MATH domain-containing protein

Overview
NameMATH domain-containing protein
Smed IDSMED30014211
Length (bp)2523
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MATH domain-containing protein (SMED30014211) t-SNE clustered cells

Violin plots show distribution of expression levels for MATH domain-containing protein (SMED30014211) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MATH domain-containing protein (SMED30014211) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MATH domain-containing protein (SMED30014211) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014211

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30014211SMESG000026079.1 Contig1465newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30014211SMESG000035481.1 Contig1465newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30014211SMESG000026079.1 dd_Smed_v4_12140_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30014211SMESG000075612.1 SMESG000026079.1 SMESG000018825.1 SMESG000002232.1 dd_Smed_v4_6759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30014211SMESG000075612.1 SMESG000026079.1 SMESG000018825.1 SMESG000002232.1 dd_Smed_v4_6759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014211SMESG000075612.1 SMESG000026079.1 SMESG000018825.1 SMESG000002232.1 dd_Smed_v4_6759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30014211SMESG000026079.1 dd_Smed_v6_12140_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30014211SMESG000075612.1 SMESG000026079.1 SMESG000018825.1 SMESG000002232.1 dd_Smed_v4_6759_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MATH domain-containing protein vs. TrEMBL
Match: V3ZUH9 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_160907 PE=4 SV=1)

HSP 1 Score: 330.487 bits (846), Expect = 6.500e-101
Identity = 170/456 (37.28%), Postives = 267/456 (58.55%), Query Frame = 3
Query:  219 LANLHRFVRLNDKSDTQVFTFIVPTQLTRGFVNEVYSENFLYRNQTWVVKFDRKERHIGAYLIMRSMQNQLSCIIDYSFMVLNKDHFTKNESFSERSCEFSLKKLCRGRPSFIEVSDLEGRHFLFDDGKFLIELELRNCATIYEDELGLAQLDES----NDTVESNYFTFGGCDWSILLRMPMTKPGEASNSPEFSLVRHSHFEHYCKISYRITVKGPEWPEMSASVEQQLDIKGYGSFFRLRTDKPLSINLKQTLHLSLRLYSMRQLSIIDLLPTNRQKNAGRCYDLNQHDWMVQSDILGSVVKLRFFYMQVANVPKNQAHLVCWDTQILPHNPKLDIVKTVSGPYCVYYSQKESDEGIEVATNLIVEQVCDSKSGYVDPETGALTIQVEWLQTHILTPNHYHVFDNIARIHKTQMSREIKTLQSENYALEKQLYKYQQSVSIKKLSLRDESGSD 1574
