Protein EFR3 homolog A

Overview
NameProtein EFR3 homolog A
Smed IDSMED30014207
Length (bp)2961
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein EFR3 homolog A (SMED30014207) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein EFR3 homolog A (SMED30014207) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein EFR3 homolog A (SMED30014207) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein EFR3 homolog A (SMED30014207) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014207

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30014207SMESG000057540.1 dd_Smed_v4_3212_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
posterior region of the whole animalSMED30014207SMESG000057540.1 dd_Smed_v4_3212_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30014207SMESG000057540.1 dd_Smed_v4_3212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014207SMESG000057540.1 dd_Smed_v4_3212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014207SMESG000057540.1 dd_Smed_v4_3212_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30014207SMESG000057540.1 DN294441ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30014207SMESG000057540.1 dd_Smed_v4_3212_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein EFR3 homolog A vs. Ensembl Human
Match: EFR3B (EFR3 homolog B [Source:HGNC Symbol;Acc:HGNC:29155])

HSP 1 Score: 408.297 bits (1048), Expect = 8.630e-129
Identity = 239/697 (34.29%), Postives = 402/697 (57.68%), Query Frame = 1
Query:  100 FGIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN-------FDSMFFDKT--NRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAF-NRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYD 2130
            +G+C  CG  RP++ ++VDNI+   P D    ++  KL F+ +  PEKLDRI +YL   L  ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM+  LLES   +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H +  +   + K+R++GIKG+ GVVRK+  D+LQAN+ D + ++ I+P+LLFN++  ++         Q      E P+  A    ++++ RA+F NI+  I  + +++D + +W P  F +      + +I+ PQ +H +++QL+ HL + +++     R GIV  +++  V  A+ +VGP +   F +LL+ LR SI+   + S               DG     A SL T    +++  E++FQEA+I T+  FA  LP  Q+ E++ FI++         ++   +T  NR++    +LLK++LQV+T ++  ++ +   S+FL+ LL+  A+  D   R+FV +IL + IDRH N  + + I  L+  ++   LK+ K SRQD +FMKK    +  ++++   ++TN   + E +Y  L LI++E+  E+VVVDL RL+ A Q   +     +PV ++CA++AL AA+++++S +  +    +H HEVI  R+ +A Y+LPE  F  R   +      +    EL+F +  +   L  SGY+
Sbjct:    2 YGVCGCCGALRPRYKRLVDNIFPEDPEDGLVKTNMEKLTFYALSAPEKLDRIGAYLSERLIRDVGRHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVAKLLESEKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSHDDLEIKTKIRMSGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQHVEEAESRSPSPLQAPEKEKESPAELAERCLRELLGRAAFGNIKNAIKPVLIHLDNHSLWEPKVFAIRCFKIIMYSIQ-PQHSHLVIQQLLGHL-DANSRSAATVRAGIVEVLSEAAVIAATGSVGPTVLEMFNTLLRQLRLSIDYALTGSY--------------DG-----AVSLGTKIIKEHE--ERMFQEAVIKTVGSFASTLPTYQRSEVILFIMSKVPRPSLHQAVDTGRTGENRNRLTQIMLLKSLLQVSTGFQCNNMMSALPSNFLDRLLS-TALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLSDISVL-KLKVDKCSRQDTVFMKKHSQQLYRHIYLSCKEETNVQKHYEALYGLLALISIELANEEVVVDLIRLVLAVQDVAQVNEENLPVYNRCALYALGAAYLNLISQLTTVPAFCQHIHEVIETRKKEAPYMLPEDVFVERPRLSQNLDGVV---IELLFRQSKISEVLGGSGYN 670          
BLAST of Protein EFR3 homolog A vs. Ensembl Human
Match: EFR3B (EFR3 homolog B [Source:HGNC Symbol;Acc:HGNC:29155])

HSP 1 Score: 407.912 bits (1047), Expect = 1.468e-127
Identity = 239/697 (34.29%), Postives = 402/697 (57.68%), Query Frame = 1
Query:  100 FGIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN-------FDSMFFDKT--NRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAF-NRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYD 2130
            +G+C  CG  RP++ ++VDNI+   P D    ++  KL F+ +  PEKLDRI +YL   L  ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM+  LLES   +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H +  +   + K+R++GIKG+ GVVRK+  D+LQAN+ D + ++ I+P+LLFN++  ++         Q      E P+  A    ++++ RA+F NI+  I  + +++D + +W P  F +      + +I+ PQ +H +++QL+ HL + +++     R GIV  +++  V  A+ +VGP +   F +LL+ LR SI+   + S               DG     A SL T    +++  E++FQEA+I T+  FA  LP  Q+ E++ FI++         ++   +T  NR++    +LLK++LQV+T ++  ++ +   S+FL+ LL+  A+  D   R+FV +IL + IDRH N  + + I  L+  ++   LK+ K SRQD +FMKK    +  ++++   ++TN   + E +Y  L LI++E+  E+VVVDL RL+ A Q   +     +PV ++CA++AL AA+++++S +  +    +H HEVI  R+ +A Y+LPE  F  R   +      +    EL+F +  +   L  SGY+
Sbjct:    2 YGVCGCCGALRPRYKRLVDNIFPEDPEDGLVKTNMEKLTFYALSAPEKLDRIGAYLSERLIRDVGRHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVAKLLESEKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSHDDLEIKTKIRMSGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQHVEEAESRSPSPLQAPEKEKESPAELAERCLRELLGRAAFGNIKNAIKPVLIHLDNHSLWEPKVFAIRCFKIIMYSIQ-PQHSHLVIQQLLGHL-DANSRSAATVRAGIVEVLSEAAVIAATGSVGPTVLEMFNTLLRQLRLSIDYALTGS--------------YDG-----AVSLGTKIIKEHE--ERMFQEAVIKTVGSFASTLPTYQRSEVILFIMSKVPRPSLHQAVDTGRTGENRNRLTQIMLLKSLLQVSTGFQCNNMMSALPSNFLDRLLS-TALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLSDISVL-KLKVDKCSRQDTVFMKKHSQQLYRHIYLSCKEETNVQKHYEALYGLLALISIELANEEVVVDLIRLVLAVQDVAQVNEENLPVYNRCALYALGAAYLNLISQLTTVPAFCQHIHEVIETRKKEAPYMLPEDVFVERPRLSQNLDGVV---IELLFRQSKISEVLGGSGYN 670          
BLAST of Protein EFR3 homolog A vs. Ensembl Human
Match: EFR3A (EFR3 homolog A [Source:HGNC Symbol;Acc:HGNC:28970])

HSP 1 Score: 395.971 bits (1016), Expect = 4.643e-123
Identity = 259/871 (29.74%), Postives = 452/871 (51.89%), Query Frame = 1
Query:  109 CTCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQE--------SNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKI--QKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEP-DKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEV--LTSSPHIDNRYGGEIYENGYMCNDVPDIWEIDYPKLFV 2643
            C C   RP++ ++VDNI+   P D    +   KL F+ V  PEKLDRI SYL   LS ++ R    +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES    LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H   ++   R ++R+AGI+GI GVVRK+  D+L+A + + + ++ I+P+LLFNM+  ++ VD          + + +E+P+  A   F++++ RA+F N+   +  +F ++D +K+W P++F +      + +I+  Q +H ++++++ HL +   +  P+ R GI++ + + V   A  ++GP +   F +LL+ LR S+E   ++ +   S+G                   V + T    + EK+ Q AII TI  F  NLPD Q+ EIM FI+    +F   T+           ++++  +LL+++L V + YK  +I       FL+ LL+   ++ D   R  V +++H L+DRHDN  +L  I+++        LKI  +K  RQD  FMKK G  +  ++++   ++ N   N E +Y +L LI +E+  E+VV+DL RL  A Q       + +P+ H+C I AL+AA+++ +S ++ +    +H  +VI +R  +A Y LPE  F       M P  +E  +K+L F  + +   L  SGY +    + +  +  ++  +     R+ SI                 +   S+ +    + +  DD+ S    + +  +F +++K + +T+    Q+K  + + + K F++  FE+I      K   +  +L ++  LT  P         I         VP ++E+ +P L V
Sbjct:    7 CCCSALRPRYKRLVDNIFPEDPKDGLVKTDMEKLTFYAVSAPEKLDRIGSYLAERLSRDVVRHRSGYVLIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESGEPKLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSRFSAMCHSCHSDPEIRTEIRIAGIRGIQGVVRKTVNDELRATIWEPQHMDKIVPSLLFNMQKIEE-VDSRIGPPSSPSATDKEENPAVLAENCFRELLGRATFGNMNNAVRPVFAHLDHHKLWDPNEFAVHCFKIIMYSIQA-QYSHHVIQEILGHL-DARKKDAPRVRAGIIQVLLEAVAIAAKGSIGPTVLEVFNTLLKHLRLSVEFEANDLQ-GGSVGS------------------VNLNTSSKDNDEKIVQNAIIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLLRSLLMVTSGYKAKTIVTALPGSFLDPLLSPSLME-DYELRQLVLEVMHNLMDRHDNRAKLRGIRIIPD---VADLKIKREKICRQDTSFMKKNGQQLYRHIYLGCKEEDNVQKNYELLYTSLALITIELANEEVVIDLIRLAIALQDSAIINEDNLPMFHRCGIMALVAAYLNFVSQMIAVPAFCQHVSKVIEIRTMEAPYFLPEHIF---RDKCMLPKSLEKHEKDLYFLTNKIAESLGGSGYSVERLSVPYVPQVTDEDRL----SRRKSI-----------------VDTVSIQVDILSNNVPSDDVVS----NTEEITFEALKKAI-DTSGMEEQEKEKRRLVIEK-FQKAPFEEIAAQCESKANLLHDRLAQILELTIRPPPSPSGTLTITSGHAQYQSVP-VYEMKFPDLCV 820          
BLAST of Protein EFR3 homolog A vs. Ensembl Human
Match: EFR3A (EFR3 homolog A [Source:HGNC Symbol;Acc:HGNC:28970])

HSP 1 Score: 395.971 bits (1016), Expect = 8.916e-123
Identity = 259/871 (29.74%), Postives = 452/871 (51.89%), Query Frame = 1
Query:  109 CTCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQE--------SNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKI--QKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEP-DKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEV--LTSSPHIDNRYGGEIYENGYMCNDVPDIWEIDYPKLFV 2643
            C C   RP++ ++VDNI+   P D    +   KL F+ V  PEKLDRI SYL   LS ++ R    +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES    LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H   ++   R ++R+AGI+GI GVVRK+  D+L+A + + + ++ I+P+LLFNM+  ++ VD          + + +E+P+  A   F++++ RA+F N+   +  +F ++D +K+W P++F +      + +I+  Q +H ++++++ HL +   +  P+ R GI++ + + V   A  ++GP +   F +LL+ LR S+E   ++ +   S+G                   V + T    + EK+ Q AII TI  F  NLPD Q+ EIM FI+    +F   T+           ++++  +LL+++L V + YK  +I       FL+ LL+   ++ D   R  V +++H L+DRHDN  +L  I+++        LKI  +K  RQD  FMKK G  +  ++++   ++ N   N E +Y +L LI +E+  E+VV+DL RL  A Q       + +P+ H+C I AL+AA+++ +S ++ +    +H  +VI +R  +A Y LPE  F       M P  +E  +K+L F  + +   L  SGY +    + +  +  ++  +     R+ SI                 +   S+ +    + +  DD+ S    + +  +F +++K + +T+    Q+K  + + + K F++  FE+I      K   +  +L ++  LT  P         I         VP ++E+ +P L V
Sbjct:   34 CCCSALRPRYKRLVDNIFPEDPKDGLVKTDMEKLTFYAVSAPEKLDRIGSYLAERLSRDVVRHRSGYVLIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESGEPKLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSRFSAMCHSCHSDPEIRTEIRIAGIRGIQGVVRKTVNDELRATIWEPQHMDKIVPSLLFNMQKIEE-VDSRIGPPSSPSATDKEENPAVLAENCFRELLGRATFGNMNNAVRPVFAHLDHHKLWDPNEFAVHCFKIIMYSIQA-QYSHHVIQEILGHL-DARKKDAPRVRAGIIQVLLEAVAIAAKGSIGPTVLEVFNTLLKHLRLSVEFEANDLQ-GGSVGS------------------VNLNTSSKDNDEKIVQNAIIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLLRSLLMVTSGYKAKTIVTALPGSFLDPLLSPSLME-DYELRQLVLEVMHNLMDRHDNRAKLRGIRIIPD---VADLKIKREKICRQDTSFMKKNGQQLYRHIYLGCKEEDNVQKNYELLYTSLALITIELANEEVVIDLIRLAIALQDSAIINEDNLPMFHRCGIMALVAAYLNFVSQMIAVPAFCQHVSKVIEIRTMEAPYFLPEHIF---RDKCMLPKSLEKHEKDLYFLTNKIAESLGGSGYSVERLSVPYVPQVTDEDRL----SRRKSI-----------------VDTVSIQVDILSNNVPSDDVVS----NTEEITFEALKKAI-DTSGMEEQEKEKRRLVIEK-FQKAPFEEIAAQCESKANLLHDRLAQILELTIRPPPSPSGTLTITSGHAQYQSVP-VYEMKFPDLCV 847          
BLAST of Protein EFR3 homolog A vs. Ensembl Human
Match: EFR3B (EFR3 homolog B [Source:HGNC Symbol;Acc:HGNC:29155])

HSP 1 Score: 380.948 bits (977), Expect = 9.841e-118
Identity = 227/661 (34.34%), Postives = 381/661 (57.64%), Query Frame = 1
Query:  196 KLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN-------FDSMFFDKT--NRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAF-NRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYD 2130
            KL F+ +  PEKLDRI +YL   L  ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM+  LLES   +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H +  +   + K+R++GIKG+ GVVRK+  D+LQAN+ D + ++ I+P+LLFN++  ++         Q      E P+  A    ++++ RA+F NI+  I  + +++D + +W P  F +      + +I+ PQ +H +++QL+ HL + +++     R GIV  +++  V  A+ +VGP +   F +LL+ LR SI+   + S               DG     A SL T    +++  E++FQEA+I T+  FA  LP  Q+ E++ FI++         ++   +T  NR++    +LLK++LQV+T ++  ++ +   S+FL+ LL+  A+  D   R+FV +IL + IDRH N  + + I  L+  ++   LK+ K SRQD +FMKK    +  ++++   ++TN   + E +Y  L LI++E+  E+VVVDL RL+ A Q   +     +PV ++CA++AL AA+++++S +  +    +H HEVI  R+ +A Y+LPE  F  R   +      +    EL+F +  +   L  SGY+
Sbjct:    3 KLTFYALSAPEKLDRIGAYLSERLIRDVGRHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVAKLLESEKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSHDDLEIKTKIRMSGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQHVEEAESRSPSPLQAPEKEKESPAELAERCLRELLGRAAFGNIKNAIKPVLIHLDNHSLWEPKVFAIRCFKIIMYSIQ-PQHSHLVIQQLLGHL-DANSRSAATVRAGIVEVLSEAAVIAATGSVGPTVLEMFNTLLRQLRLSIDYALTGS--------------YDG-----AVSLGTKIIKEHE--ERMFQEAVIKTVGSFASTLPTYQRSEVILFIMSKVPRPSLHQAVDTGRTGENRNRLTQIMLLKSLLQVSTGFQCNNMMSALPSNFLDRLLS-TALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLSDISVL-KLKVDKCSRQDTVFMKKHSQQLYRHIYLSCKEETNVQKHYEALYGLLALISIELANEEVVVDLIRLVLAVQDVAQVNEENLPVYNRCALYALGAAYLNLISQLTTVPAFCQHIHEVIETRKKEAPYMLPEDVFVERPRLSQNLDGVV---IELLFRQSKISEVLGGSGYN 635          
BLAST of Protein EFR3 homolog A vs. Ensembl Celegans
Match: efr-3 (pep chromosome:WBcel235:II:6318087:6321101:-1 gene:WBGene00016311.1 transcript:C32D5.3.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:efr-3)

HSP 1 Score: 298.13 bits (762), Expect = 6.484e-87
Identity = 213/728 (29.26%), Postives = 374/728 (51.37%), Query Frame = 1
Query:  103 GICTCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQ-RLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDN--SANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKN----------------VDQESNNYDEDPSTEALF---VFKDIICRASFTNIQPVISSIFVYIDQNKMWTPS-DFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFIL-NFDSMFFDKTNRSKQLIR-VLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLF--VQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKA----KYLL----------PELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAF 2154
            G+C C P +P++ ++VD+IY  +  D    S+  KL F+ +  PEKL+RI  YL   +  +L+R+  V V   ++A++ L+ ACH+   L  F  N L+M+Q LLESN   ++ L   SFV FS I E +P+YHR+YD+ I  F++M H N  +A   D    R AG++G+ GVV KS  D L  N+ + + ++ I+P++LFN++ PD +                 D   ++  +D +T  +      ++++ +ASF +++ VI  +  ++D +K WTP   F + V  + + +I++ Q ++ ++++L+ HL +         R GI   ++ ++VS+A  ++GP +   F SLL+ LR S++   S        GK                         +Q  EK++QEA+I+ + +FA  LPD QK+E+M F + N  ++   K+ +  + ++ VL+KT+L+VAT+Y+T  ++ +F   FL+ LL    V RDP  R+  Q+I HTL+DRHDNA  L  +     +     L ++K SR D +FM+K    I   L   V + D+ +   +++ + CT+ L+ +E      +++LFRL  A Q    D         +  IH ++A ++++ + ++    + +    V+  R  +       LL          P  +   ++T+       E D+ L+F+ + +   L  SG D T   + F
Sbjct:    3 GLCCCTPCKPRYRRLVDSIYPRAVTDGLLYSNMQKLTFYAISHPEKLERIGEYLVMRMVRDLSRQRPVQVKIAVEAMDQLLQACHSSPSLPQFSENHLRMVQRLLESNNAKMEQLATDSFVTFSNIEESSPSYHRQYDFFIDKFSQMCHANPQAAYGDDFRLARCAGLRGLRGVVWKSVTDDLHPNIWEQQHMDKIVPSILFNLQEPDDSGKGFSSSQIPKFDNTFADSTQSHRVDDEATPKVLSDRCLRELMGKASFGSLRAVIEPVLKHMDLHKRWTPPPSFAIHVFRAIIYSIQS-QNSYFVIQELINHL-DSMCSADASTRIGIATVLS-SIVSIAGTSIGPLLLSIFNSLLKHLRTSVDFERS--------GKC-----------------------SDQPAEKMYQEALINAMGDFANALPDYQKVEMMMFTVGNIPNLDERKSKQGDEFLQHVLVKTLLKVATKYRTAYLATVFTDSFLDTLLLLALV-RDPQVRLATQQIFHTLLDRHDNAANLVHLG-YELDVSDVQLTVEKCSRADQMFMRKHIGEITYMLLRAVALADENDLNKHIDAVLCTMSLLCIES-----LIELFRLSLALQQLALDSKQNFSDAKRNCIHNMVAKYLNLSAQLIANPSLCQQVQHVVSCRAQRGIPGLNLLLNVKDSPNNDDPLSSSALNSTSQGATTITEEDQTLLFNAEDIAESLKASGKDATRLFVPF 689          
BLAST of Protein EFR3 homolog A vs. Ensembl Celegans
Match: efr-3 (pep chromosome:WBcel235:II:6318087:6321159:-1 gene:WBGene00016311.1 transcript:C32D5.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:efr-3)

HSP 1 Score: 298.13 bits (762), Expect = 6.484e-87
Identity = 213/728 (29.26%), Postives = 374/728 (51.37%), Query Frame = 1
Query:  103 GICTCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQ-RLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDN--SANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKN----------------VDQESNNYDEDPSTEALF---VFKDIICRASFTNIQPVISSIFVYIDQNKMWTPS-DFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFIL-NFDSMFFDKTNRSKQLIR-VLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLF--VQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKA----KYLL----------PELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAF 2154
            G+C C P +P++ ++VD+IY  +  D    S+  KL F+ +  PEKL+RI  YL   +  +L+R+  V V   ++A++ L+ ACH+   L  F  N L+M+Q LLESN   ++ L   SFV FS I E +P+YHR+YD+ I  F++M H N  +A   D    R AG++G+ GVV KS  D L  N+ + + ++ I+P++LFN++ PD +                 D   ++  +D +T  +      ++++ +ASF +++ VI  +  ++D +K WTP   F + V  + + +I++ Q ++ ++++L+ HL +         R GI   ++ ++VS+A  ++GP +   F SLL+ LR S++   S        GK                         +Q  EK++QEA+I+ + +FA  LPD QK+E+M F + N  ++   K+ +  + ++ VL+KT+L+VAT+Y+T  ++ +F   FL+ LL    V RDP  R+  Q+I HTL+DRHDNA  L  +     +     L ++K SR D +FM+K    I   L   V + D+ +   +++ + CT+ L+ +E      +++LFRL  A Q    D         +  IH ++A ++++ + ++    + +    V+  R  +       LL          P  +   ++T+       E D+ L+F+ + +   L  SG D T   + F
Sbjct:    3 GLCCCTPCKPRYRRLVDSIYPRAVTDGLLYSNMQKLTFYAISHPEKLERIGEYLVMRMVRDLSRQRPVQVKIAVEAMDQLLQACHSSPSLPQFSENHLRMVQRLLESNNAKMEQLATDSFVTFSNIEESSPSYHRQYDFFIDKFSQMCHANPQAAYGDDFRLARCAGLRGLRGVVWKSVTDDLHPNIWEQQHMDKIVPSILFNLQEPDDSGKGFSSSQIPKFDNTFADSTQSHRVDDEATPKVLSDRCLRELMGKASFGSLRAVIEPVLKHMDLHKRWTPPPSFAIHVFRAIIYSIQS-QNSYFVIQELINHL-DSMCSADASTRIGIATVLS-SIVSIAGTSIGPLLLSIFNSLLKHLRTSVDFERS--------GKC-----------------------SDQPAEKMYQEALINAMGDFANALPDYQKVEMMMFTVGNIPNLDERKSKQGDEFLQHVLVKTLLKVATKYRTAYLATVFTDSFLDTLLLLALV-RDPQVRLATQQIFHTLLDRHDNAANLVHLG-YELDVSDVQLTVEKCSRADQMFMRKHIGEITYMLLRAVALADENDLNKHIDAVLCTMSLLCIES-----LIELFRLSLALQQLALDSKQNFSDAKRNCIHNMVAKYLNLSAQLIANPSLCQQVQHVVSCRAQRGIPGLNLLLNVKDSPNNDDPLSSSALNSTSQGATTITEEDQTLLFNAEDIAESLKASGKDATRLFVPF 689          
BLAST of Protein EFR3 homolog A vs. Ensembl Fly
Match: stmA (gene:FBgn0086784 transcript:FBtr0088716)

