GPYR LFHPD L++  ED A+NFAR  FTIGK  I+   N VRK+V+ C  L+GFF+ +S  GGTGSGF+ L L+ L +E+TK+  +Q  VFPS  L+T+ VEP+NT L +   +++ D+    DNE++Y+I    L+IPRPT+S +NR+++Q+ S ++TS+RFEG+LN+D++Q+ TNL+PYPRIHFP+  + PL S  K  H+ LTT+ LT+  FD ++Q+VSC L+EG++MCC L YRG +TPKEVN+++FEIKR+++IKFV+WCPT FKLGIN+QPP     SEIA +DKSV ML NS++I   +  +++KF+ILFSKRSF+HWYVGEGMEE E   + DE+  I LDY EL +  E+  +E V EE +   +D+      +   V + E+E+ E  +++ E N+
Sbjct:   74 IDEIRSGPYRNLFHPDQLISSNEDGASNFARAFFTIGKRQIENLTNTVRKLVDACEMLQGFFLIHSVSGGTGSGFTTLALDTLTLEYTKRNKFQMSVFPSPMLSTAVVEPFNTSLSSVRALENCDITNIMDNEAIYNISNACLNIPRPTFSNINRVISQVFSDMTTSLRFEGSLNSDLNQLCTNLIPYPRIHFPVCCHTPLTSPSKAEHEPLTTATLTKNLFDKNSQMVSCTLNEGKYMCCVLMYRGRITPKEVNQAIFEIKRKNEIKFVDWCPTGFKLGINNQPPIMAPGSEIAPSDKSVTMLANSTSIKDIWEKIMSKFDILFSKRSFVHWYVGEGMEEGEFNEARDELNGIYLDYCELEDTGEERQEEGVTEEAVPATEDLGVDAGATEPTVNEDEKEKSEEAVANDEGNV 487          

HSP 2 Score: 116.701 bits (291), Expect = 7.600e-142
Identity = 50/77 (64.94%), Postives = 62/77 (80.52%), Query Frame = 3
Query:   39 MREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            MRE+IC +IGQAGVQ+S+  WE FC EHGI+A+G LK     DE  SFR FFQE+P+GQFVPR ISIDLEP+V+D++
Sbjct:    1 MREVICINIGQAGVQLSNAAWELFCMEHGIEANGLLKENLSLDETDSFRTFFQEVPTGQFVPRTISIDLEPTVIDEI 77          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000029549.1 (SMESG000029549.1)

HSP 1 Score: 419.853 bits (1078), Expect = 1.496e-139
Identity = 202/391 (51.66%), Postives = 290/391 (74.17%), Query Frame = 2
Query:  356 DEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEEELKQEDDVKNISTTGVKD 1528
            DEIRTG YR+LFHPD L+ G EDAA+NFARGHFTIGK+ ID  + ++RK+V+ C GLEGF + +S+GGGTGSGF  LMLE++ +E+ K++     ++P  +L+TSTVEPYN +L +   ++  +L   FDNES+YDIC  +LDI RPTYS LNR++AQI SA++ S+R+E +LNA+++QI+TNL+PYPRIHF +  Y+P++S+Q+  H+  +  +LTR  F+ S+QL+  N+  G++M CCLQYRG++TP+ VNE++FEIKRR+DIKFV+WCPT FK+GINSQPP  +  S +A +  SV M+TNS+AI   + ++  KF +LF+KR+F+HWYVGEGMEE E   + D +  +  DY E+       E  N+E+L +  +V N+S + +K+
Sbjct:  209 DEIRTGTYRQLFHPDSLINGEEDAASNFARGHFTIGKSIIDSAMAQLRKVVDNCDGLEGFLMISSYGGGTGSGFQTLMLEKIGIEYAKRLKISVVIYPCPKLSTSTVEPYNAVLTSHFTLEQGELSVFFDNESMYDICSKTLDINRPTYSNLNRLLAQIYSAITVSLRYESSLNANLNQIVTNLIPYPRIHFSMVNYSPIVSTQRAAHEQFSVVELTRNVFEPSSQLLRVNMKVGKYMSCCLQYRGDITPRAVNEAIFEIKRRTDIKFVDWCPTGFKIGINSQPPTLIPGSGLAPSKSSVTMITNSTAIVTMWENINKKFTLLFNKRAFVHWYVGEGMEEGEFNEAIDNISYLLKDYREV-------EMTNDEDLNKA-NVTNVSHSNIKE 591          