            +A L R V+LND+ ++QVFTF +P ++TR F  + Y++ F+Y  Q WVV F R ERHIGA+L +++     +C +D++F  LN++HFT+NES   +  +F+  +   GR +F+E+ D+  R FL D+G  LIELE+R    +YE+ + + +  +S     D +E+ YF+FG  DWSI L  P     EA  S    L RH+ F+H C + YR+ + G +    S  + Q LD  G+G  F +          K +L + + + S+  +S + L  +N  K    CYD ++  WM+++D  G  +  R +Y  +++VP+     V WD  I+  N    +VK   GPY  YY Q++ DEG  + TN+ ++++ D  + ++D     LTI ++W+Q+H+L   +Y+  D++ R+HK QM REI  LQ+ENYALEKQLY YQQS++ K  SL+    SD
Sbjct:    1 MAKLCRLVQLNDRFNSQVFTFTLPGKITREFTPDTYAKEFVYGFQKWVVSFIRSERHIGAFLRLQTAAKDTTCGLDFTFTALNREHFTRNESIPFKGSQFTFHEHTHGRKNFMEMDDIVHRKFLQDNGDILIELEMRKINCLYENHMKMIKEGQSRHGYGDRLETTYFSFGLFDWSISL-FPDVTSTEADGSVAVQLQRHTSFDHMCNVKYRV-ILGDDASFDSGELTQMLDASGFGDPFTVGASISRLSRGKSSLKVKVEMMSVVSVSEVPLPVSNNSKGRAHCYDRDKQAWMLETDTSGKFLSFRLYYTDISHVPRRFCRYVVWDLSIVCGNK---VVKVGEGPYSKYYIQQDLDEGFFMRTNIAIDELSDPDNEFIDLNDKKLTIYIQWIQSHLLVFPNYNNLDDVTRLHKHQMGREIMALQAENYALEKQLYSYQQSIA-KTNSLKTRQNSD 450          
BLAST of MATH domain-containing protein vs. TrEMBL
Match: A0A2T7NIW7 (MATH domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19285 PE=4 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 3.257e-100
Identity = 175/456 (38.38%), Postives = 267/456 (58.55%), Query Frame = 3
Query:  219 LANLHRFVRLNDKSDTQVFTFIVPTQLTRGFVNEVYSENFLYRNQTWVVKFDRKERHIGAYLIMRSMQNQLSCIIDYSFMVLNKDHFTKNESFSERSCEFSLKKLCRGRPSFIEVSDLEGRHFLFDDGKFLIELELRNCATIYEDELGLAQLDESN-------DTVESNYFTFGGCDWSILLRMPMTKPGEASNSPEFSLVRHSHFEHYCKISYRITVKGPEWPEMSASVEQQLDIKGYGSFFRLRTDKPLSINLKQTLHLSLRLYSMRQLSIIDLLPTNRQKNAGRCYDLNQHDWMVQSDILGSVVKLRFFYMQVANVPKNQAHLVCWDTQILPHNPKLDIVKTVSGPYCVYYSQKESDEGIEVATNLIVEQVCDSKSGYVDPETGALTIQVEWLQTHILTPNHYHVFDNIARIHKTQMSREIKTLQSENYALEKQLYKYQQSVSIKKLSLRDES 1565
            +A L RFV+L D+ + QVF+F VP+++    + EVYS++F+Y +Q W V   R ERHIGA+L +++    L C +D+SF V+N++HFTKN SF E+S EF+ +    GR +F E  DL  R+F+ + G  L+ELE+RN   I+E  L + +            D +ES YF FG  DWS+ L  P +   EA  S    L RHS F+H C + YR+ + G E    S  +EQ LD  G G  F +          + TL + + + S+  +S + +   +R KN    YD ++  WMV++D  G  +  + +Y  +++VP+     V W  ++L  +    +V+   GPY  YY Q++ D+G  ++T++ VE+V D  S +VDP+   +T+ VEWL++H+L   +Y+  D++ R+HK QM+REI  LQ+ENYALEKQLY YQQS++ K    R ES
Sbjct:    1 MAKLCRFVKLQDRFNAQVFSFAVPSRILTELMPEVYSKDFVYGHQRWNVSITRTERHIGAFLKLQTPSQGLRCRLDFSFTVINREHFTKNISFIEKSYEFTSECQKHGRKTFAETEDLLARNFVQESGDLLLELEMRNIHNIFECFLRVPKEGHGGNNRHGYVDRLESTYFLFGLSDWSVSL-FPDSSSTEADGSVAVQLQRHSSFDHMCTVRYRV-ILGDEGTFDSGDMEQMLDASGVGEPFTVGASVTRLARGRSTLRIKVEMTSVVYVSEVAVNVLSRSKNRAHLYDRDKQAWMVEADPSGRYLAFKLYYTDISHVPRRFTRYVAWHVRLLSRSGNARVVRLPQGPYSKYYVQQDVDDGFIMSTDVPVEEVSDPDSMWVDPDDHKVTLYVEWLESHLLVTPNYNSQDDVTRLHKHQMTREIMALQAENYALEKQLYSYQQSIAKKDSRGRSES 454          