HSP 1 Score: 358.607 bits (919), Expect = 1.216e-109
Identity = 242/832 (29.09%), Postives = 430/832 (51.68%), Query Frame = 1
Query:  103 GIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQR-LNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKA-GEQRTMLLMAPRKASIFAYMAL------GGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLC--------SFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTS 2538
            G C  C   RP++ ++VDNI+  +P D    S+  KL F+ +  P+KLDRI  YL    + ++NRK Y      M+A++ L+ ACH Q  LNLFV +FL+M+Q LLE +  +L+++   SFV+F+ I+EDTP+YHR YD+ IS F+ M H ++A  S R+ LR+AGIKG+ GV+RK+  D L  N+ ++  +  I+P+LLFNM+  D    +++ N    P   A  V ++++ RASF +I+ V+  +  ++D++++W P+ F +      + +I+ PQ ++++++ L+ HL N     +P+ RT +   ++K +   A ++VGP       +LL  LR S+ +T                            S +T +       E  +QEA+I+ + EFA + PD QKIEIM FI+N       K+   + L  +LLK++L+V TQY T S    F + FL  LL       +P  R+ V +IL  L+DRH N + L+ + +      + +L  + PSR DIIF  K GA I++ L +  +  +++VD L   + T  L+ +EM   + V +    I   Q  +    + +   H+C++HA+    + ++S +  +N +  +  +++  R+ +A + LP L              +EP K            LA   +++    +A    A GE      M  ++ +  A  +L      G     ++ +S  +T  + S +  T++  D+ S++     +C        +F ++++ L+E  +  ++++R +++++ + FRE  F+ + +    K+  I+ +L E+  S
Sbjct:    3 GCCGCCSALRPRYKRLVDNIFPVNPEDGLVKSNMEKLTFYSLSSPDKLDRIGEYLYQKATKDINRKRYKLAEIAMEAMDLLLQACHAQTTLNLFVESFLRMVQKLLEDSNPNLKIMATNSFVKFANINEDTPSYHRRYDFFISKFSSMCHSDAA--SMRDSLRLAGIKGLQGVIRKTVSDDLVENIWEAEHMEKIVPSLLFNMQSGDLTPVEDATNV--TPPALAEEVLRELVGRASFGHIRSVLKPLLTHLDRHELWVPNTFAIHTFRIVMISIQ-PQYSYTVVETLMQHLDNNFKS-SPKTRTSLAVVLSKIIAIAAGESVGPSALDIINNLLTHLRTSVSTT----------------------------SEITPE-------ESQYQEALINALGEFANHHPDYQKIEIMLFIMNTVPDLSKKSKGDQMLQNILLKSLLKVGTQYSTVSFEKAFPASFLQPLLKMARAPHNP-TRMVVMQILQALLDRHQNEQVLSSVSV----KPYPALSQEPPSRSDIIFTHKYGANIMQAL-IDSMALSDRVDALTSSFNTAALLIVEMSCNETVQEFLLFILGIQQ-VACTVDTLGNVHKCSLHAISIGLLVLISRVSGINNLLEYAQKIVDARREEASHFLPPL--------------LEPKK------------LAGKTFNLQLPHLAIDKLALGECLQNAGMDAQRLNTGAPYSLNQTDHPGHRHSWVESVSNQLTQRNSSAD-LTVYNGDVDSVSS-SPGVCKKLLAPEFNFDAMKRALAEPTEAAKREQRERQMQIVRTFREGEFDDLMRRTEPKHDLIQNRLNELFNS 758          
BLAST of Protein EFR3 homolog A vs. Ensembl Fly
Match: stmA (gene:FBgn0086784 transcript:FBtr0088715)

HSP 1 Score: 357.451 bits (916), Expect = 6.324e-109
Identity = 241/832 (28.97%), Postives = 429/832 (51.56%), Query Frame = 1
Query:  109 CTCG---PFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQR-LNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKA-GEQRTMLLMAPRKASIFAYMAL------GGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLC--------SFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTS 2538
            C CG     RP++ ++VDNI+  +P D    S+  KL F+ +  P+KLDRI  YL    + ++NRK Y      M+A++ L+ ACH Q  LNLFV +FL+M+Q LLE +  +L+++   SFV+F+ I+EDTP+YHR YD+ IS F+ M H ++A  S R+ LR+AGIKG+ GV+RK+  D L  N+ ++  +  I+P+LLFNM+  D    +++ N    P   A  V ++++ RASF +I+ V+  +  ++D++++W P+ F +      + +I+ PQ ++++++ L+ HL N     +P+ RT +   ++K +   A ++VGP       +LL  LR S+ +T           +  P+                         E  +QEA+I+ + EFA + PD QKIEIM FI+N       K+   + L  +LLK++L+V TQY T S    F + FL  LL       +P  R+ V +IL  L+DRH N + L+ + +      + +L  + PSR DIIF  K GA I++ L +  +  +++VD L   + T  L+ +EM   + V +    I   Q  +    + +   H+C++HA+    + ++S +  +N +  +  +++  R+ +A + LP L              +EP K            LA   +++    +A    A GE      M  ++ +  A  +L      G     ++ +S  +T  + S +  T++  D+ S++     +C        +F ++++ L+E  +  ++++R +++++ + FRE  F+ + +    K+  I+ +L E+  S
Sbjct:   29 CCCGCCSALRPRYKRLVDNIFPVNPEDGLVKSNMEKLTFYSLSSPDKLDRIGEYLYQKATKDINRKRYKLAEIAMEAMDLLLQACHAQTTLNLFVESFLRMVQKLLEDSNPNLKIMATNSFVKFANINEDTPSYHRRYDFFISKFSSMCHSDAA--SMRDSLRLAGIKGLQGVIRKTVSDDLVENIWEAEHMEKIVPSLLFNMQSGDLTPVEDATNV--TPPALAEEVLRELVGRASFGHIRSVLKPLLTHLDRHELWVPNTFAIHTFRIVMISIQ-PQYSYTVVETLMQHLDNNFKS-SPKTRTSLAVVLSKIIAIAAGESVGPSALDIINNLLTHLRTSVSTT----------SEITPE-------------------------ESQYQEALINALGEFANHHPDYQKIEIMLFIMNTVPDLSKKSKGDQMLQNILLKSLLKVGTQYSTVSFEKAFPASFLQPLLKMARAPHNP-TRMVVMQILQALLDRHQNEQVLSSVSV----KPYPALSQEPPSRSDIIFTHKYGANIMQAL-IDSMALSDRVDALTSSFNTAALLIVEMSCNETVQEFLLFILGIQQ-VACTVDTLGNVHKCSLHAISIGLLVLISRVSGINNLLEYAQKIVDARREEASHFLPPL--------------LEPKK------------LAGKTFNLQLPHLAIDKLALGECLQNAGMDAQRLNTGAPYSLNQTDHPGHRHSWVESVSNQLTQRNSSAD-LTVYNGDVDSVSS-SPGVCKKLLAPEFNFDAMKRALAEPTEAAKREQRERQMQIVRTFREGEFDDLMRRTEPKHDLIQNRLNELFNS 784          
BLAST of Protein EFR3 homolog A vs. Ensembl Fly
Match: stmA (gene:FBgn0086784 transcript:FBtr0339341)

HSP 1 Score: 351.288 bits (900), Expect = 9.163e-107
Identity = 240/844 (28.44%), Postives = 429/844 (50.83%), Query Frame = 1
Query:  103 GIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQR-LNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMR------------LPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKA-GEQRTMLLMAPRKASIFAYMAL------GGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLC--------SFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTS 2538
            G C  C   RP++ ++VDNI+  +P D    S+  KL F+ +  P+KLDRI  YL    + ++NRK Y      M+A++ L+ ACH Q  LNLFV +FL+M+Q LLE +  +L+++   SFV+F+ I+EDTP+YHR YD+ IS F+ M H ++A  S R+ LR+AGIKG+ GV+RK+  D L  N+ ++  +  I+P+LLFNM+            L   ++    +  +  P   A  V ++++ RASF +I+ V+  +  ++D++++W P+ F +      + +I+ PQ ++++++ L+ HL N     +P+ RT +   ++K +   A ++VGP       +LL  LR S+ +T           +  P+                         E  +QEA+I+ + EFA + PD QKIEIM FI+N       K+   + L  +LLK++L+V TQY T S    F + FL  LL       +P  R+ V +IL  L+DRH N + L+ + +      + +L  + PSR DIIF  K GA I++ L +  +  +++VD L   + T  L+ +EM   + V +    I   Q  +    + +   H+C++HA+    + ++S +  +N +  +  +++  R+ +A + LP L              +EP K            LA   +++    +A    A GE      M  ++ +  A  +L      G     ++ +S  +T  + S +  T++  D+ S++     +C        +F ++++ L+E  +  ++++R +++++ + FRE  F+ + +    K+  I+ +L E+  S
Sbjct:    3 GCCGCCSALRPRYKRLVDNIFPVNPEDGLVKSNMEKLTFYSLSSPDKLDRIGEYLYQKATKDINRKRYKLAEIAMEAMDLLLQACHAQTTLNLFVESFLRMVQKLLEDSNPNLKIMATNSFVKFANINEDTPSYHRRYDFFISKFSSMCHSDAA--SMRDSLRLAGIKGLQGVIRKTVSDDLVENIWEAEHMEKIVPSLLFNMQFCVNVMFVKKNLLASGDLTPVEDATNVTPPALAEEVLRELVGRASFGHIRSVLKPLLTHLDRHELWVPNTFAIHTFRIVMISIQ-PQYSYTVVETLMQHLDNNFKS-SPKTRTSLAVVLSKIIAIAAGESVGPSALDIINNLLTHLRTSVSTTS----------EITPE-------------------------ESQYQEALINALGEFANHHPDYQKIEIMLFIMNTVPDLSKKSKGDQMLQNILLKSLLKVGTQYSTVSFEKAFPASFLQPLLKMARAPHNP-TRMVVMQILQALLDRHQNEQVLSSVSV----KPYPALSQEPPSRSDIIFTHKYGANIMQAL-IDSMALSDRVDALTSSFNTAALLIVEMSCNETVQEFLLFILGIQQ-VACTVDTLGNVHKCSLHAISIGLLVLISRVSGINNLLEYAQKIVDARREEASHFLPPL--------------LEPKK------------LAGKTFNLQLPHLAIDKLALGECLQNAGMDAQRLNTGAPYSLNQTDHPGHRHSWVESVSNQLTQRNSSAD-LTVYNGDVDSVSS-SPGVCKKLLAPEFNFDAMKRALAEPTEAAKREQRERQMQIVRTFREGEFDDLMRRTEPKHDLIQNRLNELFNS 772          
BLAST of Protein EFR3 homolog A vs. Ensembl Fly
Match: stmA (gene:FBgn0086784 transcript:FBtr0301639)

HSP 1 Score: 350.132 bits (897), Expect = 4.245e-106
Identity = 240/844 (28.44%), Postives = 429/844 (50.83%), Query Frame = 1
Query:  109 CTCG---PFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQR-LNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMR------------LPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKA-GEQRTMLLMAPRKASIFAYMAL------GGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLC--------SFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTS 2538
            C CG     RP++ ++VDNI+  +P D    S+  KL F+ +  P+KLDRI  YL    + ++NRK Y      M+A++ L+ ACH Q  LNLFV +FL+M+Q LLE +  +L+++   SFV+F+ I+EDTP+YHR YD+ IS F+ M H ++A  S R+ LR+AGIKG+ GV+RK+  D L  N+ ++  +  I+P+LLFNM+            L   ++    +  +  P   A  V ++++ RASF +I+ V+  +  ++D++++W P+ F +      + +I+ PQ ++++++ L+ HL N     +P+ RT +   ++K +   A ++VGP       +LL  LR S+ +T           +  P+                         E  +QEA+I+ + EFA + PD QKIEIM FI+N       K+   + L  +LLK++L+V TQY T S    F + FL  LL       +P  R+ V +IL  L+DRH N + L+ + +      + +L  + PSR DIIF  K GA I++ L +  +  +++VD L   + T  L+ +EM   + V +    I   Q  +    + +   H+C++HA+    + ++S +  +N +  +  +++  R+ +A + LP L              +EP K            LA   +++    +A    A GE      M  ++ +  A  +L      G     ++ +S  +T  + S +  T++  D+ S++     +C        +F ++++ L+E  +  ++++R +++++ + FRE  F+ + +    K+  I+ +L E+  S
Sbjct:   29 CCCGCCSALRPRYKRLVDNIFPVNPEDGLVKSNMEKLTFYSLSSPDKLDRIGEYLYQKATKDINRKRYKLAEIAMEAMDLLLQACHAQTTLNLFVESFLRMVQKLLEDSNPNLKIMATNSFVKFANINEDTPSYHRRYDFFISKFSSMCHSDAA--SMRDSLRLAGIKGLQGVIRKTVSDDLVENIWEAEHMEKIVPSLLFNMQFCVNVMFVKKNLLASGDLTPVEDATNVTPPALAEEVLRELVGRASFGHIRSVLKPLLTHLDRHELWVPNTFAIHTFRIVMISIQ-PQYSYTVVETLMQHLDNNFKS-SPKTRTSLAVVLSKIIAIAAGESVGPSALDIINNLLTHLRTSVSTTS----------EITPE-------------------------ESQYQEALINALGEFANHHPDYQKIEIMLFIMNTVPDLSKKSKGDQMLQNILLKSLLKVGTQYSTVSFEKAFPASFLQPLLKMARAPHNP-TRMVVMQILQALLDRHQNEQVLSSVSV----KPYPALSQEPPSRSDIIFTHKYGANIMQAL-IDSMALSDRVDALTSSFNTAALLIVEMSCNETVQEFLLFILGIQQ-VACTVDTLGNVHKCSLHAISIGLLVLISRVSGINNLLEYAQKIVDARREEASHFLPPL--------------LEPKK------------LAGKTFNLQLPHLAIDKLALGECLQNAGMDAQRLNTGAPYSLNQTDHPGHRHSWVESVSNQLTQRNSSAD-LTVYNGDVDSVSS-SPGVCKKLLAPEFNFDAMKRALAEPTEAAKREQRERQMQIVRTFREGEFDDLMRRTEPKHDLIQNRLNELFNS 798          
BLAST of Protein EFR3 homolog A vs. Ensembl Zebrafish
Match: efr3a (EFR3 homolog A (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040426-1681])

HSP 1 Score: 402.134 bits (1032), Expect = 3.735e-127
Identity = 233/710 (32.82%), Postives = 397/710 (55.92%), Query Frame = 1
Query:  103 GIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIE-PDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTML 2187
            G+C  CGP RP++ ++VDNI+   P D    S   KL F+ V  PEKLDRI +YL   L+ ++ R  Y +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES   DLQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H    +   R+++RVAGIKG+ GVVRK+  D+LQA + + + ++ ++P++LFNM+    N D E    +E+P++ A   F++++ RA++ N+   +  + V++D +++W P+DF +      + +I+  Q +H +++Q+++HL + H++ TP+ R GIV+ + +TV   A  ++GP +   F +LL+ LR S         +D  +G        DG    +  SL +V+T +++  E++ Q AII TI  F  NLPD Q+ E+M FI+    ++    +           +K++  +LL +++ V + +K  ++     + FL  L + +++  D   R  V +ILH +IDRHDN  +L  I+++         K +K  ++D++FMKK G  +  ++++   ++ N   N E ++  L LI +E+  E+VV+DL RL  A Q         MP+  +C I AL+AA+++ LS ++      +H  +VI LR   A YLLPE  F       + P+ ++  D  L F    +   +   GY++    I +  +   +  +L
Sbjct:    2 GVCGCCGPLRPRYKRLVDNIFPEDPKDGLVKSDMEKLTFYAVSAPEKLDRIGAYLAERLTRDVVRHRYGYVGIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESREPDLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSQFSAMCHSTHEDPETRSRIRVAGIKGLQGVVRKTVNDELQAIIWEPQHMDKLIPSMLFNMQ---DNEDSERAG-EENPASLAESCFRELLGRAAYGNMNNAVRPVLVHLDNHRLWDPNDFAVSCFRIIMYSIQ-AQHSHHVIQQVLSHL-DTHSKNTPRVRAGIVQVLLETVAIAAKGSIGPTVLEVFNTLLKHLRMS---------VDFELG--------DGSRRNSTSSLSSVRTKESE--ERIVQNAIIQTIGFFGGNLPDYQRAEVMMFIMGKVPVYGTPCHTLDTVKIGHQGTKRIQAMLLSSLIMVTSGFKCKTMGAGLPAAFLEPLCS-ISLMEDSELRQLVLEILHNIIDRHDNRAKLRGIRIIPNVAAL-KFKREKICKEDVVFMKKHGQQLYRHIYLGCKEEDNLQKNFELLFTALALITIELANEEVVIDLMRLSIALQDMALVNEENMPMFIRCGIMALVAAYLNFLSQMIANPPFCQHVSKVIELRSLDAPYLLPEHIFREK---CVLPDSLDREDNALYFQTADLAEAMTVPGYNVERLSIPYIPQVTGKHALL 681          
BLAST of Protein EFR3 homolog A vs. Ensembl Zebrafish
Match: efr3a (EFR3 homolog A (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040426-1681])

HSP 1 Score: 394.43 bits (1012), Expect = 3.215e-124
Identity = 231/704 (32.81%), Postives = 389/704 (55.26%), Query Frame = 1
Query:  103 GIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLI----RVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIE-PDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTML 2187
            G+C  CGP RP++ ++VDNI+   P D    S   KL F+ V  PEKLDRI +YL   L+ ++ R  Y +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES   DLQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H    +   R+++RVAGIKG+ GVVRK+  D+LQA + + + ++ ++P++LFNM+    N D E    +E+P++ A   F++++ RA++ N+   +  + V++D +++W P+DF +      + +I+  Q +H +++Q+++HL + H++ TP+ R GIV+ + +TV   A  ++GP +   F +LL+ LR S         +D  +G        DG    +  SL +V+T +++  E++ Q AII TI  F  NLPD Q+ E+M FI+    ++    +     I     +       V + +K  ++     + FL  L + +++  D   R  V +ILH +IDRHDN  +L  I+++         K +K  ++D++FMKK G  +  ++++   ++ N   N E ++  L LI +E+  E+VV+DL RL  A Q         MP+  +C I AL+AA+++ LS ++      +H  +VI LR   A YLLPE  F       + P+ ++  D  L F    +   +   GY++    I +  +   +  +L
Sbjct:    8 GVCGCCGPLRPRYKRLVDNIFPEDPKDGLVKSDMEKLTFYAVSAPEKLDRIGAYLAERLTRDVVRHRYGYVGIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESREPDLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSQFSAMCHSTHEDPETRSRIRVAGIKGLQGVVRKTVNDELQAIIWEPQHMDKLIPSMLFNMQ---DNEDSERAG-EENPASLAESCFRELLGRAAYGNMNNAVRPVLVHLDNHRLWDPNDFAVSCFRIIMYSIQ-AQHSHHVIQQVLSHL-DTHSKNTPRVRAGIVQVLLETVAIAAKGSIGPTVLEVFNTLLKHLRMS---------VDFELG--------DGSRRNSTSSLSSVRTKESE--ERIVQNAIIQTIGFFGGNLPDYQRAEVMMFIMGKVPVYGTPCHTLDTFIMGKCTIYNNGAGHVTSGFKCKTMGAGLPAAFLEPLCS-ISLMEDSELRQLVLEILHNIIDRHDNRAKLRGIRIIPNVAAL-KFKREKICKEDVVFMKKHGQQLYRHIYLGCKEEDNLQKNFELLFTALALITIELANEEVVIDLMRLSIALQDMALVNEENMPMFIRCGIMALVAAYLNFLSQMIANPPFCQHVSKVIELRSLDAPYLLPEHIFREK---CVLPDSLDREDNALYFQTADLAEAMTVPGYNVERLSIPYIPQVTGKHALL 681          
BLAST of Protein EFR3 homolog A vs. Ensembl Zebrafish
Match: efr3bb (EFR3 homolog Bb (S. cerevisiae) [Source:NCBI gene;Acc:561353])