HSP 2 Score: 124.02 bits (310), Expect = 8.467e-46
Identity = 68/126 (53.97%), Postives = 96/126 (76.19%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDL 730
            +DEIRTG YR+LFHPD L+ G EDAA+NFARGHFTIGK+ ID  + ++RK+V+ C GLEGF + +S+GGGTGSGF  LMLE++ +E+ K++     ++P  +L+TSTVEPYN +L +   ++  +L
Sbjct:   59 VDEIRTGTYRQLFHPDSLINGEEDAASNFARGHFTIGKSIIDSAMAQLRKVVDNCDGLEGFLMISSYGGGTGSGFQTLMLEKIGIEYAKRLKISVVIYPCPKLSTSTVEPYNAVLTSHFTLEQGEL 184          

HSP 3 Score: 80.1073 bits (196), Expect = 8.467e-46
Identity = 30/62 (48.39%), Postives = 49/62 (79.03%), Query Frame = 3
Query:   84 ISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            +++ +WE FC EHGI ADG +++G +D ++++F  FF + PS Q+VPR +SIDLEP+V+D++
Sbjct:    1 MANAIWELFCQEHGITADGKMRSGLQDGDSRAFNTFFFQSPSDQYVPRVLSIDLEPTVVDEI 62          
BLAST of Tubulin alpha chain vs. Planmine SMEST
Match: SMESG000029549.1 (SMESG000029549.1)

HSP 1 Score: 419.853 bits (1078), Expect = 1.723e-139
Identity = 202/391 (51.66%), Postives = 290/391 (74.17%), Query Frame = 2
Query:  356 DEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALSTSVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSDLTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSDIKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRSLLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDDAKEKVNEEELKQEDDVKNISTTGVKD 1528
            DEIRTG YR+LFHPD L+ G EDAA+NFARGHFTIGK+ ID  + ++RK+V+ C GLEGF + +S+GGGTGSGF  LMLE++ +E+ K++     ++P  +L+TSTVEPYN +L +   ++  +L   FDNES+YDIC  +LDI RPTYS LNR++AQI SA++ S+R+E +LNA+++QI+TNL+PYPRIHF +  Y+P++S+Q+  H+  +  +LTR  F+ S+QL+  N+  G++M CCLQYRG++TP+ VNE++FEIKRR+DIKFV+WCPT FK+GINSQPP  +  S +A +  SV M+TNS+AI   + ++  KF +LF+KR+F+HWYVGEGMEE E   + D +  +  DY E+       E  N+E+L +  +V N+S + +K+
Sbjct:  218 DEIRTGTYRQLFHPDSLINGEEDAASNFARGHFTIGKSIIDSAMAQLRKVVDNCDGLEGFLMISSYGGGTGSGFQTLMLEKIGIEYAKRLKISVVIYPCPKLSTSTVEPYNAVLTSHFTLEQGELSVFFDNESMYDICSKTLDINRPTYSNLNRLLAQIYSAITVSLRYESSLNANLNQIVTNLIPYPRIHFSMVNYSPIVSTQRAAHEQFSVVELTRNVFEPSSQLLRVNMKVGKYMSCCLQYRGDITPRAVNEAIFEIKRRTDIKFVDWCPTGFKIGINSQPPTLIPGSGLAPSKSSVTMITNSTAIVTMWENINKKFTLLFNKRAFVHWYVGEGMEEGEFNEAIDNISYLLKDYREV-------EMTNDEDLNKA-NVTNVSHSNIKE 600          

HSP 2 Score: 132.88 bits (333), Expect = 1.706e-48
Identity = 73/135 (54.07%), Postives = 102/135 (75.56%), Query Frame = 2
Query:  353 IDEIRTGPYRKLFHPDMLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEXXXXXXXXXXXXXXXXXALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLCTTALIDHTDLCGTFDNESL 757
            +DEIRTG YR+LFHPD L+ G EDAA+NFARGHFTIGK+ ID  + ++RK+V+ C GLEGF + +S+GGGTGSGF  LMLE++ +E+ K++     ++P  +L+TSTVEPYN +L +   ++  +L   FDNES+
Sbjct:   59 VDEIRTGTYRQLFHPDSLINGEEDAASNFARGHFTIGKSIIDSAMAQLRKVVDNCDGLEGFLMISSYGGGTGSGFQTLMLEKIGIEYAKRLKISVVIYPCPKLSTSTVEPYNAVLTSHFTLEQGELSVFFDNESM 193          