BLAST of MATH domain-containing protein vs. TrEMBL
Match: A0A2C9K432 (MATH domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106050407 PE=4 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 5.277e-100
Identity = 175/457 (38.29%), Postives = 269/457 (58.86%), Query Frame = 3
Query:  201 MSRKTILANLHRFVRLNDKSDTQVFTFIVPTQLTRGFVNEVYSENFLYRNQTWVVKFDRKERHIGAYLIMRSMQNQLSCIIDYSFMVLNKDHFTKNESFSERSCEFSLKKLCRGRPSFIEVSDLEGRHFLFDDGKFLIELELRNCATIYEDELGLAQLDESN---------DTVESNYFTFGGCDWSILLRMPMTKPGEASNSPEFSLVRHSHFEHYCKISYRITVKGPEWPEMSASVEQQLDIKGYGSFFRLRTDKPLSINLKQTLHLSLRLYSMRQLSIIDLLPTNR---QKNAGRCYDLNQHDWMVQSDILGSVVKLRFFYMQVANVPKNQAHLVCWDTQILPHNPKLDIVKTVSGPYCVYYSQKESDEGIEVATNLIVEQVCDSKSGYVDPETGALTIQVEWLQTHILTPNHYHVFDNIARIHKTQMSREIKTLQSENYALEKQLYKYQQSVS 1535
            MSR   +A L RFV+LND+ + QVFTF++P ++ R F  ++YS++++Y    W V F R +RHIGA+L +++    L C +D+SF V+N+DHFTKN SF E+SCEF+      GR +F E+ DL  R+FL + G  L+E+E+RN  +IYE  L L +   +N         D +ES YF FG  DWSI L  P     EA  S E  L RH+ F+H C + YRI + G E    S  +EQ LD  G G  F +          + TL + + + S+  +S + L   NR   ++    CYD ++  WM+++D  G  + LR +Y  +++VP+  +  V W+ +++         +T+ GPY  YY Q+E DEG  + T++ +E++ +    +++ +   LT+ +EW+ +H+L   +Y   D++ R+HK QMSREI  LQ+ENYALEKQL+ YQQS++
Sbjct:    1 MSRGPTMAKLCRFVKLNDRFNAQVFTFLLPGRILREFTPDIYSKDYVYGYHRWKVSFVRTDRHIGAFLKLQTASQGLRCRMDFSFTVVNRDHFTKNISFIEKSCEFTPDASVFGRKTFTEIDDLIKRNFLQESGDLLVEVEMRNIQSIYECFLRLPKEGSTNSSSSKHGYGDRMESTYFMFGLSDWSISL-FPDNSVAEADGSVEVQLQRHTSFDHLCYVRYRI-ILGDEGTFDSGDLEQVLDASGQGEPFTIGASVHRLSRGRSTLRVKVEMISVVSVSEVYLNVFNRGGSKQVGAHCYDRDKQAWMMEADTTGKYLTLRLYYTDISHVPRKFSRYVGWNIRMVSKATNSRPRRTLDGPYSKYYVQQEVDEGSVIRTDISLEELKNPDCPFLELDDHKLTVHIEWMDSHLLACPNYTNIDDVTRLHKHQMSREILALQAENYALEKQLHSYQQSLA 455          
BLAST of MATH domain-containing protein vs. TrEMBL
Match: A0A433TZE3 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_005278 PE=4 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 1.547e-87
Identity = 163/459 (35.51%), Postives = 256/459 (55.77%), Query Frame = 3
Query:  282 IVPTQLTRGFVNEVYSENFLYRNQTWVVKFDRKERHIGAYLIMRSMQNQLSCIIDYSFMVLNKDHFTKNESFSERSCEFSLKKLCRGRPSFIEVSDLEGRHFLFDDGKFLIELELRNCATIYE------DELGL----------------------AQLDESNDTVESNYFTFGGCDWSILLRMPMTKPGEASNSPEFSLVRHSHFEHYCKISYRITVKGPEWPEMSASVEQQLDIKGYGSFFRLRTDKPLSINLKQTLHLSLRLYSMRQLSIIDL--LPTNRQKNAG-----------RCYDLNQHDWMVQSDILGSVVKLRFFYMQVANVPKNQAHLVCWDTQILPHNPKLDIVKTVSGPYCVYYSQKESDEGIEVATNLIVEQVCDSKSGYVDPETGALTIQVEWLQTHILTPNHYHVFDNIARIHKTQMSREIKTLQSENYALEKQLYKYQQSVS 1535