HSP 1 Score: 389.423 bits (999), Expect = 8.885e-121
Identity = 231/694 (33.29%), Postives = 389/694 (56.05%), Query Frame = 1
Query:  106 IC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSM--------FFDKTNRSKQLIRV-LLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYD 2130
            +C  CG  RP++ ++VDNI+   P D    ++  KL F+ +  PEKLDRI +YL   LS ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM++ LLE++  +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H    +   R K+R+AGIKG+ GVVRK+  D+LQAN+ D + ++ I+P+LLFN++  +          Q S    E P+      F++++ RA++ NI+  ++ + +++D + +W    F +      + +I++ Q +H +++QL+ HL + +++ +   R GIV  + +     AS +VGP +   F +LL+ LR S++   + S    +IG  I K                      +  E+  QEA+I TI  FA  LP  Q+ E+M FI+    +                 ++I+V LLK++ QV   ++T ++     + FL+ +L+  A+  D   R+ V +IL +LIDRHDN  + + I +++  ++   LK+ K SRQD +FMKK    +  ++++   +Q++   + E +Y  L LI++E+  E+VVVDL R+  A Q         +PV ++CAIHAL +A+++++S +  +    +H HEVI +RQ +  YLLPE  F  +        K+E D  ++F +  +   L  SGY+
Sbjct:    5 VCGCCGALRPRYKRLVDNIFPEDPEDGLVKANMEKLTFYALSAPEKLDRIGAYLSERLSRDVARHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVRKLLEADKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSGYEDPDIRTKIRMAGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQSGEGTESRSPSPLQASEKEKESPAELTERCFRELLGRAAYGNIKNAVTPVLMHLDNHSLWEGKTFAVRCFKIIMYSIQS-QHSHLVIQQLLGHL-DANSKSSATVRAGIVEVLLEVAAIAASGSVGPTVLEVFNTLLRHLRLSVDYELTGSYDCTNIGTKIIK----------------------EHEERQLQEAVIRTIGSFANTLPTYQRSEVMLFIMGKVPIPGLHPTLPSIGSGPEGNRMIQVMLLKSLRQVTCGFQTTNMLTALPNSFLDPMLS-FALLEDAEIRLLVLEILVSLIDRHDNLPKFSNISIISDISVL-KLKVDKCSRQDNLFMKKHAQHLYRHIYLCSKEQSSVQPHFEKLYSLLALISMELANEEVVVDLIRVALALQDLALSSEEMLPVYNRCAIHALSSAYLNLISQLTTVPAFCQHVHEVIEMRQKEIPYLLPEDVFIENPKIPKTLEKLEGD--VLFQQAKITEVLGGSGYN 670          
BLAST of Protein EFR3 homolog A vs. Ensembl Zebrafish
Match: efr3bb (EFR3 homolog Bb (S. cerevisiae) [Source:NCBI gene;Acc:561353])

HSP 1 Score: 389.423 bits (999), Expect = 8.885e-121
Identity = 231/694 (33.29%), Postives = 389/694 (56.05%), Query Frame = 1
Query:  106 IC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSM--------FFDKTNRSKQLIRV-LLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYD 2130
            +C  CG  RP++ ++VDNI+   P D    ++  KL F+ +  PEKLDRI +YL   LS ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM++ LLE++  +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H    +   R K+R+AGIKG+ GVVRK+  D+LQAN+ D + ++ I+P+LLFN++  +          Q S    E P+      F++++ RA++ NI+  ++ + +++D + +W    F +      + +I++ Q +H +++QL+ HL + +++ +   R GIV  + +     AS +VGP +   F +LL+ LR S++   + S    +IG  I K                      +  E+  QEA+I TI  FA  LP  Q+ E+M FI+    +                 ++I+V LLK++ QV   ++T ++     + FL+ +L+  A+  D   R+ V +IL +LIDRHDN  + + I +++  ++   LK+ K SRQD +FMKK    +  ++++   +Q++   + E +Y  L LI++E+  E+VVVDL R+  A Q         +PV ++CAIHAL +A+++++S +  +    +H HEVI +RQ +  YLLPE  F  +        K+E D  ++F +  +   L  SGY+
Sbjct:    5 VCGCCGALRPRYKRLVDNIFPEDPEDGLVKANMEKLTFYALSAPEKLDRIGAYLSERLSRDVARHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVRKLLEADKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSGYEDPDIRTKIRMAGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQSGEGTESRSPSPLQASEKEKESPAELTERCFRELLGRAAYGNIKNAVTPVLMHLDNHSLWEGKTFAVRCFKIIMYSIQS-QHSHLVIQQLLGHL-DANSKSSATVRAGIVEVLLEVAAIAASGSVGPTVLEVFNTLLRHLRLSVDYELTGSYDCTNIGTKIIK----------------------EHEERQLQEAVIRTIGSFANTLPTYQRSEVMLFIMGKVPIPGLHPTLPSIGSGPEGNRMIQVMLLKSLRQVTCGFQTTNMLTALPNSFLDPMLS-FALLEDAEIRLLVLEILVSLIDRHDNLPKFSNISIISDISVL-KLKVDKCSRQDNLFMKKHAQHLYRHIYLCSKEQSSVQPHFEKLYSLLALISMELANEEVVVDLIRVALALQDLALSSEEMLPVYNRCAIHALSSAYLNLISQLTTVPAFCQHVHEVIEMRQKEIPYLLPEDVFIENPKIPKTLEKLEGD--VLFQQAKITEVLGGSGYN 670          
BLAST of Protein EFR3 homolog A vs. Ensembl Zebrafish
Match: efr3ba (EFR3 homolog Ba (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-030616-64])

HSP 1 Score: 379.407 bits (973), Expect = 4.027e-117
Identity = 228/704 (32.39%), Postives = 395/704 (56.11%), Query Frame = 1
Query:  100 FGIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLP---DKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSI--ESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN-------FDSMFFDKTN-RSKQLIRV-LLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEP-DKELIFSEDLVKTQLADSGYDMTTFEIAF 2154
            +G+C  CG  RP++ ++VDNI+   P D    ++  KL F+ +  PEKLDRI +YL   LS ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FL M++ LLE++  +LQ+LG  SFV+F+ I EDT +YHR YD+ +S F++M H +  +   R K+R+AGI+G+ GVVRK+  D+LQAN+ D + ++ I+P+LLFN++     +++   E+    E P       F++++ RA + NI+  +  + +++D + +W    F +      + +I++ Q +H +++QL+ HL + +++ + + R GIV  I++  V  AS ++GP +   F +LL+ LR S+  E TGS         K I   +                       E+  QE++I TI  FA  LP  Q+ E+M FI+        + ++    T     ++I++ LLK++LQV   +++ +I     + FL+ LL+   ++ D   R+ V  IL ++IDRHDN  + + +++++  ++   LK+ K SRQD +FMKK    +  ++++   + ++   + E ++  L LI +E+  E+VVVDL RL  A Q      ++ +PV  +CAIHAL AA+++++S +  +    +H HEVI  R+    +LLPE     S      P K+E  + E++F++  +   L  SGY+      A+
Sbjct:    2 YGVCGCCGALRPRYKRLVDNIFPEDPEDGLVKANMEKLTFYALSAPEKLDRIGAYLSERLSRDVARHRYGYVCIAMEALDQLLMACHCQSINLFVESFLTMVRKLLEADKPNLQILGTNSFVKFANIEEDTASYHRSYDFFVSRFSEMCHSSFEDPDIRTKIRMAGIRGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQQEEGIERSPSPETEKEKESPVELTERCFRELLGRAVYGNIKNAVKPVLMHLDNHSLWEGKTFAVRCFKIIMYSIQS-QHSHLVIQQLLGHL-DANSKNSARVRAGIVEVISEAAVIEASGSIGPTVLEVFNTLLKQLRLSVDYELTGSYDSFANMGTKVIKVHE-----------------------ERQLQESVIKTIGSFANTLPTYQRSEVMLFIIGKIPVPGMYPALGSANTGVEGSRMIQIMLLKSLLQVTAGFQSNNILTALPTSFLDPLLSFTLME-DAEIRLLVLDILISIIDRHDNRHKFSPVRIISDISIL-KLKVDKCSRQDNLFMKKHSHRLYRHIYLACKEDSSVQRHFESLHTLLGLICVELANEEVVVDLIRLALALQDLALT-DDTLPVYSRCAIHALSAAYLNLISQLTTVPTFCQHVHEVIESRKKLVPFLLPEDVLVESPK---IPEKLEKVEGEMLFAQAKIAEMLGGSGYNTERLATAY 674          
BLAST of Protein EFR3 homolog A vs. Ensembl Xenopus
Match: efr3b (EFR3 homolog B [Source:NCBI gene;Acc:100491752])

HSP 1 Score: 389.423 bits (999), Expect = 3.256e-122
Identity = 238/680 (35.00%), Postives = 384/680 (56.47%), Query Frame = 1
Query:  196 KLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSI--ESTGS-NSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN-------FDSMFFDKT-NRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIE-PDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRT 2181
            KL F+ +  PEKLDRI SYL   LS ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM+  LLES   +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H +  +   R K+R+AGIKG+ GVVRK+  D+LQAN+ +++ ++ I+P+LL+N++  ++         Q S    E P+  A    ++++ RA++ NI+  I  + +++D + +W P  F +      + +I+ PQ +H +++QL+ HL + +++     R GIV  +++  V  AS +VGP +   F +LL+ LR SI  E TG+ +S ++  IG  I K                      +  E++FQEA+I TI  FA  LP  Q+ E+M FI+          +M F K  NR  Q++  LLK++LQV+  ++  ++     S FL+ LL+  A+  D   R+FV +IL  LIDRH N  +++ I      ++   LK+ K SRQD +FMKK    +  ++++   + TN   + E +Y  L +I++E+  E VVVDL RL+ A Q    +  + +P   +CAI AL AA++S++S +  +    +H HEVI +RQ +A YLLPE  F         P+ ++  + +L+F +  +   L  SGY+       +  +   +RT
Sbjct:   25 KLTFYALSAPEKLDRIGSYLSERLSRDVARHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVAKLLESEKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSHDDGEIRTKIRMAGIKGLQGVVRKTVNDELQANIWETQHMDKIVPSLLYNLQQVEETESRSPSPLQTSEKEKEIPAELAERCLRELLGRAAYGNIKNAIKPVLMHLDNHSLWEPKLFAIRCFKIIMYSIQ-PQHSHLVIQQLLGHL-DANSKSAATVRAGIVEVLSEAAVIAASGSVGPTVLEVFNTLLRQLRLSIDYELTGTYDSTVN--IGTKIIK----------------------EHEERMFQEAVIKTIGSFASTLPIYQRSEVMLFIMGKVPLPSMHHAMDFGKAGNRLTQIM--LLKSLLQVSMGFQCNNMLTALPSSFLDPLLSS-ALMEDAEIRLFVLEILICLIDRHGNRHKISSISTEPDISVL-KLKVDKCSRQDTLFMKKHAQHLYRHIYLSCNEPTNVQTHYEALYFLLVIISIELATEDVVVDLIRLVLAVQEMALNNEDNLPAYCRCAIQALCAAYLSLISNLTTVPAFCQHVHEVIEMRQKEAPYLLPEDIFTEK------PHSMDRVETQLLFLQSKISEVLGGSGYNTDRLSTPYVPQLTGKRT 668          
BLAST of Protein EFR3 homolog A vs. Ensembl Xenopus
Match: efr3b (EFR3 homolog B [Source:NCBI gene;Acc:100491752])

HSP 1 Score: 389.808 bits (1000), Expect = 3.152e-121
Identity = 235/663 (35.44%), Postives = 379/663 (57.16%), Query Frame = 1
Query:  196 KLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSI--ESTGS-NSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN-------FDSMFFDKT--NRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYD 2130
            KL F+ +  PEKLDRI SYL   LS ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM+  LLES   +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H +  +   R K+R+AGIKG+ GVVRK+  D+LQAN+ +++ ++ I+P+LL+N++  ++         Q S    E P+  A    ++++ RA++ NI+  I  + +++D + +W P  F +      + +I+ PQ +H +++QL+ HL + +++     R GIV  +++  V  AS +VGP +   F +LL+ LR SI  E TG+ +S ++  IG  I K                      +  E++FQEA+I TI  FA  LP  Q+ E+M FI+          +M F K   NR++    +LLK++LQV+  ++  ++     S FL+ LL+  A+  D   R+FV +IL  LIDRH N  +++ I      ++   LK+ K SRQD +FMKK    +  ++++   + TN   + E +Y  L +I++E+  E VVVDL RL+ A Q    +  + +P   +CAI AL AA++S++S +  +    +H HEVI +RQ +A YLLPE  F      +   +++E   +L+F +  +   L  SGY+
Sbjct:    3 KLTFYALSAPEKLDRIGSYLSERLSRDVARHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVAKLLESEKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSHDDGEIRTKIRMAGIKGLQGVVRKTVNDELQANIWETQHMDKIVPSLLYNLQQVEETESRSPSPLQTSEKEKEIPAELAERCLRELLGRAAYGNIKNAIKPVLMHLDNHSLWEPKLFAIRCFKIIMYSIQ-PQHSHLVIQQLLGHL-DANSKSAATVRAGIVEVLSEAAVIAASGSVGPTVLEVFNTLLRQLRLSIDYELTGTYDSTVN--IGTKIIK----------------------EHEERMFQEAVIKTIGSFASTLPIYQRSEVMLFIMGKVPLPSMHHAMDFGKAGENRNRLTQIMLLKSLLQVSMGFQCNNMLTALPSSFLDPLLSS-ALMEDAEIRLFVLEILICLIDRHGNRHKISSISTEPDISVL-KLKVDKCSRQDTLFMKKHAQHLYRHIYLSCNEPTNVQTHYEALYFLLVIISIELATEDVVVDLIRLVLAVQEMALNNEDNLPAYCRCAIQALCAAYLSLISNLTTVPAFCQHVHEVIEMRQKEAPYLLPEDIFTEKPQWSSSMDRVE--TQLLFLQSKISEVLGGSGYN 635          
BLAST of Protein EFR3 homolog A vs. Ensembl Xenopus
Match: efr3b (EFR3 homolog B [Source:NCBI gene;Acc:100491752])

HSP 1 Score: 389.808 bits (1000), Expect = 6.166e-121
Identity = 236/662 (35.65%), Postives = 379/662 (57.25%), Query Frame = 1
Query:  196 KLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSI--ESTGS-NSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN-------FDSMFFDKT-NRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYD 2130
            KL F+ +  PEKLDRI SYL   LS ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM+  LLES   +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H +  +   R K+R+AGIKG+ GVVRK+  D+LQAN+ +++ ++ I+P+LL+N++  ++         Q S    E P+  A    ++++ RA++ NI+  I  + +++D + +W P  F +      + +I+ PQ +H +++QL+ HL + +++     R GIV  +++  V  AS +VGP +   F +LL+ LR SI  E TG+ +S ++  IG  I K                      +  E++FQEA+I TI  FA  LP  Q+ E+M FI+          +M F K  NR  Q++  LLK++LQV+  ++  ++     S FL+ LL+  A+  D   R+FV +IL  LIDRH N  +++ I      ++   LK+ K SRQD +FMKK    +  ++++   + TN   + E +Y  L +I++E+  E VVVDL RL+ A Q    +  + +P   +CAI AL AA++S++S +  +    +H HEVI +RQ +A YLLPE  F      +   +++E   +L+F +  +   L  SGY+
Sbjct:   29 KLTFYALSAPEKLDRIGSYLSERLSRDVARHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVAKLLESEKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSHDDGEIRTKIRMAGIKGLQGVVRKTVNDELQANIWETQHMDKIVPSLLYNLQQVEETESRSPSPLQTSEKEKEIPAELAERCLRELLGRAAYGNIKNAIKPVLMHLDNHSLWEPKLFAIRCFKIIMYSIQ-PQHSHLVIQQLLGHL-DANSKSAATVRAGIVEVLSEAAVIAASGSVGPTVLEVFNTLLRQLRLSIDYELTGTYDSTVN--IGTKIIK----------------------EHEERMFQEAVIKTIGSFASTLPIYQRSEVMLFIMGKVPLPSMHHAMDFGKAGNRLTQIM--LLKSLLQVSMGFQCNNMLTALPSSFLDPLLSS-ALMEDAEIRLFVLEILICLIDRHGNRHKISSISTEPDISVL-KLKVDKCSRQDTLFMKKHAQHLYRHIYLSCNEPTNVQTHYEALYFLLVIISIELATEDVVVDLIRLVLAVQEMALNNEDNLPAYCRCAIQALCAAYLSLISNLTTVPAFCQHVHEVIEMRQKEAPYLLPEDIFTEKPQWSSSMDRVE--TQLLFLQSKISEVLGGSGYN 658          
BLAST of Protein EFR3 homolog A vs. Ensembl Xenopus
Match: efr3b (EFR3 homolog B [Source:NCBI gene;Acc:100491752])

HSP 1 Score: 387.111 bits (993), Expect = 5.184e-120
Identity = 236/663 (35.60%), Postives = 379/663 (57.16%), Query Frame = 1
Query:  196 KLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSI--ESTGS-NSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN-------FDSMFFDKT-NRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIE-PDKELIFSEDLVKTQLADSGYD 2130
            KL F+ +  PEKLDRI SYL   LS ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM+  LLES   +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H +  +   R K+R+AGIKG+ GVVRK+  D+LQAN+ +++ ++ I+P+LL+N++  ++         Q S    E P+  A    ++++ RA++ NI+  I  + +++D + +W P  F +      + +I+ PQ +H +++QL+ HL + +++     R GIV  +++  V  AS +VGP +   F +LL+ LR SI  E TG+ +S ++  IG  I K                      +  E++FQEA+I TI  FA  LP  Q+ E+M FI+          +M F K  NR  Q++  LLK++LQV+  ++  ++     S FL+ LL+  A+  D   R+FV +IL  LIDRH N  +++ I      ++   LK+ K SRQD +FMKK    +  ++++   + TN   + E +Y  L +I++E+  E VVVDL RL+ A Q    +  + +P   +CAI AL AA++S++S +  +    +H HEVI +RQ +A YLLPE  F         P+ ++  + +L+F +  +   L  SGY+
Sbjct:   37 KLTFYALSAPEKLDRIGSYLSERLSRDVARHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVAKLLESEKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSHDDGEIRTKIRMAGIKGLQGVVRKTVNDELQANIWETQHMDKIVPSLLYNLQQVEETESRSPSPLQTSEKEKEIPAELAERCLRELLGRAAYGNIKNAIKPVLMHLDNHSLWEPKLFAIRCFKIIMYSIQ-PQHSHLVIQQLLGHL-DANSKSAATVRAGIVEVLSEAAVIAASGSVGPTVLEVFNTLLRQLRLSIDYELTGTYDSTVN--IGTKIIK----------------------EHEERMFQEAVIKTIGSFASTLPIYQRSEVMLFIMGKVPLPSMHHAMDFGKAGNRLTQIM--LLKSLLQVSMGFQCNNMLTALPSSFLDPLLSS-ALMEDAEIRLFVLEILICLIDRHGNRHKISSISTEPDISVL-KLKVDKCSRQDTLFMKKHAQHLYRHIYLSCNEPTNVQTHYEALYFLLVIISIELATEDVVVDLIRLVLAVQEMALNNEDNLPAYCRCAIQALCAAYLSLISNLTTVPAFCQHVHEVIEMRQKEAPYLLPEDIFTEK------PHSMDRVETQLLFLQSKISEVLGGSGYN 663          
BLAST of Protein EFR3 homolog A vs. Ensembl Xenopus
Match: efr3b (EFR3 homolog B [Source:NCBI gene;Acc:100491752])

HSP 1 Score: 382.874 bits (982), Expect = 1.548e-118
Identity = 237/710 (33.38%), Postives = 391/710 (55.07%), Query Frame = 1
Query:  196 KLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSI--ESTGS-NSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN------FDSMFFD---------------KTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIE-PDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMAL 2232
            KL F+ +  PEKLDRI SYL   LS ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM+  LLES   +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H +  +   R K+R+AGIKG+ GVVRK+  D+LQAN+ +++ ++ I+P+LL+N++  ++         Q S    E P+  A    ++++ RA++ NI+  I  + +++D + +W P  F +      + +I+ PQ +H +++QL+ HL + +++     R GIV  +++  V  AS +VGP +   F +LL+ LR SI  E TG+ +S ++  IG  I K                      +  E++FQEA+I TI  FA  LP  Q+ E+M FI+       F + ++                + NR++    +LLK++LQV+  ++  ++     S FL+ LL+  A+  D   R+FV +IL  LIDRH N  +++ I      ++   LK+ K SRQD +FMKK    +  ++++   + TN   + E +Y  L +I++E+  E VVVDL RL+ A Q    +  + +P   +CAI AL AA++S++S +  +    +H HEVI +RQ +A YLLPE  F         P+ ++  + +L+F +  +   L  SGY+       +  +   +RT     P +  +  ++ L
Sbjct:   25 KLTFYALSAPEKLDRIGSYLSERLSRDVARHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVAKLLESEKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSHDDGEIRTKIRMAGIKGLQGVVRKTVNDELQANIWETQHMDKIVPSLLYNLQQVEETESRSPSPLQTSEKEKEIPAELAERCLRELLGRAAYGNIKNAIKPVLMHLDNHSLWEPKLFAIRCFKIIMYSIQ-PQHSHLVIQQLLGHL-DANSKSAATVRAGIVEVLSEAAVIAASGSVGPTVLEVFNTLLRQLRLSIDYELTGTYDSTVN--IGTKIIK----------------------EHEERMFQEAVIKTIGSFASTLPIYQRSEVMLFIMGKVNVSVFSTAWWIMVIISVANQLLSLNFRENRNRLTQIMLLKSLLQVSMGFQCNNMLTALPSSFLDPLLSS-ALMEDAEIRLFVLEILICLIDRHGNRHKISSISTEPDISVL-KLKVDKCSRQDTLFMKKHAQHLYRHIYLSCNEPTNVQTHYEALYFLLVIISIELATEDVVVDLIRLVLAVQEMALNNEDNLPAYCRCAIQALCAAYLSLISNLTTVPAFCQHVHEVIEMRQKEAPYLLPEDIFTEK------PHSMDRVETQLLFLQSKISEVLGGSGYNTDRLSTPYVPQLTGKRT-----PCRGFVLTHLPL 695          
BLAST of Protein EFR3 homolog A vs. Ensembl Mouse
Match: Efr3b (EFR3 homolog B [Source:MGI Symbol;Acc:MGI:2444851])