HSP 3 Score: 80.1073 bits (196), Expect = 1.706e-48
Identity = 30/62 (48.39%), Postives = 49/62 (79.03%), Query Frame = 3
Query:   84 ISSTVWETFCTEHGIQADGALKNGYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQV 269
            +++ +WE FC EHGI ADG +++G +D ++++F  FF + PS Q+VPR +SIDLEP+V+D++
Sbjct:    1 MANAIWELFCQEHGITADGKMRSGLQDGDSRAFNTFFFQSPSDQYVPRVLSIDLEPTVVDEI 62          
The following BLAST results are available for this feature:
BLAST of Tubulin alpha chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA1C1.382e-13449.73tubulin alpha 1c [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA4A2.798e-13450.00tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:1240... [more]
TUBA4A3.504e-13450.00tubulin alpha 4a [Source:HGNC Symbol;Acc:HGNC:1240... [more]
TUBA1A5.282e-13450.55tubulin alpha 1a [Source:HGNC Symbol;Acc:HGNC:2076... [more]
TUBA1B2.711e-13350.55tubulin alpha 1b [Source:HGNC Symbol;Acc:HGNC:1880... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tba-92.409e-13349.87Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
tba-41.614e-12947.86Tubulin alpha chain [Source:UniProtKB/TrEMBL;Acc:... [more]
mec-122.712e-12948.66Tubulin alpha-3 chain Detyrosinated tubulin alpha-... [more]
tba-24.704e-12948.36Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
tba-24.704e-12948.36Tubulin alpha-2 chain [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
alphaTub84B1.231e-13249.72gene:FBgn0003884 transcript:FBtr0081639[more]
alphaTub85E1.981e-13248.80gene:FBgn0003886 transcript:FBtr0082087[more]
alphaTub84D1.742e-13149.72gene:FBgn0003885 transcript:FBtr0081538[more]
alphaTub67C3.471e-12247.59gene:FBgn0087040 transcript:FBtr0076393[more]
CG77941.495e-9640.52gene:FBgn0038565 transcript:FBtr0083540[more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tuba1b2.589e-13550.53tubulin, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030822... [more]
tuba1b2.589e-13550.53tubulin, alpha 1b [Source:ZFIN;Acc:ZDB-GENE-030822... [more]
tuba8l31.648e-13451.10tubulin, alpha 8 like 3 [Source:ZFIN;Acc:ZDB-GENE-... [more]
tuba8l42.433e-13451.10tubulin, alpha 8 like 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
si:ch73-199e17.15.075e-13450.83si:ch73-199e17.1 [Source:ZFIN;Acc:ZDB-GENE-100921-... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tubal3.15.401e-13852.47tubulin, alpha 4 [Source:NCBI gene;Acc:407878][more]
tuba1c2.582e-13550.00tubulin alpha 1c [Source:NCBI gene;Acc:394675][more]
tuba3e5.771e-13451.65tubulin alpha 3e [Source:NCBI gene;Acc:548558][more]
tuba3e9.581e-13451.65tubulin alpha 3e [Source:NCBI gene;Acc:548558][more]
pex11.462e-13350.82peroxisomal biogenesis factor 1 [Source:Xenbase;Ac... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tuba1c1.129e-13450.27tubulin, alpha 1C [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba4a2.406e-13450.00tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba4a3.385e-13450.00tubulin, alpha 4A [Source:MGI Symbol;Acc:MGI:10954... [more]