            ++  ++ R F  ++YS++F+Y  Q W V F R +RHIGA+L ++S    L C +D+SF V+N+DHFTKN SF E+SCEFS      GR +FIE+ DL  R+FL + G+ L+E+E+RN  +IYE       E+G                       ++ D   + +ES YF FG  DWSI L  P     EA  S E  L RH+ F+H C + YRI + G E    S  +EQ LD  G G  F +          + TL + + + S+  +S + L  +P+     +             CYD ++  W++++D+ G  +  R FY  +++VP+  +  V W+ +++         +TV GPY  YY Q+E+D+G  + T+++++++ +S+  Y+D E   +T+ +EW+ +H+L   +Y   D++ R+HK QMSREI  LQ+ENYALEKQLY YQQS++
Sbjct:    1 MLSGRILREFTPDIYSKDFVYGYQKWNVSFVRTDRHIGAFLKLQSPSQGLRCRLDFSFTVVNRDHFTKNVSFIEKSCEFSPDASVFGRKTFIEIEDLLKRNFLQETGELLLEVEMRNIHSIYECFMRLPKEIGAGNHHNNNHNHHATSHSIHHHGGSRRDSYEERMESTYFMFGLSDWSISL-FPDNSVAEADGSVEVQLQRHTSFDHLCYVRYRI-ILGDEGTFDSGDLEQVLDASGVGEPFTIGASVHRLARGRSTLRVKVEMISVVSVSEVYLSAIPSMGHSRSSTGGGLGGAARAHCYDRDKQAWILEADLTGKYLAFRLFYTDISHVPRKFSRYVGWNIRLVSKGGSPRPKRTVDGPYSKYYVQQEADDGYVIRTDVLLDELKESECPYLDGEDRKMTLHIEWMDSHLLINPNYTSLDDVTRLHKHQMSREILALQAENYALEKQLYSYQQSLA 457          
BLAST of MATH domain-containing protein vs. TrEMBL
Match: A0A210PWD0 (Uncharacterized protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13368 PE=4 SV=1)

HSP 1 Score: 290.812 bits (743), Expect = 2.473e-86
Identity = 149/418 (35.65%), Postives = 249/418 (59.57%), Query Frame = 3
Query:  219 LANLHRFVRLNDKSDTQVFTFIVPTQLTRGFVNEVYSENFLYRNQTWVVKFDRKERHIGAYLIMRSMQNQLSCIIDYSFMVLNKDHFTKNESFSERSCEFSLKKLCRGRPSFIEVSDLEGRHFLFDDGKFLIELELRNCATIYEDELGLAQLDESND-----TVESNYFTFGGCDWSILLRMPMTKPGEASNSPEFSLVRHSHFEHYCKISYRITVKGPEWPEMSASVEQQLDIKGYGSFFRLRTDKPLSINLKQTLHLSLRLYSMRQLSIIDLLPTNRQKNAGRCYDLNQHDWMVQSDILGSVVKLRFFYMQVANVPKNQAHLVCWDTQILPHNPKLDIVKTVSGPYCVYYSQKESDEGIEVATNLIVEQVCDSKSGYVDPETGALTIQVEWLQTHILTPNHYHVFDNIARIHKTQM 1457
            +A L R +RLND+ DTQVFTF +P ++ R F  +VYS++F+Y  Q W V F + + H+GAYL +++  N + C +DYSF  LN +HFTKNESF E+ CEFS +   +GR +F+ + DL  R F+ ++G+FL+ELELRN  +     L + + D +N       +ES YF+FG  DWSI L  P     +  ++    L RH+ F+H C + Y +T+ G   P  S +++Q LD  G    + + +   L    + ++ + L +YS+  +S + LL  NR KN    YD ++  WM+++D  G  +  R +Y  +++VP+     V ++  +LP NP+ ++ + ++GP+  YY Q++ D+G  V T++ ++++ D +S ++  E   LT+ +EW+ +H+L   ++H  D+  R+HK QM
Sbjct:    1 MAKLFRMIRLNDRFDTQVFTFSLPNKILREFSPDVYSKDFVYGYQKWTVSFVKSDHHLGAYLKLQTSSNAMLCKMDYSFTFLNSEHFTKNESFLEKGCEFSDQSDTKGRKTFMPLEDLLHRKFIQENGEFLVELELRNIVSTLNCFLNIPK-DYTNRYSYGPRMESPYFSFGLFDWSISL-FPNASTADTESNVAIQLHRHTSFDHLCNVKYHVTL-GDTDPYESGTIDQLLDATGNSDPYVIGSTLQLLAKGRTSIKVRLDMYSVVSVSEVSLLVLNRNKNGAHLYDRDKQAWMLEADASGKSLAFRLYYTDISHVPRKFTRYVSFNIVVLPANPERNVARALNGPFYRYYVQQDLDDGFMVHTDIKMDELSDPESDFLSSEDQTLTVHIEWIDSHLLISPNFHSLDDATRLHKHQM 415          