HSP 1 Score: 400.593 bits (1028), Expect = 5.641e-125
Identity = 236/698 (33.81%), Postives = 395/698 (56.59%), Query Frame = 1
Query:  100 FGIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIES--TGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN---FDSMFFD------KTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYD 2130
            +G+C  CG  RP++ ++VDNI+   P D    ++  KL F+ +  PEKLDRI +YL   L  ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM+  LLES   +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H +  +   + K+R++GIKG+ GVVRK+  D+LQAN+ D + ++ I+P+LLFN++  ++         Q      E+P+  A    ++++ RA+F NI+  I  + +++D + +W P  F        + +I+ PQ +H +++QL++HL + +++     R GIV  +++  +  A+ +VGP +   F +LL+ LR SI+   TGS      S+G  I K                      +  E +FQEA+I TI  FA  LP  Q+ E++ FI++     S+           NR++    +LLK++LQV+T ++  ++ +   S+FL+ LL+  A+  D   R+FV +IL + IDRH N  + + I  L   ++   LK+ K SRQD +FMKK    +  ++++   ++TN   + E +Y  L LI++E+  E+VVVDL RL+ A Q   +     +P  ++CA++AL AA+++++S +  +    +H HEVI  R+ +A Y+LPE  F      +   + +    E +F +  +   L  SGY+
Sbjct:    2 YGVCGCCGALRPRYKRLVDNIFPEDPEDGLVKTNMEKLTFYALSAPEKLDRIGAYLSERLIRDVGRHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVAKLLESEKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSHDDLEIKTKIRMSGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQHVEEAESRSPSPLQAPEKEKENPAELAERCLRELLGRAAFGNIKNAIKPVLIHLDNHSLWEPKVFATRCFKIIMYSIQ-PQHSHLVIQQLLSHL-DANSRSAATVRAGIVEVLSEAAIIAATGSVGPTVLEMFNTLLRQLRLSIDYALTGSYDGA-VSLGSKIIK----------------------EHEECMFQEAVIKTIGSFASTLPTYQRSEVILFIMSKVPLPSVHHPVETGRTGENRNRLTQIMLLKSLLQVSTGFQCNNMMSALPSNFLDRLLS-TALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLGDISVL-KLKVDKCSRQDTVFMKKHSQQLYRHIYLSCKEETNIQKHYEALYGLLALISIELANEEVVVDLIRLVLAVQDVAQVNEENLPTYNRCALYALGAAYLNLISQLTTVPAFCQHIHEVIETRKKEAPYMLPEDVFVEKPRLSQNLDGVV--IEFLFRQSKISEVLGGSGYN 670          
BLAST of Protein EFR3 homolog A vs. Ensembl Mouse
Match: Efr3a (EFR3 homolog A [Source:MGI Symbol;Acc:MGI:1923990])

HSP 1 Score: 395.201 bits (1014), Expect = 5.733e-123
Identity = 259/870 (29.77%), Postives = 454/870 (52.18%), Query Frame = 1
Query:  109 CTCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQE--------SNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKI--QKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEP-DKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTSSPHIDNRYGGEI-YENGYMCNDVPDIWEIDYPKLFV 2643
            C C   RP++ ++VDNI+   P D    +   KL F+ V  PEKLDRI +YL   LS ++ R    +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES    LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H   ++   R ++R+AGI+GI GVVRK+  D+L+A + + + ++ I+P+LLFNM+  ++ VD          + + +E+P+  A   F++++ RA+F N+   +  +F ++D +K+W P++F +      + +I+  Q +H ++++++ HL +   + +P+ R GI++ + + V   A  ++GP +   F +LL+ LR S+E   ++S+   S+G                   VTV + DN   EK+ Q A+I TI  F  NLPD Q+ EIM FI+    +F   T+           ++++  +LL+++L V + YK  +I       FL+ LL+   ++ D   R  V +++H L+DRHDN  +L  I+++        LKI  +K  RQD  FMKK G  +  ++++   ++ N   N E +Y +L LI +E+  E+VV+DL RL  A Q       + + + H+C I AL+AA+++ +S ++ +    +H  +VI  R  +A Y LPE  F       M P  +E  DK L F  + +   L  SGY +    + +  +  ++  +     R+ SI   +++  +I     LS S+ S  +  N   I                +F +++K +     E ++K++ + +   + F++  FE+I      K   +  +L ++L  +        G +   +G+       ++E+ +P L V
Sbjct:    7 CCCSALRPRYKRLVDNIFPEDPKDGLVKADMEKLTFYAVSAPEKLDRIGAYLAERLSRDVVRHRSGYVLIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESGEPKLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSRFSAMCHSCHSDPEIRTEIRIAGIRGIQGVVRKTVNDELRATIWEPQHMDKIVPSLLFNMQKIEE-VDSRLGPPSSPSAADKEENPAVLAESCFRELLGRATFGNMNNAVRPVFAHLDHHKLWDPNEFAVHCFKIIMYSIQA-QYSHHVIQEILGHL-DARRKDSPRVRAGIIQVLLEAVAIAAKGSIGPTVLEVFNTLLKHLRLSVELEANDSQ-KGSVGS------------------VTVSSKDND--EKIVQNAVIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLLRSLLMVTSGYKAKTIVTALPGSFLDPLLSPSLME-DYELRQLVLEVMHNLMDRHDNRAKLRGIRIIPD---VADLKIKREKICRQDTSFMKKNGQQLYRHIYLGCKEEDNVQKNYELLYTSLALITIELANEEVVIDLIRLAIALQDSAIINEDNLSMFHRCGIMALVAAYLNFVSQMIAVPAFCQHVSKVIETRTMEAPYFLPEHIF---RDKCMLPKSLEKHDKNLYFLTNKIAESLGGSGYSVERLTVPYVPQVTDEDRL----SRRKSIVDTVSIQVDI-----LSNSVPSDDVVSNTEEI----------------TFEALKKAIDTNGMEEQEKEKRRLV--IEKFQKAPFEEIAAQCESKANLLHDRLAQILELTIRPPPSPSGTLTVTSGHTQYQSVPVYEMKFPDLCV 818          
BLAST of Protein EFR3 homolog A vs. Ensembl Mouse
Match: Efr3a (EFR3 homolog A [Source:MGI Symbol;Acc:MGI:1923990])

HSP 1 Score: 394.815 bits (1013), Expect = 9.159e-123
Identity = 262/862 (30.39%), Postives = 449/862 (52.09%), Query Frame = 1
Query:  109 CTCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQE--------SNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKI--QKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEP-DKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETA-DERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTSSPHIDNRYGGEIYEN-GYMCNDVPDIW 2616
            C C   RP++ ++VDNI+   P D    +   KL F+ V  PEKLDRI +YL   LS ++ R    +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES    LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H   ++   R ++R+AGI+GI GVVRK+  D+L+A + + + ++ I+P+LLFNM+  ++ VD          + + +E+P+  A   F++++ RA+F N+   +  +F ++D +K+W P++F +      + +I+  Q +H ++++++ HL +   + +P+ R GI++ + + V   A  ++GP +   F +LL+ LR S+E   ++S+   S+G                   VTV + DN   EK+ Q A+I TI  F  NLPD Q+ EIM FI+    +F   T+           ++++  +LL+++L V + YK  +I       FL+ LL+   ++ D   R  V +++H L+DRHDN  +L  I+++        LKI  +K  RQD  FMKK G  +  ++++   ++ N   N E +Y +L LI +E+  E+VV+DL RL  A Q       + + + H+C I AL+AA+++ +S ++ +    +H  +VI  R  +A Y LPE  F       M P  +E  DK L F  + +   L  SGY +    + +  +  ++  +     R+ SI   +++  +I     LS S+ S  +  N   I                +F +++K +     +E+ ++KR   IE    F++  FE+I      K   +  +L ++L  +  I  R    +Y+     C   P  W
Sbjct:    7 CCCSALRPRYKRLVDNIFPEDPKDGLVKADMEKLTFYAVSAPEKLDRIGAYLAERLSRDVVRHRSGYVLIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESGEPKLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSRFSAMCHSCHSDPEIRTEIRIAGIRGIQGVVRKTVNDELRATIWEPQHMDKIVPSLLFNMQKIEE-VDSRLGPPSSPSAADKEENPAVLAESCFRELLGRATFGNMNNAVRPVFAHLDHHKLWDPNEFAVHCFKIIMYSIQ-AQYSHHVIQEILGHL-DARRKDSPRVRAGIIQVLLEAVAIAAKGSIGPTVLEVFNTLLKHLRLSVELEANDSQ-KGSVGS------------------VTVSSKDND--EKIVQNAVIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLLRSLLMVTSGYKAKTIVTALPGSFLDPLLSPSLME-DYELRQLVLEVMHNLMDRHDNRAKLRGIRIIPD---VADLKIKREKICRQDTSFMKKNGQQLYRHIYLGCKEEDNVQKNYELLYTSLALITIELANEEVVIDLIRLAIALQDSAIINEDNLSMFHRCGIMALVAAYLNFVSQMIAVPAFCQHVSKVIETRTMEAPYFLPEHIF---RDKCMLPKSLEKHDKNLYFLTNKIAESLGGSGYSVERLTVPYVPQVTDEDRL----SRRKSIVDTVSIQVDI-----LSNSVPSDDVVSNTEEI----------------TFEALKKAIDTNGMEEQEKEKRRLVIEK---FQKAPFEEIAAQCESKANLLHDRLAQILELT--IRQRRESMLYKTEAEPCYTQPMAW 807          
BLAST of Protein EFR3 homolog A vs. Ensembl Mouse
Match: Efr3a (EFR3 homolog A [Source:MGI Symbol;Acc:MGI:1923990])

HSP 1 Score: 395.201 bits (1014), Expect = 1.400e-122
Identity = 262/871 (30.08%), Postives = 454/871 (52.12%), Query Frame = 1
Query:  109 CTCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQE--------SNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKI--QKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEP-DKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETA-DERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTSSPHIDNRYGGEI-YENGYMCNDVPDIWEIDYPKLFV 2643
            C C   RP++ ++VDNI+   P D    +   KL F+ V  PEKLDRI +YL   LS ++ R    +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES    LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H   ++   R ++R+AGI+GI GVVRK+  D+L+A + + + ++ I+P+LLFNM+  ++ VD          + + +E+P+  A   F++++ RA+F N+   +  +F ++D +K+W P++F +      + +I+  Q +H ++++++ HL +   + +P+ R GI++ + + V   A  ++GP +   F +LL+ LR S+E   ++S+   S+G                   VTV + DN   EK+ Q A+I TI  F  NLPD Q+ EIM FI+    +F   T+           ++++  +LL+++L V + YK  +I       FL+ LL+   ++ D   R  V +++H L+DRHDN  +L  I+++        LKI  +K  RQD  FMKK G  +  ++++   ++ N   N E +Y +L LI +E+  E+VV+DL RL  A Q       + + + H+C I AL+AA+++ +S ++ +    +H  +VI  R  +A Y LPE  F       M P  +E  DK L F  + +   L  SGY +    + +  +  ++  +     R+ SI   +++  +I     LS S+ S  +  N   I                +F +++K +     +E+ ++KR   IE    F++  FE+I      K   +  +L ++L  +        G +   +G+       ++E+ +P L V
Sbjct:   34 CCCSALRPRYKRLVDNIFPEDPKDGLVKADMEKLTFYAVSAPEKLDRIGAYLAERLSRDVVRHRSGYVLIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESGEPKLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSRFSAMCHSCHSDPEIRTEIRIAGIRGIQGVVRKTVNDELRATIWEPQHMDKIVPSLLFNMQKIEE-VDSRLGPPSSPSAADKEENPAVLAESCFRELLGRATFGNMNNAVRPVFAHLDHHKLWDPNEFAVHCFKIIMYSIQA-QYSHHVIQEILGHL-DARRKDSPRVRAGIIQVLLEAVAIAAKGSIGPTVLEVFNTLLKHLRLSVELEANDSQ-KGSVGS------------------VTVSSKDND--EKIVQNAVIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLLRSLLMVTSGYKAKTIVTALPGSFLDPLLSPSLME-DYELRQLVLEVMHNLMDRHDNRAKLRGIRIIPD---VADLKIKREKICRQDTSFMKKNGQQLYRHIYLGCKEEDNVQKNYELLYTSLALITIELANEEVVIDLIRLAIALQDSAIINEDNLSMFHRCGIMALVAAYLNFVSQMIAVPAFCQHVSKVIETRTMEAPYFLPEHIF---RDKCMLPKSLEKHDKNLYFLTNKIAESLGGSGYSVERLTVPYVPQVTDEDRL----SRRKSIVDTVSIQVDI-----LSNSVPSDDVVSNTEEI----------------TFEALKKAIDTNGMEEQEKEKRRLVIEK---FQKAPFEEIAAQCESKANLLHDRLAQILELTIRPPPSPSGTLTVTSGHTQYQSVPVYEMKFPDLCV 845          
BLAST of Protein EFR3 homolog A vs. Ensembl Mouse
Match: Efr3b (EFR3 homolog B [Source:MGI Symbol;Acc:MGI:2444851])

HSP 1 Score: 259.225 bits (661), Expect = 3.017e-74
Identity = 161/485 (33.20%), Postives = 273/485 (56.29%), Query Frame = 1
Query:  433 LGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIES--TGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN-------FDSMFFDKT--NRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQ 1836
            LG  SFV+F+ I EDTP+YHR YD+ +S F++M H +  +   + K+R++GIKG+ GVVRK+  D+LQAN+ D + ++ I+P+LLFN++  ++         Q      E+P+  A    ++++ RA+F NI+  I  + +++D + +W P  F        + +I+ PQ +H +++QL++HL + +++     R GIV  +++  +  A+ +VGP +   F +LL+ LR SI+   TGS      S+G  I K                      +  E +FQEA+I TI  FA  LP  Q+ E++ FI++          +   +T  NR++    +LLK++LQV+T ++  ++ +   S+FL+ LL+  A+  D   R+FV +IL + IDRH N  + + I  L   ++   LK+ K SRQD +FMKK    +  ++++   ++TN   + E +Y  L LI++E+  E+VVVDL RL+ A Q
Sbjct:    1 LGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSHDDLEIKTKIRMSGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQHVEEAESRSPSPLQAPEKEKENPAELAERCLRELLGRAAFGNIKNAIKPVLIHLDNHSLWEPKVFATRCFKIIMYSIQ-PQHSHLVIQQLLSHL-DANSRSAATVRAGIVEVLSEAAIIAATGSVGPTVLEMFNTLLRQLRLSIDYALTGSYDGA-VSLGSKIIK----------------------EHEECMFQEAVIKTIGSFASTLPTYQRSEVILFIMSKVPLPSVHHPVETGRTGENRNRLTQIMLLKSLLQVSTGFQCNNMMSALPSNFLDRLLS-TALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLGDISVL-KLKVDKCSRQDTVFMKKHSQQLYRHIYLSCKEETNIQKHYEALYGLLALISIELANEEVVVDLIRLVLAVQ 458          
BLAST of Protein EFR3 homolog A vs. UniProt/SwissProt
Match: sp|Q9Y2G0|EFR3B_HUMAN (Protein EFR3 homolog B OS=Homo sapiens OX=9606 GN=EFR3B PE=1 SV=2)

HSP 1 Score: 407.912 bits (1047), Expect = 7.050e-127
Identity = 239/697 (34.29%), Postives = 402/697 (57.68%), Query Frame = 1
Query:  100 FGIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN-------FDSMFFDKT--NRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAF-NRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYD 2130
            +G+C  CG  RP++ ++VDNI+   P D    ++  KL F+ +  PEKLDRI +YL   L  ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM+  LLES   +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H +  +   + K+R++GIKG+ GVVRK+  D+LQAN+ D + ++ I+P+LLFN++  ++         Q      E P+  A    ++++ RA+F NI+  I  + +++D + +W P  F +      + +I+ PQ +H +++QL+ HL + +++     R GIV  +++  V  A+ +VGP +   F +LL+ LR SI+   + S               DG     A SL T    +++  E++FQEA+I T+  FA  LP  Q+ E++ FI++         ++   +T  NR++    +LLK++LQV+T ++  ++ +   S+FL+ LL+  A+  D   R+FV +IL + IDRH N  + + I  L+  ++   LK+ K SRQD +FMKK    +  ++++   ++TN   + E +Y  L LI++E+  E+VVVDL RL+ A Q   +     +PV ++CA++AL AA+++++S +  +    +H HEVI  R+ +A Y+LPE  F  R   +      +    EL+F +  +   L  SGY+
Sbjct:    2 YGVCGCCGALRPRYKRLVDNIFPEDPEDGLVKTNMEKLTFYALSAPEKLDRIGAYLSERLIRDVGRHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVAKLLESEKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSHDDLEIKTKIRMSGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQHVEEAESRSPSPLQAPEKEKESPAELAERCLRELLGRAAFGNIKNAIKPVLIHLDNHSLWEPKVFAIRCFKIIMYSIQ-PQHSHLVIQQLLGHL-DANSRSAATVRAGIVEVLSEAAVIAATGSVGPTVLEMFNTLLRQLRLSIDYALTGS--------------YDG-----AVSLGTKIIKEHE--ERMFQEAVIKTVGSFASTLPTYQRSEVILFIMSKVPRPSLHQAVDTGRTGENRNRLTQIMLLKSLLQVSTGFQCNNMMSALPSNFLDRLLS-TALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLSDISVL-KLKVDKCSRQDTVFMKKHSQQLYRHIYLSCKEETNVQKHYEALYGLLALISIELANEEVVVDLIRLVLAVQDVAQVNEENLPVYNRCALYALGAAYLNLISQLTTVPAFCQHIHEVIETRKKEAPYMLPEDVFVERPRLSQNLDGVV---IELLFRQSKISEVLGGSGYN 670          
BLAST of Protein EFR3 homolog A vs. UniProt/SwissProt
Match: sp|Q6ZQ18|EFR3B_MOUSE (Protein EFR3 homolog B OS=Mus musculus OX=10090 GN=Efr3b PE=1 SV=2)

HSP 1 Score: 400.593 bits (1028), Expect = 3.946e-124
Identity = 236/698 (33.81%), Postives = 395/698 (56.59%), Query Frame = 1
Query:  100 FGIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIES--TGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN---FDSMFFD------KTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYD 2130
            +G+C  CG  RP++ ++VDNI+   P D    ++  KL F+ +  PEKLDRI +YL   L  ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM+  LLES   +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H +  +   + K+R++GIKG+ GVVRK+  D+LQAN+ D + ++ I+P+LLFN++  ++         Q      E+P+  A    ++++ RA+F NI+  I  + +++D + +W P  F        + +I+ PQ +H +++QL++HL + +++     R GIV  +++  +  A+ +VGP +   F +LL+ LR SI+   TGS      S+G  I K                      +  E +FQEA+I TI  FA  LP  Q+ E++ FI++     S+           NR++    +LLK++LQV+T ++  ++ +   S+FL+ LL+  A+  D   R+FV +IL + IDRH N  + + I  L   ++   LK+ K SRQD +FMKK    +  ++++   ++TN   + E +Y  L LI++E+  E+VVVDL RL+ A Q   +     +P  ++CA++AL AA+++++S +  +    +H HEVI  R+ +A Y+LPE  F      +   + +    E +F +  +   L  SGY+
Sbjct:    2 YGVCGCCGALRPRYKRLVDNIFPEDPEDGLVKTNMEKLTFYALSAPEKLDRIGAYLSERLIRDVGRHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVAKLLESEKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSHDDLEIKTKIRMSGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQHVEEAESRSPSPLQAPEKEKENPAELAERCLRELLGRAAFGNIKNAIKPVLIHLDNHSLWEPKVFATRCFKIIMYSIQ-PQHSHLVIQQLLSHL-DANSRSAATVRAGIVEVLSEAAIIAATGSVGPTVLEMFNTLLRQLRLSIDYALTGSYDGA-VSLGSKIIK----------------------EHEECMFQEAVIKTIGSFASTLPTYQRSEVILFIMSKVPLPSVHHPVETGRTGENRNRLTQIMLLKSLLQVSTGFQCNNMMSALPSNFLDRLLS-TALMEDAEIRLFVLEILISFIDRHGNRHKFSTISTLGDISVL-KLKVDKCSRQDTVFMKKHSQQLYRHIYLSCKEETNIQKHYEALYGLLALISIELANEEVVVDLIRLVLAVQDVAQVNEENLPTYNRCALYALGAAYLNLISQLTTVPAFCQHIHEVIETRKKEAPYMLPEDVFVEKPRLSQNLDGVV--IEFLFRQSKISEVLGGSGYN 670          
BLAST of Protein EFR3 homolog A vs. UniProt/SwissProt
Match: sp|Q14156|EFR3A_HUMAN (Protein EFR3 homolog A OS=Homo sapiens OX=9606 GN=EFR3A PE=1 SV=2)