Tuba1b1.861e-13350.55tubulin, alpha 1B [Source:MGI Symbol;Acc:MGI:10780... [more]
Tuba1a2.718e-13350.55tubulin, alpha 1A [Source:MGI Symbol;Acc:MGI:98869... [more]
back to top
BLAST of Tubulin alpha chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50258|TBAD_PHYPO2.641e-13551.20Tubulin alpha-1A chain OS=Physarum polycephalum OX... [more]
sp|P08537|TBA_XENLA3.173e-13550.27Tubulin alpha chain OS=Xenopus laevis OX=8355 GN=t... [more]
sp|P11480|TBAE_PHYPO5.451e-13550.27Tubulin alpha-2B chain OS=Physarum polycephalum OX... [more]
sp|Q9BQE3|TBA1C_HUMAN6.639e-13449.73Tubulin alpha-1C chain OS=Homo sapiens OX=9606 GN=... [more]
sp|P68373|TBA1C_MOUSE7.894e-13450.27Tubulin alpha-1C chain OS=Mus musculus OX=10090 GN... [more]
back to top
BLAST of Tubulin alpha chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q7Z1L81.267e-13849.52Tubulin alpha chain OS=Schmidtea polychroa OX=5005... [more]
A0A0X3NMC89.206e-13653.04Tubulin alpha chain OS=Schistocephalus solidus OX=... [more]
A0A087VX243.132e-13551.37Tubulin alpha 1 chain OS=Echinococcus multilocular... [more]
A0A068WVQ13.132e-13551.37Tubulin alpha 1 chain OS=Echinococcus granulosus O... [more]
A0A1W5YQC05.482e-13551.66Alpha tubulin isotype 3 (Fragment) OS=Echinococcus... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000042562.16.692e-13551.37tubulin alpha chain [Source:NCBI gene;Acc:10303831... [more]
ENSAMXT00000008906.22.226e-13449.21pep primary_assembly:Astyanax_mexicanus-2.0:22:146... [more]
si:ch73-199e17.13.860e-13450.14tubulin alpha chain-like [Source:NCBI gene;Acc:103... [more]
ENSAMXT00000004574.24.324e-13449.21pep primary_assembly:Astyanax_mexicanus-2.0:22:146... [more]
tuba1a1.220e-13350.83tubulin alpha chain [Source:NCBI gene;Acc:10303797... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TUBA3C1.899e-10251.62tubulin alpha 3c [Source:HGNC Symbol;Acc:HGNC:1240... [more]
ENSPMAT00000001139.13.266e-7245.21pep scaffold:Pmarinus_7.0:GL478075:30403:34872:1 g... [more]
tubb21.474e-6335.56tubulin, beta 2A class IIa [Source:ZFIN;Acc:ZDB-GE... [more]
ENSPMAT00000001368.11.320e-3628.71pep scaffold:Pmarinus_7.0:GL476337:866089:875956:-... [more]
ENSPMAT00000005307.12.590e-3250.00pep scaffold:Pmarinus_7.0:GL485425:14485:17012:-1 ... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
TUB31.168e-11844.99Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB11.170e-11744.05Alpha-tubulin; associates with beta-tubulin (Tub2p... [more]
TUB22.066e-7734.04Beta-tubulin; associates with alpha-tubulin (Tub1p... [more]
TUB41.494e-3527.92Gamma-tubulin; involved in nucleating microtubules... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO407811.856e-13451.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463323.174e-13449.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447667.540e-13450.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445571.497e-13350.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448043.112e-13350.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tubulin alpha chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000003572.24.301e-13650.53tubulin alpha chain [Source:NCBI gene;Acc:10117151... [more]