BLAST of MATH domain-containing protein vs. Planmine SMEST
Match: SMESG000026079.1 (SMESG000026079.1)

HSP 1 Score: 1384.01 bits (3581), Expect = 0.000e+0
Identity = 674/674 (100.00%), Postives = 674/674 (100.00%), Query Frame = 3
Query:  201 MSRKTILANLHRFVRLNDKSDTQVFTFIVPTQLTRGFVNEVYSENFLYRNQTWVVKFDRKERHIGAYLIMRSMQNQLSCIIDYSFMVLNKDHFTKNESFSERSCEFSLKKLCRGRPSFIEVSDLEGRHFLFDDGKFLIELELRNCATIYEDELGLAQLDESNDTVESNYFTFGGCDWSILLRMPMTKPGEASNSPEFSLVRHSHFEHYCKISYRITVKGPEWPEMSASVEQQLDIKGYGSFFRLRTDKPLSINLKQTLHLSLRLYSMRQLSIIDLLPTNRQKNAGRCYDLNQHDWMVQSDILGSVVKLRFFYMQVANVPKNQAHLVCWDTQILPHNPKLDIVKTVSGPYCVYYSQKESDEGIEVATNLIVEQVCDSKSGYVDPETGALTIQVEWLQTHILTPNHYHVFDNIARIHKTQMSREIKTLQSENYALEKQLYKYQQSVSIKKLSLRDESGSDTVSLSGVSCPDYQIQQTPAPGDYLRDSFSPQNVRVSQNTLHTSQPXXXXXXXXXXXXXPNATAPLKYQQQYNNYKPRELDRNKMNMISPPLNLAKPMANTYNNAHENDYVYDGSNVIKRQLPRNPGENIDSRPTRIREEQRIDNIPSRHSRRSPNGERRNRQQSPMINADYPEMSKSPRVEQNSNRQYKYSYTPPEDEYNSLAMKYENRVSTQKKW 2222
            MSRKTILANLHRFVRLNDKSDTQVFTFIVPTQLTRGFVNEVYSENFLYRNQTWVVKFDRKERHIGAYLIMRSMQNQLSCIIDYSFMVLNKDHFTKNESFSERSCEFSLKKLCRGRPSFIEVSDLEGRHFLFDDGKFLIELELRNCATIYEDELGLAQLDESNDTVESNYFTFGGCDWSILLRMPMTKPGEASNSPEFSLVRHSHFEHYCKISYRITVKGPEWPEMSASVEQQLDIKGYGSFFRLRTDKPLSINLKQTLHLSLRLYSMRQLSIIDLLPTNRQKNAGRCYDLNQHDWMVQSDILGSVVKLRFFYMQVANVPKNQAHLVCWDTQILPHNPKLDIVKTVSGPYCVYYSQKESDEGIEVATNLIVEQVCDSKSGYVDPETGALTIQVEWLQTHILTPNHYHVFDNIARIHKTQMSREIKTLQSENYALEKQLYKYQQSVSIKKLSLRDESGSDTVSLSGVSCPDYQIQQTPAPGDYLRDSFSPQNVRVSQNTLHTSQPRRESSNSASRSLSPNATAPLKYQQQYNNYKPRELDRNKMNMISPPLNLAKPMANTYNNAHENDYVYDGSNVIKRQLPRNPGENIDSRPTRIREEQRIDNIPSRHSRRSPNGERRNRQQSPMINADYPEMSKSPRVEQNSNRQYKYSYTPPEDEYNSLAMKYENRVSTQKKW
Sbjct:    1 MSRKTILANLHRFVRLNDKSDTQVFTFIVPTQLTRGFVNEVYSENFLYRNQTWVVKFDRKERHIGAYLIMRSMQNQLSCIIDYSFMVLNKDHFTKNESFSERSCEFSLKKLCRGRPSFIEVSDLEGRHFLFDDGKFLIELELRNCATIYEDELGLAQLDESNDTVESNYFTFGGCDWSILLRMPMTKPGEASNSPEFSLVRHSHFEHYCKISYRITVKGPEWPEMSASVEQQLDIKGYGSFFRLRTDKPLSINLKQTLHLSLRLYSMRQLSIIDLLPTNRQKNAGRCYDLNQHDWMVQSDILGSVVKLRFFYMQVANVPKNQAHLVCWDTQILPHNPKLDIVKTVSGPYCVYYSQKESDEGIEVATNLIVEQVCDSKSGYVDPETGALTIQVEWLQTHILTPNHYHVFDNIARIHKTQMSREIKTLQSENYALEKQLYKYQQSVSIKKLSLRDESGSDTVSLSGVSCPDYQIQQTPAPGDYLRDSFSPQNVRVSQNTLHTSQPRRESSNSASRSLSPNATAPLKYQQQYNNYKPRELDRNKMNMISPPLNLAKPMANTYNNAHENDYVYDGSNVIKRQLPRNPGENIDSRPTRIREEQRIDNIPSRHSRRSPNGERRNRQQSPMINADYPEMSKSPRVEQNSNRQYKYSYTPPEDEYNSLAMKYENRVSTQKKW 674          