HSP 1 Score: 395.971 bits (1016), Expect = 2.230e-122
Identity = 259/871 (29.74%), Postives = 452/871 (51.89%), Query Frame = 1
Query:  109 CTCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQE--------SNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKI--QKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEP-DKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEV--LTSSPHIDNRYGGEIYENGYMCNDVPDIWEIDYPKLFV 2643
            C C   RP++ ++VDNI+   P D    +   KL F+ V  PEKLDRI SYL   LS ++ R    +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES    LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H   ++   R ++R+AGI+GI GVVRK+  D+L+A + + + ++ I+P+LLFNM+  ++ VD          + + +E+P+  A   F++++ RA+F N+   +  +F ++D +K+W P++F +      + +I+  Q +H ++++++ HL +   +  P+ R GI++ + + V   A  ++GP +   F +LL+ LR S+E   ++ +   S+G                   V + T    + EK+ Q AII TI  F  NLPD Q+ EIM FI+    +F   T+           ++++  +LL+++L V + YK  +I       FL+ LL+   ++ D   R  V +++H L+DRHDN  +L  I+++        LKI  +K  RQD  FMKK G  +  ++++   ++ N   N E +Y +L LI +E+  E+VV+DL RL  A Q       + +P+ H+C I AL+AA+++ +S ++ +    +H  +VI +R  +A Y LPE  F       M P  +E  +K+L F  + +   L  SGY +    + +  +  ++  +     R+ SI                 +   S+ +    + +  DD+ S    + +  +F +++K + +T+    Q+K  + + + K F++  FE+I      K   +  +L ++  LT  P         I         VP ++E+ +P L V
Sbjct:    7 CCCSALRPRYKRLVDNIFPEDPKDGLVKTDMEKLTFYAVSAPEKLDRIGSYLAERLSRDVVRHRSGYVLIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESGEPKLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSRFSAMCHSCHSDPEIRTEIRIAGIRGIQGVVRKTVNDELRATIWEPQHMDKIVPSLLFNMQKIEE-VDSRIGPPSSPSATDKEENPAVLAENCFRELLGRATFGNMNNAVRPVFAHLDHHKLWDPNEFAVHCFKIIMYSIQA-QYSHHVIQEILGHL-DARKKDAPRVRAGIIQVLLEAVAIAAKGSIGPTVLEVFNTLLKHLRLSVEFEANDLQ-GGSVGS------------------VNLNTSSKDNDEKIVQNAIIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLLRSLLMVTSGYKAKTIVTALPGSFLDPLLSPSLME-DYELRQLVLEVMHNLMDRHDNRAKLRGIRIIPD---VADLKIKREKICRQDTSFMKKNGQQLYRHIYLGCKEEDNVQKNYELLYTSLALITIELANEEVVIDLIRLAIALQDSAIINEDNLPMFHRCGIMALVAAYLNFVSQMIAVPAFCQHVSKVIEIRTMEAPYFLPEHIF---RDKCMLPKSLEKHEKDLYFLTNKIAESLGGSGYSVERLSVPYVPQVTDEDRL----SRRKSI-----------------VDTVSIQVDILSNNVPSDDVVS----NTEEITFEALKKAI-DTSGMEEQEKEKRRLVIEK-FQKAPFEEIAAQCESKANLLHDRLAQILELTIRPPPSPSGTLTITSGHAQYQSVP-VYEMKFPDLCV 820          
BLAST of Protein EFR3 homolog A vs. UniProt/SwissProt
Match: sp|Q8BG67|EFR3A_MOUSE (Protein EFR3 homolog A OS=Mus musculus OX=10090 GN=Efr3a PE=1 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 4.010e-122
Identity = 259/870 (29.77%), Postives = 454/870 (52.18%), Query Frame = 1
Query:  109 CTCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQE--------SNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKI--QKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEP-DKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTSSPHIDNRYGGEI-YENGYMCNDVPDIWEIDYPKLFV 2643
            C C   RP++ ++VDNI+   P D    +   KL F+ V  PEKLDRI +YL   LS ++ R    +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES    LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H   ++   R ++R+AGI+GI GVVRK+  D+L+A + + + ++ I+P+LLFNM+  ++ VD          + + +E+P+  A   F++++ RA+F N+   +  +F ++D +K+W P++F +      + +I+  Q +H ++++++ HL +   + +P+ R GI++ + + V   A  ++GP +   F +LL+ LR S+E   ++S+   S+G                   VTV + DN   EK+ Q A+I TI  F  NLPD Q+ EIM FI+    +F   T+           ++++  +LL+++L V + YK  +I       FL+ LL+   ++ D   R  V +++H L+DRHDN  +L  I+++        LKI  +K  RQD  FMKK G  +  ++++   ++ N   N E +Y +L LI +E+  E+VV+DL RL  A Q       + + + H+C I AL+AA+++ +S ++ +    +H  +VI  R  +A Y LPE  F       M P  +E  DK L F  + +   L  SGY +    + +  +  ++  +     R+ SI   +++  +I     LS S+ S  +  N   I                +F +++K +     E ++K++ + +   + F++  FE+I      K   +  +L ++L  +        G +   +G+       ++E+ +P L V
Sbjct:    7 CCCSALRPRYKRLVDNIFPEDPKDGLVKADMEKLTFYAVSAPEKLDRIGAYLAERLSRDVVRHRSGYVLIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESGEPKLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSRFSAMCHSCHSDPEIRTEIRIAGIRGIQGVVRKTVNDELRATIWEPQHMDKIVPSLLFNMQKIEE-VDSRLGPPSSPSAADKEENPAVLAESCFRELLGRATFGNMNNAVRPVFAHLDHHKLWDPNEFAVHCFKIIMYSIQA-QYSHHVIQEILGHL-DARRKDSPRVRAGIIQVLLEAVAIAAKGSIGPTVLEVFNTLLKHLRLSVELEANDSQ-KGSVGS------------------VTVSSKDND--EKIVQNAVIQTIGFFGSNLPDYQRSEIMMFIMGKVPVFGTSTHTLDISQLGDLGTRRIQIMLLRSLLMVTSGYKAKTIVTALPGSFLDPLLSPSLME-DYELRQLVLEVMHNLMDRHDNRAKLRGIRIIPD---VADLKIKREKICRQDTSFMKKNGQQLYRHIYLGCKEEDNVQKNYELLYTSLALITIELANEEVVIDLIRLAIALQDSAIINEDNLSMFHRCGIMALVAAYLNFVSQMIAVPAFCQHVSKVIETRTMEAPYFLPEHIF---RDKCMLPKSLEKHDKNLYFLTNKIAESLGGSGYSVERLTVPYVPQVTDEDRL----SRRKSIVDTVSIQVDI-----LSNSVPSDDVVSNTEEI----------------TFEALKKAIDTNGMEEQEKEKRRLV--IEKFQKAPFEEIAAQCESKANLLHDRLAQILELTIRPPPSPSGTLTVTSGHTQYQSVPVYEMKFPDLCV 818          
BLAST of Protein EFR3 homolog A vs. UniProt/SwissProt
Match: sp|Q5SPP5|EFR3B_DANRE (Protein EFR3 homolog B OS=Danio rerio OX=7955 GN=efr3b PE=3 SV=2)

HSP 1 Score: 392.119 bits (1006), Expect = 5.804e-121
Identity = 232/695 (33.38%), Postives = 390/695 (56.12%), Query Frame = 1
Query:  103 GIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSM--------FFDKTNRSKQLIRV-LLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYD 2130
            G+C  CG  RP++ ++VDNI+   P D    ++  KL F+ +  PEKLDRI +YL   LS ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM++ LLE++  +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H    +   R K+R+AGIKG+ GVVRK+  D+LQAN+ D + ++ I+P+LLFN++  +          Q S    E P+      F++++ RA++ NI+  ++ + +++D + +W    F +      + +I++ Q +H +++QL+ HL + +++ +   R GIV  + +     AS +VGP +   F +LL+ LR S++   + S    +IG  I K                      +  E+  QEA+I TI  FA  LP  Q+ E+M FI+    +                 ++I+V LLK++ QV   ++T ++     + FL+ +L+  A+  D   R+ V +IL +LIDRHDN  + + I +++  ++   LK+ K SRQD +FMKK    +  ++++   +Q++   + E +Y  L LI++E+  E+VVVDL R+  A Q         +PV ++CAIHAL +A+++++S +  +    +H HEVI +RQ +  YLLPE  F  +        K+E D  ++F +  +   L  SGY+
Sbjct:    3 GVCGCCGALRPRYKRLVDNIFPEDPEDGLVKANMEKLTFYALSAPEKLDRIGAYLSERLSRDVARHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVRKLLEADKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSGYEDPDIRTKIRMAGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQSGEGTESRSPSPLQASEKEKESPAELTERCFRELLGRAAYGNIKNAVTPVLMHLDNHSLWEGKTFAVRCFKIIMYSIQS-QHSHLVIQQLLGHL-DANSKSSATVRAGIVEVLLEVAAIAASGSVGPTVLEVFNTLLRHLRLSVDYELTGSYDCTNIGTKIIK----------------------EHEERQLQEAVIRTIGSFANTLPTYQRSEVMLFIMGKVPIPGLHPTLPSIGSGPEGNRMIQVMLLKSLRQVTCGFQTTNMLTALPNSFLDPMLS-FALLEDAEIRLLVLEILVSLIDRHDNLPKFSNISIISDISVL-KLKVDKCSRQDNLFMKKHAQHLYRHIYLCSKEQSSVQPHFEKLYSLLALISMELANEEVVVDLIRVALALQDLALSSEEMLPVYNRCAIHALSSAYLNLISQLTTVPAFCQHVHEVIEMRQKEIPYLLPEDVFIENPKIPKTLEKLEGD--VLFQQAKITEVLGGSGYN 669          
BLAST of Protein EFR3 homolog A vs. TrEMBL
Match: A0A0X3P8B8 (Protein EFR3 homolog B (Fragment) OS=Schistocephalus solidus OX=70667 GN=EFR3B PE=4 SV=1)

HSP 1 Score: 694.115 bits (1790), Expect = 0.000e+0
Identity = 381/893 (42.67%), Postives = 535/893 (59.91%), Query Frame = 1
Query:   82 IMSDNKFGICTCGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTN---RSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSA-----------------------------------KAGEQRTMLLMAPRK-------------ASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTS-------SPHIDNRYGGEIYENG 2586
            +M   +F +C CGP RP+W KMVD++Y S+  D ++  KLV +CVRKP+KLD IA YL   LSS+LN  NY +VN T++A+++L+NAC+  +LNLF  +FLKM+QLLLES + +LQLLG +SF+ FSQI ED PNYHREYD LI  F +M++ N  +  +R K+RVAGI+G+ GVVRK+  DQL+ NVL S S++ I+PALLFN+R       +E +  + +PS +A+FVFKD++CRAS+TNI PV+ +I  Y+D  ++W PSDF L +    L++IKN Q AH+L+K LV +L +       Q+R  +V+ INKTV++LA  A+GPD+FHNFK+LLQILR SIE T                              V V   +    E  FQE II+TIAEFAKNLPD QKIEI+KFILNFD +   ++N    SK +++VL+KTML VATQY+T +ISN  + DFL LLL+GVAVD D   R+FVQKILH LIDRH N  +L  +KL     +    K +KPSRQDI+FMKKTG ++ +NL+ Q++D +NKVDNLEH+ CT+ L+ALEMGAE+V+V+LFRL+ A Q       N +P+ H CA+HA+LA  +S++  +  L  +  H  EVI  RQ  A YLLPE+AFNR NT   YP ++   +EL+FS+D V+  L D+ +D TT +  + A                                   ++  QR++    PR                  AYMA     R     S+S  S++ S N ++  +     +N   ++  SF   Q++L E+ +  R++K  +   + + +  + F+ +C   R+K       + EV +         P + N   G   E G
Sbjct:   41 LMPPRRF-MCGCGPCRPQWAKMVDSLYSSNHTDGTN--KLVCYCVRKPDKLDNIAKYLHKRLSSDLNHLNYENVNITVEAMSALVNACYAVKLNLFDSSFLKMVQLLLESKLPELQLLGTKSFLAFSQIEEDAPNYHREYDELIDQFCRMSYSNLPDVEERKKVRVAGIQGLQGVVRKTARDQLRMNVLQSASMDQIIPALLFNIR-EGSPTGEEPDESELEPSRQAVFVFKDVVCRASYTNIVPVVKAILSYLDGQRIWVPSDFALLIFGYLLDSIKNMQIAHNLVKALVTYLHD--TDLNTQQRISVVQVINKTVITLAKGAIGPDVFHNFKALLQILRSSIEKT------------------------------VKVAAAE----EHRFQETIINTIAEFAKNLPDAQKIEILKFILNFDPLPSGRSNCKDYSKPMVKVLVKTMLTVATQYQTVAISNAIDYDFLRLLLHGVAVDPDASIRVFVQKILHALIDRHGNGPRLLSVKLYPMNEVTSVYKREKPSRQDILFMKKTGFMLTDNLYHQLLDPSNKVDNLEHLMCTIGLVALEMGAEEVIVELFRLVLAVQQDAIS-TNSLPLPHLCAVHAILACVMSIVVPLAPLPPLVPHVEEVINRRQETASYLLPEVAFNRKNTQETYPTQLAISEELLFSKDKVRAALVDADFDATTLDTPYPAFDPLKAPPITGRVNLPSGIRVSDYNGSVGSEYGTMRSTGQRSVGNYPPRTQMGLLPSQLNDPLGGNLAYMASSTGPRHRHSDSLSSLSITASYNSTSNQQSRASGLN---QEFLSFDMAQRILHESPEAWRRRKLVESGSLAQAYSTLDFDGLCAQHRQKIQTAHMNMAEVFSDLSSEVNRRPRLSNARSGHHLERG 889          
BLAST of Protein EFR3 homolog A vs. TrEMBL
Match: A0A4Z2CQ28 (Protein EFR3A OS=Schistosoma japonicum OX=6182 GN=EWB00_008444 PE=4 SV=1)

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 377/849 (44.41%), Postives = 534/849 (62.90%), Query Frame = 1
Query:  115 CGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMF---FDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAF---------------------------SAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHE--------DDMKSI----NKMDEDLCSFASIQKLLSETADERRQKKRNKEIE-MNKYFREVGFEKICKDEREKYVPIRQKLLEVL 2532
            CGP RPKWMKMVDN+Y  +P D ++H+KL+ +C+ +P+KLDRIA YL   LS +L+R+   +++ ++ AI+ L+  CH  RL +  ++FLKMIQLLLE+N  DLQ++  +SFV+FS+I +D+PNYH+E + ++ HFA MAH +  N  DRN +RVAGI+GI GVVRK   DQL   V +S +++ I+PALLFNM      +D  SN    +PS EA++VF+DI+ +AS+TNI+PV++SI  ++D + +W P DF L +    L+++K  Q AHSL+KQLVAHL    + FT  ERT +V+ I   V++LA  A+GPD+FHNFKSLLQIL+ SI+ T                     ++D+  PSL    +      E+ FQEAII+TIAEFAKNLPDTQKIEI+KFILNF+ M     +  +R K LI VLL+TML VATQYKT +ISN  NSDFLNLLL GVA+D DP  RI VQKILHTLIDRH N  QL  +++     L     ++KP RQDI+FMKK G + IEN++ Q++D +NKVDNLE++ CT+ L+ALEMGAEQV+ +LFRLI A Q  I D N  MP+TH+CA+HALLA+ I++L  ++ L  +  H + VI  R+  A +LLP +AFNR+NT + YP++ E + +L+FS + +   L  +GYD+T   I +                           S     Q++  ++A  K S    +   G I  +  L+ +M     S++G+   +        D + S+    N +DE L SF +++KL+ E  + ++  K  +E   ++  F    F +IC  +REK   +R  + EVL
Sbjct:   21 CGPCRPKWMKMVDNLYSGNPQDTNNHNKLIHYCLHQPDKLDRIAKYLHLRLSQDLSRRYDQNLSISVKAIDKLIQVCHGHRL-VLAISFLKMIQLLLETNRTDLQIMASKSFVEFSKIDDDSPNYHKECNEILDHFAAMAHASLLNPKDRNAVRVAGIQGIQGVVRKLVSDQLILEVHES-NMDKIVPALLFNM-CDRSEIDPNSNESQTEPSQEAVYVFEDIVRQASYTNIKPVVASILTHLDNHHLWDPCDFPLLIFQYLLDSLKTTQVAHSLVKQLVAHLSLHESDFTLAERTSLVQVIGLVVINLAKGAIGPDVFHNFKSLLQILKASIDKTSQ-------------------ISDSEQPSLFN-DSNRKLTGERQFQEAIINTIAEFAKNLPDTQKIEILKFILNFEPMVNYHPEYGDRPKPLIMVLLQTMLTVATQYKTVAISNALNSDFLNLLLRGVAIDPDPVIRIIVQKILHTLIDRHGNTEQLLTVRIYGENELSNYFVLEKPERQDILFMKKAGVLFIENIYHQLLDPSNKVDNLEYLSCTVGLVALEMGAEQVITELFRLILAVQTKIIDENTYMPLTHRCALHALLASTITLLVQLINLKSLSEHIYSVIQRRRDVAPWLLPSVAFNRTNTVDSYPSEFEVNDDLLFSSERITESLVSAGYDITVLSIPYNPIYLRLYDGNSRDPLADSSVYPRVGGSEHCANQQSYGVVADDKNSAIGNVTSSGCIESLY-LNGTMLCRKNSQSGTGFVQSGSSFSLTDSLYSVADSTNMVDEFL-SFKNMRKLVVEGEEVQKPSKLFEEDRLLSGCFNPAEFNEICAQQREKAHSVRAHMAEVL 844          
BLAST of Protein EFR3 homolog A vs. TrEMBL
Match: A0A5K4F086 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 688.723 bits (1776), Expect = 0.000e+0
Identity = 382/851 (44.89%), Postives = 535/851 (62.87%), Query Frame = 1
Query:  115 CGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKN-VDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMF---FDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSA-----KAGEQRTMLL---MAPR-------------------KASIFAYMALGGEIREM--------QDLSISMTSLSISENGSTIHEDD-----MKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIE-MNKYFREVGFEKICKDEREKYVPIRQKLLEVL 2532
            CGP RPKWMKMVDN+Y  SP D ++H+KL+ +C+ +P+KLDRIA YL   LS +L+R+   +++ ++ AI+ L+  CH  RL +  ++FLKMIQLLLE+N  DLQ++  +SFV+FS+I +D+PNYH+E + ++ HFA MAH +  N  +RN +RVAGI+GI GVVRK   DQL   V +S +++ I+P LLFNM   DK+ +D  SN    DPS EA++VF+DI+ +AS+TNI+PV++SI  ++D +K+W P DF L +    L+++K  Q AHSL+KQLVAHL    + FT  ERT +V+ I   V+SLA  A+GPD+FHNFKSLLQIL+ SI+ T             I   D     D+N        +G+ Q     FQEAII+TIAEFAKNLPDTQKIEI+KFILNF+ M     +  +R K LI VLL+TML VATQYKT +ISN  NSDFLNLLL GVA+D DP  RI VQKILHTLIDRH N  QL  +++     L     ++KP RQDI+FMKKTG + IEN++ Q++D +NKVDNLE++ CT+ L+ALEMGAEQV+ +LFRLI A Q  I D N  MP+TH+CA+HALLA+ I++L  ++ L  +  H + VI  R+  A +LLP +AFNR+NT + YP + E + +L+FS D +   L ++GYD     I ++        G+    L+   + PR                   K S  A    G  +           ++ S+  +   ++++GS+    D       S N +DE L SF +++K++S+  + ++  K  +E   +   F  V F +IC  +REK   +R  + EV 
Sbjct:   13 CGPCRPKWMKMVDNLYSGSPQDTNNHNKLIHYCLHQPDKLDRIAKYLHLRLSQDLSRRYDQNISISVKAIDKLIQVCHGHRL-VLAISFLKMIQLLLETNRVDLQIMASKSFVEFSKIDDDSPNYHKECNEILDHFAAMAHASLPNPQERNAVRVAGIQGIQGVVRKMVSDQLILEVHES-NMDKIVPPLLFNMC--DKSEMDSSSNESQCDPSQEAVYVFEDIVRQASYTNIKPVVTSILTHLDNHKLWDPCDFPLLIFQYLLDSLKTTQVAHSLVKQLVAHLSLHESDFTLSERTSLVQVIGLVVISLAKGAIGPDVFHNFKSLLQILKASIDKTSQ-----------ISDPDQPSFNDSNRK-----LSGERQ-----FQEAIINTIAEFAKNLPDTQKIEILKFILNFEPMVNYHPEYGDRPKPLIMVLLQTMLTVATQYKTVAISNALNSDFLNLLLRGVAIDPDPVIRIIVQKILHTLIDRHGNTEQLLTVRIYGENGLSNYFILEKPERQDILFMKKTGVLFIENIYHQLLDPSNKVDNLEYLSCTVGLVALEMGAEQVITELFRLILAVQTKIIDENTYMPLTHRCALHALLASTITLLVQLINLQSLSEHIYTVIQRRRDIAPWLLPSVAFNRTNTVDSYPTEFEINDDLLFSSDKITESLVNTGYDTAVLSIPYNPIYLRLYDGKSPDPLIDGNIYPRVSGNEHFTNQSIYYGTVDDKNSSIANSTSGARMNSTYLDGTMLYRESSLVESGTCVAQSGSSFSLTDSLYSVADSTNMVDEYL-SFKNMRKIISDGEEIQKPPKFVEEDRLLGGCFNSVEFNEICAQQREKAHSVRAHMAEVF 837          
BLAST of Protein EFR3 homolog A vs. TrEMBL
Match: A0A5K4F0G9 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 685.641 bits (1768), Expect = 0.000e+0
Identity = 383/856 (44.74%), Postives = 534/856 (62.38%), Query Frame = 1
Query:  115 CGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKN-VDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMF---FDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSA-----KAGEQRTMLL---MAPR-------------------KASIFAYMALGGEIREM--------QDLSISMTSLSISENGSTIHEDD-----MKSINKMDEDLCSFASIQKLLSE--TADERRQKKRNKEIE----MNKYFREVGFEKICKDEREKYVPIRQKLLEVL 2532
            CGP RPKWMKMVDN+Y  SP D ++H+KL+ +C+ +P+KLDRIA YL   LS +L+R+   +++ ++ AI+ L+  CH  RL +  ++FLKMIQLLLE+N  DLQ++  +SFV+FS+I +D+PNYH+E + ++ HFA MAH +  N  +RN +RVAGI+GI GVVRK   DQL   V +S +++ I+P LLFNM   DK+ +D  SN    DPS EA++VF+DI+ +AS+TNI+PV++SI  ++D +K+W P DF L +    L+++K  Q AHSL+KQLVAHL    + FT  ERT +V+ I   V+SLA  A+GPD+FHNFKSLLQIL+ SI+ T             I   D     D+N        +G+ Q     FQEAII+TIAEFAKNLPDTQKIEI+KFILNF+ M     +  +R K LI VLL+TML VATQYKT +ISN  NSDFLNLLL GVA+D DP  RI VQKILHTLIDRH N  QL  +++     L     ++KP RQDI+FMKKTG + IEN++ Q++D +NKVDNLE++ CT+ L+ALEMGAEQV+ +LFRLI A Q  I D N  MP+TH+CA+HALLA+ I++L  ++ L  +  H + VI  R+  A +LLP +AFNR+NT + YP + E + +L+FS D +   L ++GYD     I ++        G+    L+   + PR                   K S  A    G  +           ++ S+  +   ++++GS+    D       S N +DE L SF +++K+++     D    +K  K +E    +   F  V F +IC  +REK   +R  + EV 
Sbjct:   11 CGPCRPKWMKMVDNLYSGSPQDTNNHNKLIHYCLHQPDKLDRIAKYLHLRLSQDLSRRYDQNISISVKAIDKLIQVCHGHRL-VLAISFLKMIQLLLETNRVDLQIMASKSFVEFSKIDDDSPNYHKECNEILDHFAAMAHASLPNPQERNAVRVAGIQGIQGVVRKMVSDQLILEVHES-NMDKIVPPLLFNM--CDKSEMDSSSNESQCDPSQEAVYVFEDIVRQASYTNIKPVVTSILTHLDNHKLWDPCDFPLLIFQYLLDSLKTTQVAHSLVKQLVAHLSLHESDFTLSERTSLVQVIGLVVISLAKGAIGPDVFHNFKSLLQILKASIDKTSQ-----------ISDPDQPSFNDSNRK-----LSGERQ-----FQEAIINTIAEFAKNLPDTQKIEILKFILNFEPMVNYHPEYGDRPKPLIMVLLQTMLTVATQYKTVAISNALNSDFLNLLLRGVAIDPDPVIRIIVQKILHTLIDRHGNTEQLLTVRIYGENGLSNYFILEKPERQDILFMKKTGVLFIENIYHQLLDPSNKVDNLEYLSCTVGLVALEMGAEQVITELFRLILAVQTKIIDENTYMPLTHRCALHALLASTITLLVQLINLQSLSEHIYTVIQRRRDIAPWLLPSVAFNRTNTVDSYPTEFEINDDLLFSSDKITESLVNTGYDTAVLSIPYNPIYLRLYDGKSPDPLIDGNIYPRVSGNEHFTNQSIYYGTVDDKNSSIANSTSGARMNSTYLDGTMLYRESSLVESGTCVAQSGSSFSLTDSLYSVADSTNMVDEYL-SFKNMRKIINVFFKGDGEEIQKPPKFVEEDRLLGGCFNSVEFNEICAQQREKAHSVRAHMAEVF 840          
BLAST of Protein EFR3 homolog A vs. TrEMBL
Match: A0A0V0J6A8 (Protein EFR3 homolog B (Fragment) OS=Schistocephalus solidus OX=70667 GN=EFR3B PE=4 SV=1)