ENSORLT00000020157.29.871e-13550.13tubulin alpha-1A chain-like [Source:NCBI gene;Acc:... [more]
ENSORLT00000028969.11.597e-13450.00tubulin alpha-1C chain-like [Source:NCBI gene;Acc:... [more]
ENSORLT00000020049.22.136e-13450.55tubulin alpha-1B chain [Source:NCBI gene;Acc:10115... [more]
tuba8l33.407e-13451.10tubulin alpha chain [Source:NCBI gene;Acc:10116825... [more]
back to top
BLAST of Tubulin alpha chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020613.11.332e-4399.77SMESG000020613.1[more]
SMESG000009421.13.484e-14956.95SMESG000009421.1[more]
SMESG000010593.17.600e-14250.97SMESG000010593.1[more]
SMESG000029549.11.496e-13951.66SMESG000029549.1[more]
SMESG000029549.11.723e-13951.66SMESG000029549.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014215 ID=SMED30014215|Name=Tubulin alpha chain|organism=Schmidtea mediterranea sexual|type=transcript|length=1811bp
TCCGATCTAATAAATTGAATAAAATTGTAATTGAAACTATGCGTGAAATA
ATTTGTGGTCACATTGGCCAAGCTGGAGTTCAAATTTCTAGCACGGTATG
GGAGACGTTTTGCACTGAGCATGGAATTCAAGCAGATGGGGCTTTAAAAA
ATGGCTACGAGGATGATGAAAATCAGAGCTTTCGTGCATTTTTCCAAGAA
ATACCAAGTGGTCAATTTGTTCCAAGAGCAATTTCTATAGACTTGGAGCC
TTCAGTTTTAGATCAGGTTTGGCCAAAAGCTTCAGTTCACGTGCCAAAAT
GAACATAAAAAACTCGTAGACCAACCGGAAATTGAAATAAAGAATATATA
AAATAGATGAAATCAGAACTGGACCTTATAGGAAACTCTTTCATCCGGAT
ATGTTGGTAACTGGCTGCGAAGACGCGGCAAACAATTTTGCTCGAGGCCA
CTTTACAATAGGAAAAAATTACATTGACTATACAATTAATAGGGTCAGAA
AAATTGTTGAAATGTGTGGAGGCTTAGAAGGATTTTTTATATTTAATAGC
TTTGGTGGAGGCACCGGATCCGGATTTTCCGCTTTAATGCTGGAAAGGTT
GAATGTTGAATTTACCAAAAAAGTAATTTATCAAAGTTGCGTGTTTCCCA
GTGATAGGCTAGCTACGTCAACGGTGGAACCATATAACACATTACTTTGC
ACCACAGCTTTAATTGATCATACAGATCTCTGTGGAACCTTTGACAATGA
ATCCTTATATGATATATGTTGCGGTAGTCTTGATATACCGAGACCAACAT
ATAGTGGACTAAATCGAATAGTCGCTCAAATAACCAGTGCCCTTTCAACT
TCCGTTAGGTTTGAAGGCACTTTAAATGCCGATATATCACAAATTATAAC
AAATTTAGTGCCTTACCCTAGGATACATTTTCCTATTTTCACGTACGCTC
CGTTACTTTCATCACAAAAAGTTCTTCACCAAAATTTGACCACTTCAGAT
TTAACAAGAGCCGCCTTCGATTCTTCTAATCAATTAGTTTCATGTAACTT
ATCAGAAGGTCGATTCATGTGTTGTTGCTTGCAATACAGAGGAAATGTAA
CACCAAAAGAAGTCAACGAATCTTTATTTGAAATAAAACGAAGAAGTGAT
ATAAAATTCGTAGAATGGTGTCCAACAAGCTTTAAACTCGGTATAAATTC
TCAACCTCCACCATTCGTAACTAAATCAGAAATTGCTCAAACTGATAAAA
GTGTAGCAATGCTTACTAATTCCAGTGCGATTGCACAAAAGTTTCGGAGT
CTCCTGAACAAATTTGAAATTCTTTTTAGTAAACGTTCTTTTTTGCATTG
GTATGTAGGCGAAGGCATGGAAGAAGCTGAAATCATGAATTCATTCGACG
AAATGAGATTAATTACATTAGACTATGAGGAATTATCAGAGGAAGATGAC
GCTAAAGAAAAGGTTAATGAAGAAGAATTGAAACAAGAGGATGATGTCAA
AAATATCTCTACAACAGGAGTGAAAGATCACGAAGAAGAAGAAGATGAAC
TGCCTTTATCTGACCATGAAAAGAATATGTACGCACATTCAGATTCTGAC
GGGGAATTCAAACCGTTGAAGAAAGACAACAATGACGATTATGATTTCTA
AGTGCAAATCCATTATTTAAAACAATACATTTTACGTTGTATGAATCTAC
CAGTGAATCTCTTTTGATAATTTTTTGTCAAAGTGAAAATTACTTTAAAA
AATTTAAATTATAATCTGAAAACTCTTTGTAAATTTTAAAATAAATCTTC
ATCAGTTGACA
back to top