The following BLAST results are available for this feature:
BLAST of MATH domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V3ZUH96.500e-10137.28Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A2T7NIW73.257e-10038.38MATH domain-containing protein OS=Pomacea canalicu... [more]
A0A2C9K4325.277e-10038.29MATH domain-containing protein OS=Biomphalaria gla... [more]
A0A433TZE31.547e-8735.51Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A210PWD02.473e-8635.65Uncharacterized protein OS=Mizuhopecten yessoensis... [more]
back to top
BLAST of MATH domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000026079.10.000e+0100.00SMESG000026079.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014211 ID=SMED30014211|Name=MATH domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2523bp
ATTTTTTGGTATCTATATGTACAAACATTACGCACACACAATGAGATAGA
ATCTGACCAATCAAATTAATTAATTCAATTCAATCCTTAACAGTTGGAAG
AAAAAGTATGTACACACATACTGGTTTATCTACAATAGATGCACACACCT
CCTCATAATTATCCTAGTCCATGCAGACAAATCTCAATTTGACAATTGAA
ATGTCTAGGAAAACAATTCTGGCAAATCTTCATCGTTTTGTGAGACTAAA
TGACAAAAGCGACACTCAAGTGTTTACATTTATTGTTCCAACTCAACTGA
CAAGAGGATTTGTAAATGAAGTCTATTCGGAGAATTTTCTCTACAGAAAT
CAAACATGGGTAGTGAAATTTGATAGAAAAGAACGCCACATCGGTGCTTA
TTTGATCATGAGATCTATGCAAAACCAGCTTTCATGCATTATCGACTACA
GTTTCATGGTGTTGAATAAAGATCATTTTACGAAAAACGAATCGTTTAGT
GAAAGAAGCTGTGAATTTTCTTTGAAGAAATTATGCCGTGGGCGACCGTC
GTTTATTGAAGTCTCCGATTTGGAGGGCCGCCATTTCTTGTTCGATGATG
GGAAATTTCTTATTGAATTGGAGTTGAGGAATTGTGCCACGATTTATGAG
GATGAATTGGGTTTAGCGCAGTTAGACGAATCGAATGATACTGTTGAGAG
CAACTATTTCACGTTTGGTGGTTGCGATTGGAGTATTCTTTTACGAATGC
CAATGACAAAACCCGGAGAGGCGAGTAATTCTCCAGAATTTTCCTTGGTT
CGACATTCTCATTTTGAACATTATTGTAAAATTAGTTACAGAATTACTGT
AAAGGGCCCAGAATGGCCAGAAATGAGTGCCTCTGTTGAACAGCAGTTAG
ACATCAAAGGTTATGGAAGTTTTTTCAGATTGCGCACAGACAAACCTTTA
TCTATTAATTTGAAACAAACTCTACATCTTTCTTTGCGACTTTATTCCAT
GAGACAACTCAGTATTATCGATCTTCTGCCAACCAATCGACAGAAGAATG
CCGGTCGATGCTACGATTTGAACCAGCATGATTGGATGGTTCAGAGCGAC
ATTTTAGGAAGTGTTGTAAAGTTAAGATTTTTTTATATGCAAGTTGCAAA
TGTTCCCAAAAACCAAGCCCATTTAGTTTGTTGGGACACACAAATTCTGC
CTCACAACCCCAAGCTCGATATCGTGAAAACTGTCAGTGGACCTTATTGT
GTTTATTACTCACAAAAAGAATCAGACGAAGGAATTGAAGTCGCAACCAA
TCTTATAGTTGAACAGGTCTGTGATTCTAAATCAGGATATGTTGATCCAG
AAACTGGAGCCTTAACAATTCAAGTTGAATGGTTGCAAACTCACATTCTA
ACACCAAATCATTACCACGTATTTGACAACATTGCTAGAATTCACAAAAC
TCAGATGAGTCGTGAAATAAAAACACTTCAATCAGAAAACTATGCCTTGG
AGAAACAGTTATATAAGTATCAGCAATCTGTTTCAATCAAGAAGCTGTCG
TTGCGTGATGAGTCCGGCAGTGATACAGTCTCACTAAGTGGGGTCAGCTG
TCCAGATTATCAGATCCAACAAACACCTGCCCCTGGGGATTATCTAAGAG