HSP 1 Score: 685.641 bits (1768), Expect = 0.000e+0
Identity = 381/904 (42.15%), Postives = 535/904 (59.18%), Query Frame = 1
Query:   82 IMSDNKFGICTCGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNK-----------LRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTN---RSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSA-----------------------------------KAGEQRTMLLMAPRK-------------ASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTS-------SPHIDNRYGGEIYENG 2586
            +M   +F +C CGP RP+W KMVD++Y S+  D ++  KLV +CVRKP+KLD IA YL   LSS+LN  NY +VN T++A+++L+NAC+  +LNLF  +FLKM+QLLLES + +LQLLG +SF+ FSQI ED PNYHREYD LI  F +M++ N  +  +R K           +RVAGI+G+ GVVRK+  DQL+ NVL S S++ I+PALLFN+R       +E +  + +PS +A+FVFKD++CRAS+TNI PV+ +I  Y+D  ++W PSDF L +    L++IKN Q AH+L+K LV +L +       Q+R  +V+ INKTV++LA  A+GPD+FHNFK+LLQILR SIE T                              V V   +    E  FQE II+TIAEFAKNLPD QKIEI+KFILNFD +   ++N    SK +++VL+KTML VATQY+T +ISN  + DFL LLL+GVAVD D   R+FVQKILH LIDRH N  +L  +KL     +    K +KPSRQDI+FMKKTG ++ +NL+ Q++D +NKVDNLEH+ CT+ L+ALEMGAE+V+V+LFRL+ A Q       N +P+ H CA+HA+LA  +S++  +  L  +  H  EVI  RQ  A YLLPE+AFNR NT   YP ++   +EL+FS+D V+  L D+ +D TT +  + A                                   ++  QR++    PR                  AYMA     R     S+S  S++ S N ++  +     +N   ++  SF   Q++L E+ +  R++K  +   + + +  + F+ +C   R+K       + EV +         P + N   G   E G
Sbjct:   41 LMPPRRF-MCGCGPCRPQWAKMVDSLYSSNHTDGTN--KLVCYCVRKPDKLDNIAKYLHKRLSSDLNHLNYENVNITVEAMSALVNACYAVKLNLFDSSFLKMVQLLLESKLPELQLLGTKSFLAFSQIEEDAPNYHREYDELIDQFCRMSYSNLPDVEERKKSFLKKSHSFFRVRVAGIQGLQGVVRKTARDQLRMNVLQSASMDQIIPALLFNIR-EGSPTGEEPDESELEPSRQAVFVFKDVVCRASYTNIVPVVKAILSYLDGQRIWVPSDFALLIFGYLLDSIKNMQIAHNLVKALVTYLHD--TDLNTQQRISVVQVINKTVITLAKGAIGPDVFHNFKALLQILRSSIEKT------------------------------VKVAAAE----EHRFQETIINTIAEFAKNLPDAQKIEILKFILNFDPLPSGRSNCKDYSKPMVKVLVKTMLTVATQYQTVAISNAIDYDFLRLLLHGVAVDPDASIRVFVQKILHALIDRHGNGPRLLSVKLYPMNEVTSVYKREKPSRQDILFMKKTGFMLTDNLYHQLLDPSNKVDNLEHLMCTIGLVALEMGAEEVIVELFRLVLAVQQDAIS-TNSLPLPHLCAVHAILACVMSIVVPLAPLPPLVPHVEEVINRRQETASYLLPEVAFNRKNTQETYPTQLAISEELLFSKDKVRAALVDADFDATTLDTPYPAFDPLKAPPITGRVNLPSGIRVSDYNGSVGSEYGTMRSTGQRSVGNYPPRTQMGLLPSQLNDPLGGNLAYMASSTGPRHRHSDSLSSLSITASYNSTSNQQSRASGLN---QEFLSFDMAQRILHESPEAWRRRKLVESGSLAQAYSTLDFDGLCAQHRQKIQTAHMNMAEVFSDLSSEVNRRPRLSNARSGHHLERG 900          
BLAST of Protein EFR3 homolog A vs. Ensembl Cavefish
Match: efr3a (EFR3 homolog A [Source:NCBI gene;Acc:103025315])

HSP 1 Score: 391.349 bits (1004), Expect = 6.939e-122
Identity = 236/704 (33.52%), Postives = 390/704 (55.40%), Query Frame = 1
Query:   94 NKFGIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKI--QKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIE-PDKELIFSEDLVKTQLADSGYDMTTFEIAF 2154
            N  G+C  CG  RP++ ++VDNI+   P D    S   KL FF V  PEKLDRI  YL   LS ++ R  Y +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES   DLQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H    +   R ++RVAGIKG+ GVVRK+  D+LQA + + + ++ ++P++LFNM+    N D +    +E+P+  A   F++++ RA++ N+   +  + V++D +++W P++F +      + +I+  Q +H +++Q++ HL + H++ TP+ R GIV+ + +TV   A  +VGP +   F +LL+ LR S         +D  +G        +G    +  SL + +  +N+  E++ Q AII TI  F  NLPD Q+ E+M FI+    ++    +           +K++  +LL +++ V + +K  +IS    + FL  L + +++  D   R  V +ILH +IDRHDN  +L  I+++       +LKI  +K S+QD+ FMKK G  +  ++++   +  N   N E ++  L L+ +E+  E+VV+DL RL  A Q         MP+  +C I AL+AA+++ LS ++      +H  +VI LR   A YLLPE  F       + P  ++  D+ + F    +   L+  GY+     I +
Sbjct:   29 NSLGVCGCCGRCRPRYKRLVDNIFPEDPKDGLVKSDMEKLTFFAVSAPEKLDRIGEYLAERLSRDVVRHRYGYVVIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESKEPDLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSQFSAMCHSTHEDPETRTRIRVAGIKGLQGVVRKTVNDELQAIIWEPQHMDKLIPSMLFNMQ---DNDDSDRAGGEENPAALAESCFRELLGRAAYGNMNNAVRPVLVHLDNHRLWDPNEFAVSCFRIIMYSIQ-AQHSHHVIQQVLNHL-DTHSKNTPRVRAGIVQVLLETVAIAAKGSVGPTVLEVFNTLLKHLRMS---------VDFELG--------EGSRRNSGTSLSSGRVKENE--ERIVQNAIIQTIGFFGGNLPDYQRAEVMMFIMGKVPVYGTPCHTLDTVKIGHQGTKRIQTMLLSSLIMVTSGFKCKTISAGLPAAFLEPLCS-ISLMEDSELRQLVLEILHNIIDRHDNRAKLRGIRIIPN---VAALKIKREKISKQDVGFMKKHGQQLYRHIYLGCKEDDNVQKNFELLFTALALLTIELANEEVVIDLIRLSLALQDMALANEENMPMFIRCGIMALVAAYLNFLSQMIANPAFCQHVSKVIELRNMDAPYLLPEHVFREK---CVLPESLDCEDRAMYFQTADLADALSGPGYNAERLAIPY 701          
BLAST of Protein EFR3 homolog A vs. Ensembl Cavefish
Match: efr3a (EFR3 homolog A [Source:NCBI gene;Acc:103025315])

HSP 1 Score: 387.882 bits (995), Expect = 1.054e-121
Identity = 235/701 (33.52%), Postives = 389/701 (55.49%), Query Frame = 1
Query:  103 GIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKI--QKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIE-PDKELIFSEDLVKTQLADSGYDMTTFEIAF 2154
            G+C  CG  RP++ ++VDNI+   P D    S   KL FF V  PEKLDRI  YL   LS ++ R  Y +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES   DLQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H    +   R ++RVAGIKG+ GVVRK+  D+LQA + + + ++ ++P++LFNM+    N D +    +E+P+  A   F++++ RA++ N+   +  + V++D +++W P++F +      + +I+  Q +H +++Q++ HL + H++ TP+ R GIV+ + +TV   A  +VGP +   F +LL+ LR S         +D  +G        +G    +  SL + +  +N+  E++ Q AII TI  F  NLPD Q+ E+M FI+    ++    +           +K++  +LL +++ V + +K  +IS    + FL  L + +++  D   R  V +ILH +IDRHDN  +L  I+++       +LKI  +K S+QD+ FMKK G  +  ++++   +  N   N E ++  L L+ +E+  E+VV+DL RL  A Q         MP+  +C I AL+AA+++ LS ++      +H  +VI LR   A YLLPE  F       + P  ++  D+ + F    +   L+  GY+     I +
Sbjct:    6 GVCGCCGRCRPRYKRLVDNIFPEDPKDGLVKSDMEKLTFFAVSAPEKLDRIGEYLAERLSRDVVRHRYGYVVIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESKEPDLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSQFSAMCHSTHEDPETRTRIRVAGIKGLQGVVRKTVNDELQAIIWEPQHMDKLIPSMLFNMQ---DNDDSDRAGGEENPAALAESCFRELLGRAAYGNMNNAVRPVLVHLDNHRLWDPNEFAVSCFRIIMYSIQ-AQHSHHVIQQVLNHL-DTHSKNTPRVRAGIVQVLLETVAIAAKGSVGPTVLEVFNTLLKHLRMS---------VDFELG--------EGSRRNSGTSLSSGRVKENE--ERIVQNAIIQTIGFFGGNLPDYQRAEVMMFIMGKVPVYGTPCHTLDTVKIGHQGTKRIQTMLLSSLIMVTSGFKCKTISAGLPAAFLEPLCS-ISLMEDSELRQLVLEILHNIIDRHDNRAKLRGIRIIPN---VAALKIKREKISKQDVGFMKKHGQQLYRHIYLGCKEDDNVQKNFELLFTALALLTIELANEEVVIDLIRLSLALQDMALANEENMPMFIRCGIMALVAAYLNFLSQMIANPAFCQHVSKVIELRNMDAPYLLPEHVFREK---CVLPESLDCEDRAMYFQTADLADALSGPGYNAERLAIPY 675          
BLAST of Protein EFR3 homolog A vs. Ensembl Cavefish
Match: efr3a (EFR3 homolog A [Source:NCBI gene;Acc:103025315])

HSP 1 Score: 390.963 bits (1003), Expect = 2.842e-121
Identity = 236/704 (33.52%), Postives = 390/704 (55.40%), Query Frame = 1
Query:   94 NKFGIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKI--QKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIE-PDKELIFSEDLVKTQLADSGYDMTTFEIAF 2154
            N  G+C  CG  RP++ ++VDNI+   P D    S   KL FF V  PEKLDRI  YL   LS ++ R  Y +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES   DLQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H    +   R ++RVAGIKG+ GVVRK+  D+LQA + + + ++ ++P++LFNM+    N D +    +E+P+  A   F++++ RA++ N+   +  + V++D +++W P++F +      + +I+  Q +H +++Q++ HL + H++ TP+ R GIV+ + +TV   A  +VGP +   F +LL+ LR S         +D  +G        +G    +  SL + +  +N+  E++ Q AII TI  F  NLPD Q+ E+M FI+    ++    +           +K++  +LL +++ V + +K  +IS    + FL  L + +++  D   R  V +ILH +IDRHDN  +L  I+++       +LKI  +K S+QD+ FMKK G  +  ++++   +  N   N E ++  L L+ +E+  E+VV+DL RL  A Q         MP+  +C I AL+AA+++ LS ++      +H  +VI LR   A YLLPE  F       + P  ++  D+ + F    +   L+  GY+     I +
Sbjct:   29 NSLGVCGCCGRCRPRYKRLVDNIFPEDPKDGLVKSDMEKLTFFAVSAPEKLDRIGEYLAERLSRDVVRHRYGYVVIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESKEPDLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSQFSAMCHSTHEDPETRTRIRVAGIKGLQGVVRKTVNDELQAIIWEPQHMDKLIPSMLFNMQ---DNDDSDRAGGEENPAALAESCFRELLGRAAYGNMNNAVRPVLVHLDNHRLWDPNEFAVSCFRIIMYSIQ-AQHSHHVIQQVLNHL-DTHSKNTPRVRAGIVQVLLETVAIAAKGSVGPTVLEVFNTLLKHLRMS---------VDFELG--------EGSRRNSGTSLSSGRVKENE--ERIVQNAIIQTIGFFGGNLPDYQRAEVMMFIMGKVPVYGTPCHTLDTVKIGHQGTKRIQTMLLSSLIMVTSGFKCKTISAGLPAAFLEPLCS-ISLMEDSELRQLVLEILHNIIDRHDNRAKLRGIRIIPN---VAALKIKREKISKQDVGFMKKHGQQLYRHIYLGCKEDDNVQKNFELLFTALALLTIELANEEVVIDLIRLSLALQDMALANEENMPMFIRCGIMALVAAYLNFLSQMIANPAFCQHVSKVIELRNMDAPYLLPEHVFREK---CVLPESLDCEDRAMYFQTADLADALSGPGYNAERLAIPY 701          
BLAST of Protein EFR3 homolog A vs. Ensembl Cavefish
Match: efr3a (EFR3 homolog A [Source:NCBI gene;Acc:103025315])

HSP 1 Score: 389.037 bits (998), Expect = 3.027e-121
Identity = 235/701 (33.52%), Postives = 389/701 (55.49%), Query Frame = 1
Query:  103 GIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKI--QKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIE-PDKELIFSEDLVKTQLADSGYDMTTFEIAF 2154
            G+C  CG  RP++ ++VDNI+   P D    S   KL FF V  PEKLDRI  YL   LS ++ R  Y +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES   DLQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H    +   R ++RVAGIKG+ GVVRK+  D+LQA + + + ++ ++P++LFNM+    N D +    +E+P+  A   F++++ RA++ N+   +  + V++D +++W P++F +      + +I+  Q +H +++Q++ HL + H++ TP+ R GIV+ + +TV   A  +VGP +   F +LL+ LR S         +D  +G        +G    +  SL + +  +N+  E++ Q AII TI  F  NLPD Q+ E+M FI+    ++    +           +K++  +LL +++ V + +K  +IS    + FL  L + +++  D   R  V +ILH +IDRHDN  +L  I+++       +LKI  +K S+QD+ FMKK G  +  ++++   +  N   N E ++  L L+ +E+  E+VV+DL RL  A Q         MP+  +C I AL+AA+++ LS ++      +H  +VI LR   A YLLPE  F       + P  ++  D+ + F    +   L+  GY+     I +
Sbjct:    4 GVCGCCGRCRPRYKRLVDNIFPEDPKDGLVKSDMEKLTFFAVSAPEKLDRIGEYLAERLSRDVVRHRYGYVVIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESKEPDLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSQFSAMCHSTHEDPETRTRIRVAGIKGLQGVVRKTVNDELQAIIWEPQHMDKLIPSMLFNMQ---DNDDSDRAGGEENPAALAESCFRELLGRAAYGNMNNAVRPVLVHLDNHRLWDPNEFAVSCFRIIMYSIQ-AQHSHHVIQQVLNHL-DTHSKNTPRVRAGIVQVLLETVAIAAKGSVGPTVLEVFNTLLKHLRMS---------VDFELG--------EGSRRNSGTSLSSGRVKENE--ERIVQNAIIQTIGFFGGNLPDYQRAEVMMFIMGKVPVYGTPCHTLDTVKIGHQGTKRIQTMLLSSLIMVTSGFKCKTISAGLPAAFLEPLCS-ISLMEDSELRQLVLEILHNIIDRHDNRAKLRGIRIIPN---VAALKIKREKISKQDVGFMKKHGQQLYRHIYLGCKEDDNVQKNFELLFTALALLTIELANEEVVIDLIRLSLALQDMALANEENMPMFIRCGIMALVAAYLNFLSQMIANPAFCQHVSKVIELRNMDAPYLLPEHVFREK---CVLPESLDCEDRAMYFQTADLADALSGPGYNAERLAIPY 673          
BLAST of Protein EFR3 homolog A vs. Ensembl Cavefish
Match: efr3bb (EFR3 homolog Bb (S. cerevisiae) [Source:NCBI gene;Acc:561353])