protein sequence of SMED30014215-orf-1

>SMED30014215-orf-1 ID=SMED30014215-orf-1|Name=SMED30014215-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=100bp
RSNKLNKIVIETMREIICGHIGQAGVQISSTVWETFCTEHGIQADGALKN
GYEDDENQSFRAFFQEIPSGQFVPRAISIDLEPSVLDQVWPKASVHVPK*
back to top

protein sequence of SMED30014215-orf-2

>SMED30014215-orf-2 ID=SMED30014215-orf-2|Name=SMED30014215-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=417bp
MLVTGCEDAANNFARGHFTIGKNYIDYTINRVRKIVEMCGGLEGFFIFNS
FGGGTGSGFSALMLERLNVEFTKKVIYQSCVFPSDRLATSTVEPYNTLLC
TTALIDHTDLCGTFDNESLYDICCGSLDIPRPTYSGLNRIVAQITSALST
SVRFEGTLNADISQIITNLVPYPRIHFPIFTYAPLLSSQKVLHQNLTTSD
LTRAAFDSSNQLVSCNLSEGRFMCCCLQYRGNVTPKEVNESLFEIKRRSD
IKFVEWCPTSFKLGINSQPPPFVTKSEIAQTDKSVAMLTNSSAIAQKFRS
LLNKFEILFSKRSFLHWYVGEGMEEAEIMNSFDEMRLITLDYEELSEEDD
AKEKVNEEELKQEDDVKNISTTGVKDHEEEEDELPLSDHEKNMYAHSDSD
GEFKPLKKDNNDDYDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR037103Tubulin/FtsZ_C_sf
IPR036525Tubulin/FtsZ_GTPase_sf
IPR000217Tubulin
IPR003008Tubulin_FtsZ_GTPase
IPR002452Alpha_tubulin
IPR018316Tubulin/FtsZ_2-layer-sand-dom
IPR023123Tubulin_C
IPR017975Tubulin_CS
IPR008280Tub_FtsZ_C
Vocabulary: biological process
TermDefinition
GO:0007017microtubule-based process
GO:0007010cytoskeleton organization
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005819spindle
GO:0005856cytoskeleton
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005200structural constituent of cytoskeleton
GO:0005525GTP binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002452Alpha tubulinPRINTSPR01162ALPHATUBULINcoord: 30..38
score: 33.43
coord: 184..199
score: 32.25
coord: 295..311
score: 29.66
coord: 257..270
score: 76.35
coord: 231..252
score: 38.58
coord: 58..70
score: 55.59
coord: 124..136
score: 52.29
coord: 270..289
score: 27.86
coord: 332..348
score: 26.74
IPR000217TubulinPRINTSPR01161TUBULINcoord: 5..16
score: 61.88
coord: 18..42
score: 36.48
coord: 88..101
score: 49.06
coord: 102..122
score: 42.91
coord: 290..318
score: 40.26
coord: 63..84
score: 30.07
coord: 44..62
score: 61.88
IPR000217TubulinPANTHERPTHR11588TUBULINcoord: 2..348
IPR018316Tubulin/FtsZ, 2-layer sandwich domainSMARTSM00865Tubulin_C_4coord: 158..303
e-value: 3.5E-23
score: 93.0
IPR018316Tubulin/FtsZ, 2-layer sandwich domainPFAMPF03953Tubulin_Ccoord: 173..302
e-value: 6.6E-39
score: 133.0
IPR003008Tubulin/FtsZ, GTPase domainSMARTSM00864Tubulin_4coord: 3..156
e-value: 4.1E-13
score: 59.6
IPR003008Tubulin/FtsZ, GTPase domainPFAMPF00091Tubulincoord: 3..123
e-value: 3.1E-33
score: 115.6
IPR037103Tubulin/FtsZ, C-terminal domain superfamilyGENE3DG3DSA:3.30.1330.20coord: 179..293
e-value: 1.1E-40
score: 140.1
IPR036525Tubulin/FtsZ, GTPase domain superfamilyGENE3DG3DSA:3.40.50.1440coord: 1..178
e-value: 5.9E-63
score: 214.7
IPR036525Tubulin/FtsZ, GTPase domain superfamilySUPERFAMILYSSF52490Tubulin nucleotide-binding domain-likecoord: 2..154
IPR023123Tubulin, C-terminalGENE3DG3DSA:1.10.287.600coord: 294..365
e-value: 7.6E-16
score: 59.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 354..416
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 347..416
NoneNo IPR availablePANTHERPTHR11588:SF304AT04270P-RELATEDcoord: 2..348
IPR017975Tubulin, conserved sitePROSITEPS00227TUBULINcoord: 52..58
IPR008280Tubulin/FtsZ, C-terminalSUPERFAMILYSSF55307Tubulin C-terminal domain-likecoord: 156..347