ATTCTTTTAGTCCACAGAATGTGAGAGTTAGCCAAAACACTTTACACACT
TCTCAGCCACGTCGAGAATCGTCAAACTCTGCCAGCCGTTCTCTAAGTCC
AAACGCAACGGCCCCGTTGAAATATCAACAGCAATATAATAACTATAAAC
CTCGCGAATTAGATCGTAACAAAATGAATATGATCTCGCCGCCTTTAAAC
TTGGCAAAACCAATGGCAAACACTTATAATAATGCTCATGAAAACGATTA
CGTGTATGATGGATCGAATGTAATCAAGCGTCAATTACCAAGGAATCCTG
GAGAAAATATTGACTCTCGGCCTACTAGAATAAGAGAAGAACAAAGAATT
GACAACATACCCTCAAGACATTCACGAAGATCACCAAACGGTGAACGGCG
AAACCGACAACAGTCTCCAATGATCAATGCCGATTATCCAGAAATGTCAA
AATCACCGAGAGTCGAACAGAACTCAAACCGACAATATAAATACAGTTAT
ACCCCACCCGAAGACGAATACAACTCATTGGCTATGAAGTATGAAAATCG
AGTTAGCACACAGAAAAAGTGGTGAAGTGTTATTAATATTATTATTACTA
TTATTATTATAATCACCATGTTTTCAATACCGATTGTGATACAGACATTT
CACTCAATCTTTCTACAGAACGTTATTCTATTATTCTGGTCATTTGGAAT
TATTCTTTCTCCTATATATTTTTCAATTGAAACTCATTACTCAGCATGCT
GATCTATTTATTTGGAATAACATTTCCTGCTGAATTATACAATTTAAAAT
AACATTTTCAGAAAATTTTAATTATTTTTTTCAAATTATTACTTGTTATA
TGAAACAAATAAAAACTATCGAC
back to top

protein sequence of SMED30014211-orf-1

>SMED30014211-orf-1 ID=SMED30014211-orf-1|Name=SMED30014211-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=685bp
MQTNLNLTIEMSRKTILANLHRFVRLNDKSDTQVFTFIVPTQLTRGFVNE
VYSENFLYRNQTWVVKFDRKERHIGAYLIMRSMQNQLSCIIDYSFMVLNK
DHFTKNESFSERSCEFSLKKLCRGRPSFIEVSDLEGRHFLFDDGKFLIEL
ELRNCATIYEDELGLAQLDESNDTVESNYFTFGGCDWSILLRMPMTKPGE
ASNSPEFSLVRHSHFEHYCKISYRITVKGPEWPEMSASVEQQLDIKGYGS
FFRLRTDKPLSINLKQTLHLSLRLYSMRQLSIIDLLPTNRQKNAGRCYDL
NQHDWMVQSDILGSVVKLRFFYMQVANVPKNQAHLVCWDTQILPHNPKLD
IVKTVSGPYCVYYSQKESDEGIEVATNLIVEQVCDSKSGYVDPETGALTI
QVEWLQTHILTPNHYHVFDNIARIHKTQMSREIKTLQSENYALEKQLYKY
QQSVSIKKLSLRDESGSDTVSLSGVSCPDYQIQQTPAPGDYLRDSFSPQN
VRVSQNTLHTSQPRRESSNSASRSLSPNATAPLKYQQQYNNYKPRELDRN
KMNMISPPLNLAKPMANTYNNAHENDYVYDGSNVIKRQLPRNPGENIDSR
PTRIREEQRIDNIPSRHSRRSPNGERRNRQQSPMINADYPEMSKSPRVEQ
NSNRQYKYSYTPPEDEYNSLAMKYENRVSTQKKW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002083MATH/TRAF_dom
IPR008974TRAF-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 426..446
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 645..659
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 503..549
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 503..543
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 598..626
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 585..666
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 23..160
e-value: 1.1E-6
score: 30.6
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 46..154
IPR002083MATH/TRAF domainCDDcd00121MATHcoord: 51..153
e-value: 6.61626E-8
score: 49.685