HSP 1 Score: 364.385 bits (934), Expect = 6.344e-112
Identity = 221/658 (33.59%), Postives = 374/658 (56.84%), Query Frame = 1
Query:  196 KLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQES--------NNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIG-KTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN---FDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIE-PDKELIFSEDLVKTQLADSGYD 2130
            KL F+ +  PEKLDRI +YL   LS ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM++ LLES+  +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H +  +   R K+R+AGIKG+ GVVRK+  D+LQAN+ D + ++ I+P+LLFN++ P +  +  S            E P+      F++++ RA++ NI+  ++ + +++D + +W    F +      + +I++ Q +H +++QL+ HL + +++ +   R GIV  + +     AS +VGP +   F +LL+ L+ S++   + S    ++G KTI + +                       E+  QEA+I TI  FA  LP  Q+ E+M FI+       M    +   + +  +LLK++ QV T +++ ++     S FL+ LL+  A+  D   R+ V +IL +LIDRHDN  + + I +++  ++   LK++K SRQD +FMKK    +  ++++   +Q++   + E +Y  L LI++E+  E+VVVDL RL  A Q         +PV ++CA+HAL AA+++++  +  +    +H HEVI +RQ    +LLPE  F         P  +E P+ E++F +  V   L  SG++
Sbjct:    3 KLTFYALSAPEKLDRIGAYLSERLSRDVARHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVRKLLESDKPNLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSFEDPDFRIKIRMAGIKGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQ-PGEGTESRSPSPLQASEGKEKESPAELTERCFRELLGRAAYGNIKNAVTPVLMHLDNHSLWEGKTFAVRCFKIIMYSIQS-QHSHLVIQQLLGHL-DANSKTSATVRAGIVEVLLEAAAIAASGSVGPTVLEVFNTLLRQLKLSVDYELTGSYDCTTMGTKTIKEHE-----------------------ERQLQEAVIMTIGSFANTLPTYQRSEVMLFIMGKIPIPGMHPTLSEADRLIQLMLLKSLRQVTTGFQSTNMLTALPSSFLDPLLS-FALLEDAHIRLLVLEILVSLIDRHDNLPKFSTISIISDISVL-KLKMEKCSRQDNLFMKKHAQQLYRHIYLSCKEQSSMQPHFEMLYTLLALISMELANEEVVVDLIRLALALQDLALASEETLPVYNRCAVHALSAAYLNLICQLTTVPTFCQHVHEVIEVRQKDCPFLLPEDIFIEDPK---IPEVLEKPEGEVLFQQAKVTEVLGGSGFN 629          
BLAST of Protein EFR3 homolog A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009977.1 (pep scaffold:Pmarinus_7.0:GL476399:1664401:1739396:-1 gene:ENSPMAG00000009014.1 transcript:ENSPMAT00000009977.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 342.428 bits (877), Expect = 6.679e-106
Identity = 210/665 (31.58%), Postives = 351/665 (52.78%), Query Frame = 1
Query:  103 GICTC-GPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRL---------PDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMF---------FDKTNRSKQLIRVLLKTMLQVATQYK-TGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQ-VVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFN 2025
            G+C C G FRP++  +VD+IY  +P D     S  +L F+ V  PEKLDRI SYL   LS ++ R+ + +V  +M+A++ L+ ACH+Q +N FV +FLKM+Q LLESN   LQ+LG  SFV+F+ I EDTP+YHR+YD+L+S F+ M H N  + +    + + G +G  G V+KS+   LQ ++        ++ +L  N++          P +     +    E P + A    ++++ RA++ NI  +I  + +++D + +W P+ F +      + +++N Q AH ++++L+ HL + H++     R G+V+ +++TV      ++GP +   F SLL+ LR S++     S + +               D NA         D    E +FQ++++ TI  FA  LPD Q+ EIM FI+    +           DK         +LL+++L+V   +K  GS+        L  LL   A+  +   R+   ++LH L+DRH N  +L  +++++       LK++K S+QD  FMKK G  +   L+   + + N   + E +Y TL L+ LE G E+ V +DL RL  A Q    +  +   V  +CA H ++AAF+S+L+    L  + +H   V+  R+  A YLLP++  +
Sbjct:    3 GVCGCFGAFRPRYKVLVDSIYPINPQDGLVKPSMERLTFYAVSAPEKLDRIGSYLSARLSRDVARRRHEYVVISMEALDKLLMACHSQCINHFVESFLKMVQKLLESNEPQLQILGTNSFVKFANIEEDTPSYHRQYDFLVSKFSAMCHSNIEDPTTCTDIHILGSRGKEGQVKKSSRGVLQRSLWLPSPSPRVVGSLKHNLQQIAEQNGYAGPGQTPGSPAPMEQEKPESLAESCLRELLSRAAYGNIDSIIRPVLMHLDGHSLWDPNTFAVRCFKIIMYSVQN-QHAHMVLQKLLGHL-DTHSKARATVRAGVVQVLSETVSIATGGSIGPAVLEVFNSLLKHLRLSVDQELRLSNVGQ---------------DDNAI--------DGASAEAMFQDSVVKTIGSFAGILPDYQRSEIMMFIMGKMPLHGVGVDMGSTGDKEQADHMYQVMLLRSVLKVVPDHKAAGSLLLALPGPVLEPLL-WPALLEEAEARVLALRVLHGLLDRHHNRDKLTAVRIVHDLASL-KLKMEKCSKQDATFMKKNGQRLYGWLYESCVAEGNTRAHYEALYVTLALLVLETGGEEFVAIDLLRLAVALQEAALEEESCSSVFARCATHGVVAAFLSLLAQRPALRPLLQHVTAVVEHRRKVAPYLLPDVVLS 640          
BLAST of Protein EFR3 homolog A vs. Ensembl Nematostella
Match: EDO43830 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXE2])

HSP 1 Score: 335.88 bits (860), Expect = 7.161e-102
Identity = 200/677 (29.54%), Postives = 370/677 (54.65%), Query Frame = 1
Query:  106 ICTC-GPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIE----STGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN-----------FDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLL--NRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVI-LLRQSKAKYLLPELAFNRSNTANMYPNKIEPD 2070
            IC+C G F P++ ++VDNI+ +        ++  KL+F+ +  PEKLDRI +YL   L+  ++RK Y  V  +M+A++ L+ ACH   LNLFV +FL+M+Q LLES   +LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M  +++ N+  R ++R +G++G+ GVVRK+  D LQ N+ D+  ++ I+P+LLF +   +K+ ++  +  D+DP+  A    ++++ RASF NI+ VI+ +  +++ +++W P++F L V    + +++N Q  + +++ L+++L     + + +++ G+V  + + V      ++GP +   F +LL+ LR S++    S+G   K++                             D  D    F+++I+ TI  FA  LPD QK ++M FI++            D      T    +L ++LL ++ QV+  Y   S+S +F+  F++ + +   V+ +P  R    +++  LIDRH+N++ L    +L   +E     L ++K  +QD++F +K    II  L+     +TN V N+  IY T+  I+ EM   +V+  L  L+F  Q+      +++    +CA+HA++AAF+ + + ++ L  +  +  EV  + +++   Y    +A+     + +      P+
Sbjct:    6 ICSCFGNFGPRYKRLVDNIFPADARSGLVKANMDKLIFYALSSPEKLDRIGTYLARKLTRFVDRKRYDFVRISMEALDLLLMACHAPSLNLFVESFLRMVQKLLESPEAELQVLGTSSFVKFANIEEDTPSYHRRYDFFVSKFSAMCWNDNENQKHRQQIRTSGLRGLQGVVRKTVSDDLQVNLWDNTHISKIVPSLLFILEESEKSFNEFQS--DDDPAHIAEACLRELMSRASFGNIKSVINPVLNHLNSSELWVPNEFALKVFKIIMFSVQN-QYNYVVIQMLLSYLDASSKE-SAKKKAGVVSVLAECVGLATGSSIGPAVLEVFNTLLRHLRYSVDARFNSSGHGCKLE-----------------------------DEMD----FEQSIVHTIGAFAALLPDFQKTDVMLFIMDKFPHRNTNQHTSDRRSLRFTESDVELQKMLLHSLRQVSVSYNPTSLSAVFSPSFMDAIFHAAIVE-NPEVRQLALEVIFALIDRHNNSKNLGLNGMLKDGKEI---QLNVEKCPKQDLMFFQKYHDQIIWYLYESASMRTNNVSNILAIYVTMATISTEMSEMEVISQLVPLVFGFQNMAMKEESKISTACRCALHAVVAAFLILAAQLLRLETLSDYAEEVYEMFKKAGCDYKGIRVAYEHQELSGVLARTSSPE 641          
BLAST of Protein EFR3 homolog A vs. Ensembl Medaka
Match: efr3a (EFR3 homolog A [Source:NCBI gene;Acc:101167822])

HSP 1 Score: 406.371 bits (1043), Expect = 4.124e-127
Identity = 266/877 (30.33%), Postives = 465/877 (53.02%), Query Frame = 1
Query:   94 NKFGIC-TCGPFRPKWMKMVDNIYKSSPNDNSSHS---KLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMR---LPDKNVDQES-----NNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDP-EKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKI--QKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEV--LTSSPHIDNRYGGEIYENGYMCNDVPDIWEIDYPKLFV 2643
            N  G+C  CGP RP++ ++VDNI+   P D  S S   KL F+ V  PEKLDRI +YL   LS ++ R  Y +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES   DLQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H    +   RN++RVAGIKG+ GVVRK+  D+LQA + + + ++ ++P++LFNM+    PD+     +      + +E+P+  A   F++++ RA++ N+   +  + V++D + +W P+DF +      + +I+  Q +H +++Q++ HL + +N+ TP+ R GIV+ + +TV   A  +VGP +   F +LL+ LR S         +D  +G++  ++           S  +V +G  ++  E++ Q AII TI  F  NLPD Q+ E+M FI+    ++    +           +K++  +LL +++ V + +K+ S+S      FL+ L + +++  D   R  V +ILH +IDRHDN  +L  I+++       +LKI  +K S+QDI FMKK G  +  ++++   ++ N   N E ++ TL ++ +E+  E+VV+DL RL  A Q         MP+  +C I A +AA+++ LS ++      +H  +VI +R  +A +LLPE  F   +   +  +  + DK L F    +   LA  GY+     + +  +  ++  +     R+ S    ++          L + +   S+ +  S + E+             +FA+++K +  T  E +++++ +++ M K F++  FE+I      K   +  +L ++  LT  P         I         VP ++E+ +P L V
Sbjct:    6 NDCGVCGCCGPLRPRYKRLVDNIFPEDPKDGLSKSDMEKLTFYAVSAPEKLDRIGAYLAERLSRDVVRHRYGYVVIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESREPDLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSQFSAMCHSMHEDTDTRNRIRVAGIKGLQGVVRKTVNDELQAIIWEPQHMDKLIPSMLFNMQDGEEPDRTGHPSTPSGTGQDGEENPAVLAENCFRELLGRAAYGNMNNAVRPVLVHLDNHHLWDPNDFAVSCFRIIMYSIQA-QHSHHVIQQVLNHL-DTNNKSTPRVRAGIVQVLLETVAIAAKGSVGPTVLEVFNTLLKHLRMS---------VDFELGESSRRN-----------SACSVSSGRGKESEERIVQNAIIQTIGFFGGNLPDYQRAEVMMFIMGKVPVYGTPCHTLDTVKIGHRGTKRIQTMLLSSLIMVTSGFKSKSMSTALPPSFLDPLFS-ISLMEDSELRQLVLEILHNIIDRHDNRAKLRGIRIIPN---VAALKIKREKISKQDIAFMKKHGQQLYRHIYLGCKEEDNNHKNFELLFTTLAIVTIELANEEVVIDLIRLSIALQEMCLINEENMPMFIRCGIMASVAAYLNFLSQMIANPPFCQHVSKVIEMRSVEALFLLPEHIFK--DKCPLPESLDKEDKHLYFQTADIAECLAGPGYNAERLSVPYIPQVTDEDRLT----RRKSFVDTIS----------LQVDIMPNSLPDKQSQLAEE------------ITFATLKKAIDTTGLEEQEREKRRQL-MEK-FQKAPFEEIAAHCESKANMLHDRLAQIFELTIRPPPSPSGVVSISAGHTQHPSVP-VYEMKFPDLCV 825          
BLAST of Protein EFR3 homolog A vs. Ensembl Medaka
Match: efr3a (EFR3 homolog A [Source:NCBI gene;Acc:101167822])

HSP 1 Score: 404.06 bits (1037), Expect = 2.131e-126
Identity = 265/874 (30.32%), Postives = 464/874 (53.09%), Query Frame = 1
Query:  103 GIC-TCGPFRPKWMKMVDNIYKSSPNDNSSHS---KLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMR---LPDKNVDQES-----NNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDP-EKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKI--QKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEV--LTSSPHIDNRYGGEIYENGYMCNDVPDIWEIDYPKLFV 2643
            G+C  CGP RP++ ++VDNI+   P D  S S   KL F+ V  PEKLDRI +YL   LS ++ R  Y +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES   DLQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H    +   RN++RVAGIKG+ GVVRK+  D+LQA + + + ++ ++P++LFNM+    PD+     +      + +E+P+  A   F++++ RA++ N+   +  + V++D + +W P+DF +      + +I+  Q +H +++Q++ HL + +N+ TP+ R GIV+ + +TV   A  +VGP +   F +LL+ LR S         +D  +G++  ++           S  +V +G  ++  E++ Q AII TI  F  NLPD Q+ E+M FI+    ++    +           +K++  +LL +++ V + +K+ S+S      FL+ L + +++  D   R  V +ILH +IDRHDN  +L  I+++       +LKI  +K S+QDI FMKK G  +  ++++   ++ N   N E ++ TL ++ +E+  E+VV+DL RL  A Q         MP+  +C I A +AA+++ LS ++      +H  +VI +R  +A +LLPE  F   +   +  +  + DK L F    +   LA  GY+     + +  +  ++  +     R+ S    ++          L + +   S+ +  S + E+             +FA+++K +  T  E +++++ +++ M K F++  FE+I      K   +  +L ++  LT  P         I         VP ++E+ +P L V
Sbjct:    4 GVCGCCGPLRPRYKRLVDNIFPEDPKDGLSKSDMEKLTFYAVSAPEKLDRIGAYLAERLSRDVVRHRYGYVVIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESREPDLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSQFSAMCHSMHEDTDTRNRIRVAGIKGLQGVVRKTVNDELQAIIWEPQHMDKLIPSMLFNMQDGEEPDRTGHPSTPSGTGQDGEENPAVLAENCFRELLGRAAYGNMNNAVRPVLVHLDNHHLWDPNDFAVSCFRIIMYSIQA-QHSHHVIQQVLNHL-DTNNKSTPRVRAGIVQVLLETVAIAAKGSVGPTVLEVFNTLLKHLRMS---------VDFELGESSRRN-----------SACSVSSGRGKESEERIVQNAIIQTIGFFGGNLPDYQRAEVMMFIMGKVPVYGTPCHTLDTVKIGHRGTKRIQTMLLSSLIMVTSGFKSKSMSTALPPSFLDPLFS-ISLMEDSELRQLVLEILHNIIDRHDNRAKLRGIRIIPN---VAALKIKREKISKQDIAFMKKHGQQLYRHIYLGCKEEDNNHKNFELLFTTLAIVTIELANEEVVIDLIRLSIALQEMCLINEENMPMFIRCGIMASVAAYLNFLSQMIANPPFCQHVSKVIEMRSVEALFLLPEHIFK--DKCPLPESLDKEDKHLYFQTADIAECLAGPGYNAERLSVPYIPQVTDEDRLT----RRKSFVDTIS----------LQVDIMPNSLPDKQSQLAEE------------ITFATLKKAIDTTGLEEQEREKRRQL-MEK-FQKAPFEEIAAHCESKANMLHDRLAQIFELTIRPPPSPSGVVSISAGHTQHPSVP-VYEMKFPDLCV 820          
BLAST of Protein EFR3 homolog A vs. Ensembl Medaka
Match: efr3a (EFR3 homolog A [Source:NCBI gene;Acc:101167822])

HSP 1 Score: 390.193 bits (1001), Expect = 6.863e-121
Identity = 265/899 (29.48%), Postives = 464/899 (51.61%), Query Frame = 1
Query:  103 GIC-TCGPFRPKWMKMVDNIYKSSPNDNSSHS---KLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMR---LPDKNVDQES-----NNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAV-------------------------GPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDP-EKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNR----------SKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKI--QKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEV--LTSSPHIDNRYGGEIYENGYMCNDVPDIWEIDYPKLFV 2643
            G+C  CGP RP++ ++VDNI+   P D  S S   KL F+ V  PEKLDRI +YL   LS ++ R  Y +V   M+A++ L+ ACH+Q +  FV +FL M+  LLES   DLQ+LG  SFV+F+ I EDTP+YHR YD+ +S F+ M H    +   RN++RVAGIKG+ GVVRK+  D+LQA + + + ++ ++P++LFNM+    PD+     +      + +E+P+  A   F++++ RA++ N+   +  + V++D + +W P+DF +      + +I+  Q +H +++Q++ HL + +N+ TP+ R GIV+ + +TV   A  +V                         GP +   F +LL+ LR S         +D  +G++  ++           S  +V +G  ++  E++ Q AII TI  F  NLPD Q+ E+M FI+    ++    +           +K++  +LL +++ V + +K+ S+S      FL+ L + +++  D   R  V +ILH +IDRHDN  +L  I+++       +LKI  +K S+QDI FMKK G  +  ++++   ++ N   N E ++ TL ++ +E+  E+VV+DL RL  A Q         MP+  +C I A +AA+++ LS ++      +H  +VI +R  +A +LLPE  F   +   +  +  + DK L F    +   LA  GY+     + +  +  ++  +     R+ S    ++          L + +   S+ +  S + E+             +FA+++K +  T  E +++++ +++ M K F++  FE+I      K   +  +L ++  LT  P         I         VP ++E+ +P L V
Sbjct:    4 GVCGCCGPLRPRYKRLVDNIFPEDPKDGLSKSDMEKLTFYAVSAPEKLDRIGAYLAERLSRDVVRHRYGYVVIAMEALDQLLMACHSQSIKPFVESFLHMVAKLLESREPDLQVLGTNSFVKFANIEEDTPSYHRRYDFFVSQFSAMCHSMHEDTDTRNRIRVAGIKGLQGVVRKTVNDELQAIIWEPQHMDKLIPSMLFNMQDGEEPDRTGHPSTPSGTGQDGEENPAVLAENCFRELLGRAAYGNMNNAVRPVLVHLDNHHLWDPNDFAVSCFRIIMYSIQA-QHSHHVIQQVLNHL-DTNNKSTPRVRAGIVQVLLETVAIAAKGSVGMIQESRRSDAISFESENNPPNLWLGPTVLEVFNTLLKHLRMS---------VDFELGESSRRN-----------SACSVSSGRGKESEERIVQNAIIQTIGFFGGNLPDYQRAEVMMFIMGKVPVYGTPCHTLDTVKIGHRGTKRIQTMLLSSLIMVTSGFKSKSMSTALPPSFLDPLFS-ISLMEDSELRQLVLEILHNIIDRHDNRAKLRGIRIIPN---VAALKIKREKISKQDIAFMKKHGQQLYRHIYLGCKEEDNNHKNFELLFTTLAIVTIELANEEVVIDLIRLSIALQEMCLINEENMPMFIRCGIMASVAAYLNFLSQMIANPPFCQHVSKVIEMRSVEALFLLPEHIFK--DKCPLPESLDKEDKHLYFQTADIAECLAGPGYNAERLSVPYIPQVTDEDRLT----RRKSFVDTIS----------LQVDIMPNSLPDKQSQLAEE------------ITFATLKKAIDTTGLEEQEREKRRQL-MEK-FQKAPFEEIAAHCESKANMLHDRLAQIFELTIRPPPSPSGVVSISAGHTQHPSVP-VYEMKFPDLCV 845          
BLAST of Protein EFR3 homolog A vs. Ensembl Medaka
Match: efr3bb (EFR3 homolog B [Source:NCBI gene;Acc:101157100])

HSP 1 Score: 388.267 bits (996), Expect = 1.954e-120
Identity = 236/698 (33.81%), Postives = 393/698 (56.30%), Query Frame = 1
Query:  103 GIC-TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVD------QESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHL-GNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSI--ESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN-----FDSMFFDKTNRSKQLIR----VLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYD 2130
            G+C  CG  RP++ ++VDNI+   P D    S+  KL F+ +  PEKLDRI +YL   LS ++ R  Y +V   M+A++ L+ ACH Q +NLFV +FLKM++ LLES+   LQ+LG  SFV+F+ I EDTP+YHR YD+ +S F++M H +  +   R  +R+AGI+G+ GVVRK+  D+LQAN+ D + ++ I+P+LLFN++  +          Q S    E P       F++++ RA+F NI+  ++ + +++D + +W    F +      + +I++ Q +H +++QL+ HL  N  N  T   R GIV  + +     AS +VGP +   F +L++ LR S+  E TGS      +IG  I K+                        E+  QEA+I TI  FA  LP  Q+ E+M FI+        S+    ++   ++ R    +LLK+++QV   ++T ++     S FL  LL+  ++  DP  R+ V +IL +LIDRH+N  + + I +++  ++   LK+ K SRQD +FMKK G  +  ++++   ++T+  ++ E ++  L L+++E+  E+VVVDL RL  A Q      +  +P  ++CA+HAL AA+++++  +  +    +H HEVI +R+ +  YLLPE  F + +      +KI  D +++F +  +   L  SGY+
Sbjct:    3 GVCGCCGALRPRYKRLVDNIFPEDPEDGLVKSNMEKLTFYALSAPEKLDRIGAYLSERLSRDVARHRYGYVCIAMEALDQLLMACHCQSINLFVESFLKMVRKLLESDKPSLQILGTNSFVKFANIEEDTPSYHRSYDFFVSRFSEMCHSSYEDPDIRTNIRMAGIRGLQGVVRKTVNDELQANIWDPQHMDKIVPSLLFNLQSEEGTESRSPSPLQASEKEKESPVELTERCFRELLGRAAFGNIKSAVTPVLMHLDNHSLWEGKTFAVRCFKIIMYSIQS-QHSHLVIQQLLGHLDANSKNSAT--VRAGIVEVLLEAAAIAASGSVGPTVLEVFNTLVKQLRLSVDYELTGSYDG-STNIGTKIIKAHE----------------------ERQLQEAVIRTIGSFANTLPTYQRSEVMLFIMGKIPVPGVSLTLPSSDSGPEVTRMIQIMLLKSLVQVTAGFQTTNMLTALPSSFLEPLLS-FSLTEDPEIRLLVLEILLSLIDRHENRPKFSRISIVSDISVL-KLKLDKCSRQDNLFMKKHGQQLYRHIYLNCKEETSAQEHYETLFALLGLLSVELANEEVVVDLIRLALALQDLALCTDEPLPTYNRCAVHALAAAYLNLICQLTTVPAFCQHIHEVIEVRRKEKPYLLPEDVFTQKSKLPSSLDKI--DADVLFLQSKITEVLGGSGYN 670          
BLAST of Protein EFR3 homolog A vs. Ensembl Medaka
Match: ENSORLT00000001777.2 (protein EFR3 homolog B-like [Source:NCBI gene;Acc:101166452])

HSP 1 Score: 346.28 bits (887), Expect = 4.003e-105
Identity = 220/687 (32.02%), Postives = 374/687 (54.44%), Query Frame = 1
Query:  112 TCGPFRPKWMKMVDNIYKSSPNDN---SSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQE-RTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILN---FDSMF--FDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFG----SLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQ-HYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNK-IEPDKELIFSEDLVKTQLADSGY 2127
             C   RP++ ++VDNI+   P D    ++  KL FF +  PEKLDRIA+YL   L+  LNR  Y +V+  M+A+  L+ ACH Q +NL V +FL  ++LLLE++   L +L   SF++F+ I EDTP+YHR YD+ +S F++M H +  + + + K+RV+GI+G+ GVVRK+  D+LQAN+ + R +  I+PALL N++ P  N    S++   D  TE    F++++ RA++ +I   I  + +++D + +W    F +      + +I++ Q +H +++QL+ HL  + N  +P   R GIV  +++  V  A+ +VGP +   F +LL+ LRQS++   +               DN     T +P             EK+ Q+A+I TI  FA  LP  Q+ E+M FI+       ++      N  + +  +LLK++LQV+  Y++ ++     S FL  LL+   ++ DP  R+ V  IL +LIDR  NA      +L++    F      LK  + SRQD +F++K    +  ++F+   ++++  ++   ++  L ++ +E+  E+V+VDL RL+ A Q   +      + V ++C IHA+ +A +++LS +     + +H  EV   RQ +A YLLP+    R       P K ++ D+ ++F    +   LA S Y
Sbjct:   12 CCWALRPRYKRLVDNIFPEDPEDGLVKANMEKLTFFALSAPEKLDRIAAYLSERLTRELNRHRYGYVSIAMEAMEQLLLACHCQSINLLVESFLSTLRLLLEADKPHLHILATNSFLKFANIEEDTPSYHRSYDFFVSRFSEMCHSDHHDPNTKLKIRVSGIRGLQGVVRKTVDDELQANIWEPRHMEQIVPALLVNLQ-PHGN----SSSRKFDCCTEV--CFRELLGRAAYGHINNAIRPVLMHLDSHSLWEGRGFAVRCFQIIMYSIQS-QHSHLVIQQLLGHL--DANSRSPASVRAGIVEVLSEAAVIEAAGSVGPTVLEVFNTLLRQLRQSVDYQLTGYY------------DNARKHKTTSPE------------EKMLQDAVIKTIGSFANTLPVYQRSEVMLFIMGRIPVPGIYPALGSPNAGRMIQVMLLKSLLQVSEPYESNNLLTALPSSFLEPLLSFTLME-DPEIRLLVLSILTSLIDRRHNA-----CRLISTSAAFEVSALELKEDECSRQDNLFIRKHAQRLYRHVFLASKEESSGHNHYRALFTLLGVLGVELANEEVLVDLIRLVLAMQVSGVLQVIENLSVFNRCGIHAVCSASLNLLSQLGPPPALRQHVAEVTETRQKEAPYLLPDHILFR------IPEKELKMDEAILFKASKICEALAGSSY 652          
BLAST of Protein EFR3 homolog A vs. Planmine SMEST
Match: SMESG000057540.1 (SMESG000057540.1)

HSP 1 Score: 1764.59 bits (4569), Expect = 0.000e+0
Identity = 851/854 (99.65%), Postives = 852/854 (99.77%), Query Frame = 1
Query:   85 MSDNKFGICTCGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTSSPHIDNRYGGEIYENGYMCNDVPDIWEIDYPKLFVA 2646
            MSDNKFGICTCGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFA+QHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRH HEVILLR SKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTSSPHIDNRYGGEIYENGYMCNDVPDIWEIDYPKLFVA
Sbjct:    1 MSDNKFGICTCGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFAAQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHAHEVILLRHSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTSSPHIDNRYGGEIYENGYMCNDVPDIWEIDYPKLFVA 854          
BLAST of Protein EFR3 homolog A vs. Planmine SMEST
Match: SMESG000057540.1 (SMESG000057540.1)

HSP 1 Score: 1733.77 bits (4489), Expect = 0.000e+0
Identity = 839/854 (98.24%), Postives = 841/854 (98.48%), Query Frame = 1
Query:   85 MSDNKFGICTCGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTSSPHIDNRYGGEIYENGYMCNDVPDIWEIDYPKLFVA 2646
            MSDNKFGICTCGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFA+QHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRH HEVILLR SKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTML           +MALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTSSPHIDNRYGGEIYENGYMCNDVPDIWEIDYPKLFVA
Sbjct:    1 MSDNKFGICTCGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFAAQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHAHEVILLRHSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTML-----------HMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSINKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKDEREKYVPIRQKLLEVLTSSPHIDNRYGGEIYENGYMCNDVPDIWEIDYPKLFVA 843          
BLAST of Protein EFR3 homolog A vs. Planmine SMEST
Match: SMESG000057540.1 (SMESG000057540.1)

HSP 1 Score: 1465.67 bits (3793), Expect = 0.000e+0
Identity = 709/712 (99.58%), Postives = 710/712 (99.72%), Query Frame = 1
Query:   85 MSDNKFGICTCGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFA 2220
            MSDNKFGICTCGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFA+QHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRH HEVILLR SKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFA
Sbjct:    1 MSDNKFGICTCGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKLDRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFLKMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMAHDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPALLFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIFVYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQFTPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNSKIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIAEFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLIRVLLKTMLQVATQYKTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQLNEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKVDNLEHIYCTLCLIALEMGAEQVVVDLFRLIFAAQHYIRDPNNRMPVTHQCAIHALLAAFISMLSLIVELNEVYRHAHEVILLRHSKAKYLLPELAFNRSNTANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTMLLMAPRKASIFA 712          
The following BLAST results are available for this feature:
BLAST of Protein EFR3 homolog A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EFR3B8.630e-12934.29EFR3 homolog B [Source:HGNC Symbol;Acc:HGNC:29155][more]
EFR3B1.468e-12734.29EFR3 homolog B [Source:HGNC Symbol;Acc:HGNC:29155][more]
EFR3A4.643e-12329.74EFR3 homolog A [Source:HGNC Symbol;Acc:HGNC:28970][more]
EFR3A8.916e-12329.74EFR3 homolog A [Source:HGNC Symbol;Acc:HGNC:28970][more]
EFR3B9.841e-11834.34EFR3 homolog B [Source:HGNC Symbol;Acc:HGNC:29155][more]
back to top
BLAST of Protein EFR3 homolog A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
efr-36.484e-8729.26pep chromosome:WBcel235:II:6318087:6321101:-1 gene... [more]
efr-36.484e-8729.26pep chromosome:WBcel235:II:6318087:6321159:-1 gene... [more]
back to top
BLAST of Protein EFR3 homolog A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
stmA1.216e-10929.09gene:FBgn0086784 transcript:FBtr0088716[more]
stmA6.324e-10928.97gene:FBgn0086784 transcript:FBtr0088715[more]
stmA9.163e-10728.44gene:FBgn0086784 transcript:FBtr0339341[more]
stmA4.245e-10628.44gene:FBgn0086784 transcript:FBtr0301639[more]
back to top
BLAST of Protein EFR3 homolog A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
efr3a3.735e-12732.82EFR3 homolog A (S. cerevisiae) [Source:ZFIN;Acc:ZD... [more]
efr3a3.215e-12432.81EFR3 homolog A (S. cerevisiae) [Source:ZFIN;Acc:ZD... [more]
efr3bb8.885e-12133.29EFR3 homolog Bb (S. cerevisiae) [Source:NCBI gene;... [more]
efr3bb8.885e-12133.29EFR3 homolog Bb (S. cerevisiae) [Source:NCBI gene;... [more]
efr3ba4.027e-11732.39EFR3 homolog Ba (S. cerevisiae) [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Protein EFR3 homolog A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
efr3b3.256e-12235.00EFR3 homolog B [Source:NCBI gene;Acc:100491752][more]
efr3b3.152e-12135.44EFR3 homolog B [Source:NCBI gene;Acc:100491752][more]
efr3b6.166e-12135.65EFR3 homolog B [Source:NCBI gene;Acc:100491752][more]
efr3b5.184e-12035.60EFR3 homolog B [Source:NCBI gene;Acc:100491752][more]
efr3b1.548e-11833.38EFR3 homolog B [Source:NCBI gene;Acc:100491752][more]
back to top
BLAST of Protein EFR3 homolog A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Efr3b5.641e-12533.81EFR3 homolog B [Source:MGI Symbol;Acc:MGI:2444851][more]
Efr3a5.733e-12329.77EFR3 homolog A [Source:MGI Symbol;Acc:MGI:1923990][more]
Efr3a9.159e-12330.39EFR3 homolog A [Source:MGI Symbol;Acc:MGI:1923990][more]
Efr3a1.400e-12230.08EFR3 homolog A [Source:MGI Symbol;Acc:MGI:1923990][more]
Efr3b3.017e-7433.20EFR3 homolog B [Source:MGI Symbol;Acc:MGI:2444851][more]
back to top
BLAST of Protein EFR3 homolog A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y2G0|EFR3B_HUMAN7.050e-12734.29Protein EFR3 homolog B OS=Homo sapiens OX=9606 GN=... [more]
sp|Q6ZQ18|EFR3B_MOUSE3.946e-12433.81Protein EFR3 homolog B OS=Mus musculus OX=10090 GN... [more]
sp|Q14156|EFR3A_HUMAN2.230e-12229.74Protein EFR3 homolog A OS=Homo sapiens OX=9606 GN=... [more]
sp|Q8BG67|EFR3A_MOUSE4.010e-12229.77Protein EFR3 homolog A OS=Mus musculus OX=10090 GN... [more]
sp|Q5SPP5|EFR3B_DANRE5.804e-12133.38Protein EFR3 homolog B OS=Danio rerio OX=7955 GN=e... [more]
back to top
BLAST of Protein EFR3 homolog A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P8B80.000e+042.67Protein EFR3 homolog B (Fragment) OS=Schistocephal... [more]
A0A4Z2CQ280.000e+044.41Protein EFR3A OS=Schistosoma japonicum OX=6182 GN=... [more]
A0A5K4F0860.000e+044.89Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A5K4F0G90.000e+044.74Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A0V0J6A80.000e+042.15Protein EFR3 homolog B (Fragment) OS=Schistocephal... [more]
back to top
BLAST of Protein EFR3 homolog A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
efr3a6.939e-12233.52EFR3 homolog A [Source:NCBI gene;Acc:103025315][more]
efr3a1.054e-12133.52EFR3 homolog A [Source:NCBI gene;Acc:103025315][more]
efr3a2.842e-12133.52EFR3 homolog A [Source:NCBI gene;Acc:103025315][more]
efr3a3.027e-12133.52EFR3 homolog A [Source:NCBI gene;Acc:103025315][more]
efr3bb6.344e-11233.59EFR3 homolog Bb (S. cerevisiae) [Source:NCBI gene;... [more]
back to top
BLAST of Protein EFR3 homolog A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009977.16.679e-10631.58pep scaffold:Pmarinus_7.0:GL476399:1664401:1739396... [more]
back to top
BLAST of Protein EFR3 homolog A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein EFR3 homolog A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO438307.161e-10229.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein EFR3 homolog A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
efr3a4.124e-12730.33EFR3 homolog A [Source:NCBI gene;Acc:101167822][more]
efr3a2.131e-12630.32EFR3 homolog A [Source:NCBI gene;Acc:101167822][more]
efr3a6.863e-12129.48EFR3 homolog A [Source:NCBI gene;Acc:101167822][more]
efr3bb1.954e-12033.81EFR3 homolog B [Source:NCBI gene;Acc:101157100][more]
ENSORLT00000001777.24.003e-10532.02protein EFR3 homolog B-like [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein EFR3 homolog A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000057540.10.000e+099.65SMESG000057540.1[more]
SMESG000057540.10.000e+098.24SMESG000057540.1[more]
SMESG000057540.10.000e+099.58SMESG000057540.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014207 ID=SMED30014207|Name=Protein EFR3 homolog A|organism=Schmidtea mediterranea sexual|type=transcript|length=2961bp
TTGAATTGTGTATTTATATGACTATTAATTATTAATTTATTTTAGTCACT
TATTTTTATGTAAAAACATTTGAATTTTATAATTATGTCAGATAATAAAT
TTGGTATATGTACATGCGGTCCTTTTCGGCCTAAATGGATGAAAATGGTT
GATAATATTTATAAGTCAAGTCCAAACGATAATTCAAGTCATAGTAAATT
AGTTTTTTTTTGTGTTAGAAAGCCAGAAAAATTAGATAGAATTGCTTCAT
ATTTGCAGTACCATCTTTCTAGTAATTTAAATCGTAAAAATTATGTCCAT
GTCAATACAACAATGGATGCTATTAATTCACTAATGAATGCGTGCCATAC
TCAACGATTGAATTTATTTGTTGTCAATTTTTTGAAAATGATTCAATTGC
TATTGGAAAGCAACATTCAAGATCTCCAGCTGCTTGGATGTCGAAGCTTT
GTGCAGTTTTCGCAAATATCTGAGGACACACCGAATTATCACAGGGAATA
CGATTATCTGATCAGTCATTTTGCCAAGATGGCCCACGATAACAGTGCCA
ATGAATCGGATCGCAACAAGCTGCGAGTTGCCGGCATTAAAGGGATCAAT
GGGGTGGTCAGAAAGTCAACAATGGACCAATTGCAAGCCAATGTGCTTGA
TTCGCGCAGTTTGAATATGATCCTTCCAGCTCTGCTGTTCAATATGCGGC
TGCCAGACAAGAATGTAGACCAAGAGAGCAATAATTACGACGAGGACCCC
TCGACTGAAGCCCTGTTTGTATTCAAGGATATAATTTGTAGGGCATCATT
CACTAATATTCAGCCGGTGATCAGTAGCATTTTTGTATATATCGATCAGA
ACAAGATGTGGACTCCCTCAGATTTTACTCTATTTGTGATGGACAGTTTC
TTGGAAAATATTAAAAATCCTCAAGCCGCACATTCGTTAATGAAACAACT
CGTGGCTCATTTAGGCAATGAACACAATCAATTTACTCCACAGGAACGAA
CTGGTATCGTTCGAGCAATCAATAAAACTGTTGTTTCTTTGGCTTCTCAA
GCTGTGGGTCCTGATATTTTCCACAATTTCAAATCACTTCTCCAGATTCT
GAGACAGAGCATTGAGTCGACAGGATCGAATTCCAAAATTGATAAATCTA
TCGGCAAAACCATTCCAAAATCAGACAATGATGGTCTGACCGACACAAAT
GCTCCCAGTTTGGTTACTGTCCAAACAGGAGATAATCAAGATCCGGAAAA
AGTATTCCAAGAAGCAATCATCTCGACTATTGCAGAGTTTGCAAAAAATT
TACCAGATACTCAAAAAATTGAAATTATGAAATTTATTTTAAATTTTGAT
TCCATGTTCTTTGATAAAACCAATCGATCCAAGCAACTGATCCGCGTTCT
TTTGAAAACTATGCTCCAGGTTGCCACTCAATATAAAACCGGATCAATAT
CTAATATTTTTAATTCTGATTTCCTTAACCTTCTCCTAAATGGGGTTGCG
GTAGATCGAGATCCTGGGAACCGGATATTTGTCCAGAAGATTTTACACAC
TCTAATAGATAGGCATGATAATGCTAGGCAATTGAATGAAATAAAACTGC
TTAATCGGGAAACTTTATTCGGTTCATTGAAAATTCAAAAGCCCTCGCGG
CAAGATATTATATTTATGAAAAAGACTGGAGCAATCATTATAGAAAATCT
ATTTGTGCAAATCATTGATCAGACCAATAAAGTGGATAATCTAGAACATA
TCTATTGTACTCTTTGTCTAATTGCTTTAGAAATGGGCGCTGAACAGGTT
GTGGTAGATCTTTTCAGATTGATTTTTGCCTCTCAACATTATATTCGTGA
TCCTAACAACCGGATGCCAGTCACTCATCAGTGTGCTATTCATGCTCTTT
TGGCAGCCTTCATTTCCATGTTGTCTCTAATTGTCGAGCTGAATGAGGTC
TACCGTCACACGCATGAAGTGATCCTTCTTCGTCAGTCAAAAGCCAAATA
TCTCCTACCTGAACTTGCCTTTAATCGGTCAAACACTGCCAACATGTATC
CTAACAAAATTGAACCAGACAAGGAATTAATTTTTTCTGAAGATTTAGTG
AAAACTCAGCTCGCCGACAGTGGATACGACATGACGACATTCGAAATAGC
TTTCAGTGCAAAAGCAGGTGAACAAAGGACAATGCTGCTAATGGCCCCAC
GGAAAGCATCGATTTTCGCCTACATGGCGCTGGGTGGGGAGATTCGTGAG
ATGCAAGATTTATCAATATCCATGACAAGTTTATCGATTTCTGAAAATGG
CAGCACGATTCACGAGGATGACATGAAATCGATTAATAAAATGGATGAAG
ATCTTTGCAGCTTTGCATCAATCCAAAAGCTGTTGAGTGAGACTGCCGAT
GAAAGGCGCCAAAAGAAACGTAACAAGGAAATTGAGATGAATAAATATTT
TCGTGAGGTTGGTTTTGAGAAAATTTGCAAAGATGAACGTGAAAAGTATG
TTCCTATCCGACAGAAATTATTAGAGGTGCTTACCAGTTCCCCTCATATT
GACAACCGATATGGAGGAGAGATCTATGAGAACGGATACATGTGTAACGA
TGTCCCTGATATTTGGGAAATCGACTATCCAAAATTGTTTGTTGCATAAT
ATAAGTATAAATTCGTACAACGGAGAAAAACGAAAATGGAATTTTAATTT
TTTAAGCGATTTTGTGATTTGGATTTCGTTTTGACTGATGTTTAGAAATT
CGCTGATTTATTATTTTGTACTTAATGATTATTATTATTGTCATTATTAC
TACTGCTATTATTATTATTTTATACTGATGTTAATCGCGAAATGTTATCA
GATTTATAGTTAATGAATTTGTCAGCATATTTTTGCATTATTGAAATTTA
ATTATTAATTTGTCAGTTGATTAATTTTAATAATAATGAGCTTGCAATAT
ACACAAAATTC
back to top

protein sequence of SMED30014207-orf-1

>SMED30014207-orf-1 ID=SMED30014207-orf-1|Name=SMED30014207-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=855bp
MSDNKFGICTCGPFRPKWMKMVDNIYKSSPNDNSSHSKLVFFCVRKPEKL
DRIASYLQYHLSSNLNRKNYVHVNTTMDAINSLMNACHTQRLNLFVVNFL
KMIQLLLESNIQDLQLLGCRSFVQFSQISEDTPNYHREYDYLISHFAKMA
HDNSANESDRNKLRVAGIKGINGVVRKSTMDQLQANVLDSRSLNMILPAL
LFNMRLPDKNVDQESNNYDEDPSTEALFVFKDIICRASFTNIQPVISSIF
VYIDQNKMWTPSDFTLFVMDSFLENIKNPQAAHSLMKQLVAHLGNEHNQF
TPQERTGIVRAINKTVVSLASQAVGPDIFHNFKSLLQILRQSIESTGSNS
KIDKSIGKTIPKSDNDGLTDTNAPSLVTVQTGDNQDPEKVFQEAIISTIA
EFAKNLPDTQKIEIMKFILNFDSMFFDKTNRSKQLIRVLLKTMLQVATQY
KTGSISNIFNSDFLNLLLNGVAVDRDPGNRIFVQKILHTLIDRHDNARQL
NEIKLLNRETLFGSLKIQKPSRQDIIFMKKTGAIIIENLFVQIIDQTNKV
DNLEHIYCTLCLIALEMGAEQVVVDLFRLIFASQHYIRDPNNRMPVTHQC
AIHALLAAFISMLSLIVELNEVYRHTHEVILLRQSKAKYLLPELAFNRSN
TANMYPNKIEPDKELIFSEDLVKTQLADSGYDMTTFEIAFSAKAGEQRTM
LLMAPRKASIFAYMALGGEIREMQDLSISMTSLSISENGSTIHEDDMKSI
NKMDEDLCSFASIQKLLSETADERRQKKRNKEIEMNKYFREVGFEKICKD
EREKYVPIRQKLLEVLTSSPHIDNRYGGEIYENGYMCNDVPDIWEIDYPK
LFVA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0072659protein localization to plasma membrane
GO:0046854phosphatidylinositol phosphorylation
GO:0090002establishment of protein localization to plasma membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000142posterior region of the whole animal
PLANA:0000208testis
Vocabulary: INTERPRO
TermDefinition
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR12444UNCHARACTERIZEDcoord: 8..819
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 16..498