N-lysine methyltransferase SETD6

Overview
NameN-lysine methyltransferase SETD6
Smed IDSMED30014205
Length (bp)1297
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of N-lysine methyltransferase SETD6 (SMED30014205) t-SNE clustered cells

Violin plots show distribution of expression levels for N-lysine methyltransferase SETD6 (SMED30014205) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of N-lysine methyltransferase SETD6 (SMED30014205) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for N-lysine methyltransferase SETD6 (SMED30014205) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014205

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30014205h1SMcG0021143 SmedASXL_004410SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30014205h1SMcG0021143 SmedASXL_004410SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Human
Match: SETD6 (SET domain containing 6, protein lysine methyltransferase [Source:HGNC Symbol;Acc:HGNC:26116])

HSP 1 Score: 184.111 bits (466), Expect = 1.060e-52
Identity = 119/355 (33.52%), Postives = 190/355 (53.52%), Query Frame = 3
Query:   51 FLQWMQKNNFFLSSKISITNSQQ-SNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVI--KNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMK-LLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNV-SKDLYKFYVAFVMAYSFTETNVVDDENEELMT-CMVPMADVLNHTSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSS--------------DYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQEEN 1052
            FL W ++    LS K++++     + YG++A + ++  E++F +PR +LLS +   +   L  E V     S W  L+L        A  S W+ Y  L+P    L+ PMFW +EE + LL  T +  A+ +D  NI  ++Q I++PF+  +P+ F+  V S +LY   VA VMAYSF E    +++ +E  +  MVP AD+LNH + +NA+L +    L M+AT+ I KG EIFNTYG+++N QL+HMYGF  P+ DN DD  ++    + E+ L                D+  K++ +G    E  + ++G+   L  EEL   +  L MP  +F++  +     D  +EE 
Sbjct:   25 FLSWCRRVGLELSPKVAVSRQGTVAGYGMVARESVQAGELLFVVPRAALLSQHTCSIGGLLERERVALQSQSGWVPLLL-ALLHELQAPASRWRPYFALWPELGRLEHPMFWPEEERRCLLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPNSPVMVPAADILNHLANHNANLEYSANCLRMVATQPIPKGHEIFNTYGQMANWQLIHMYGFVEPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVG----EEGAFVIGREEVLTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEG 374          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Human
Match: SETD6 (SET domain containing 6, protein lysine methyltransferase [Source:HGNC Symbol;Acc:HGNC:26116])

HSP 1 Score: 175.637 bits (444), Expect = 3.002e-49
Identity = 122/379 (32.19%), Postives = 192/379 (50.66%), Query Frame = 3
Query:   51 FLQWMQKNNFFLSSKIS----------------------ITNSQQ---SNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVI--KNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMK-LLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNV-SKDLYKFYVAFVMAYSFTETNVVDDENEELMT-CMVPMADVLNHTSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSS--------------DYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQEEN 1052
            FL W ++    LS K+S                      +  S+Q   + YG++A + ++  E++F +PR +LLS +   +   L  E V     S W  L+L        A  S W+ Y  L+P    L+ PMFW +EE + LL  T +  A+ +D  NI  ++Q I++PF+  +P+ F+  V S +LY   VA VMAYSF E    +++ +E  +  MVP AD+LNH + +NA+L +    L M+AT+ I KG EIFNTYG+++N QL+HMYGF  P+ DN DD  ++    + E+ L                D+  K++ +G    E  + ++G+   L  EEL   +  L MP  +F++  +     D  +EE 
Sbjct:   25 FLSWCRRVGLELSPKVSERAGGRRTRGGARAALTSPPAQVAVSRQGTVAGYGMVARESVQAGELLFVVPRAALLSQHTCSIGGLLERERVALQSQSGWVPLLL-ALLHELQAPASRWRPYFALWPELGRLEHPMFWPEEERRCLLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPNSPVMVPAADILNHLANHNANLEYSANCLRMVATQPIPKGHEIFNTYGQMANWQLIHMYGFVEPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVG----EEGAFVIGREEVLTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEG 398          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Human
Match: SETD6 (SET domain containing 6, protein lysine methyltransferase [Source:HGNC Symbol;Acc:HGNC:26116])

HSP 1 Score: 130.954 bits (328), Expect = 2.502e-33
Identity = 104/353 (29.46%), Postives = 161/353 (45.61%), Query Frame = 3
Query:   51 FLQWMQKNNFFLSSKISITNSQQ-SNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVI--KNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMT-CMVPMADVLNHTSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSS--------------DYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQEEN 1052
            FL W ++    LS K++++     + YG++A + ++  E++F +PR +LLS +   +   L  E V     S W  L+L        A  S W+ Y  L+P    L+ PMF        L    LE                                    LY   VA VMAYSF E    +++ +E  +  MVP AD+LNH + +NA+L +    L M+AT+ I KG EIFNTYG+++N QL+HMYGF  P+ DN DD  ++    + E+ L                D+  K++ +G    E  + ++G+   L  EEL   +  L MP  +F++  +     D  +EE 
Sbjct:   25 FLSWCRRVGLELSPKVAVSRQGTVAGYGMVARESVQAGELLFVVPRAALLSQHTCSIGGLLERERVALQSQSGWVPLLL-ALLHELQAPASRWRPYFALWPELGRLEHPMF-------CLRVRSLE------------------------------------LYHQLVALVMAYSFQEPLEEEEDEKEPNSPVMVPAADILNHLANHNANLEYSANCLRMVATQPIPKGHEIFNTYGQMANWQLIHMYGFVEPYPDNTDDTADIQMVTVREAALQGTKTEAERHLVYERWDFLCKLEMVG----EEGAFVIGREEVLTEEELTTTLKVLCMPAEEFRELKDQDGGGDDKREEG 329          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Human
Match: SETD6 (SET domain containing 6, protein lysine methyltransferase [Source:HGNC Symbol;Acc:HGNC:26116])

HSP 1 Score: 120.553 bits (301), Expect = 8.254e-31
Identity = 74/221 (33.48%), Postives = 123/221 (55.66%), Query Frame = 3
Query:   33 MNKLDEFLQWMQKNNFFLSSKISITNSQQ-SNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVI--KNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMK-LLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNV-SKDLYKFYVAFVMAYSFTETNVVDDENEELMT-CMVPMADVLNHTSLNNAHLMF 677
            ++ +  FL W ++    LS K++++     + YG++A + ++  E++F +PR +LLS +   +   L  E V     S W  L+L        A  S W+ Y  L+P    L+ PMFW +EE + LL  T +  A+ +D  NI  ++Q I++PF+  +P+ F+  V S +LY   VA VMAYSF E    +++ +E  +  MVP AD+LNH + +NA+L +
Sbjct:   19 LDPVACFLSWCRRVGLELSPKVAVSRQGTVAGYGMVARESVQAGELLFVVPRAALLSQHTCSIGGLLERERVALQSQSGWVPLLL-ALLHELQAPASRWRPYFALWPELGRLEHPMFWPEEERRCLLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPNSPVMVPAADILNHLANHNANLEY 238          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Human
Match: SETD6 (SET domain containing 6, protein lysine methyltransferase [Source:HGNC Symbol;Acc:HGNC:26116])

HSP 1 Score: 111.694 bits (278), Expect = 1.775e-27
Identity = 77/245 (31.43%), Postives = 125/245 (51.02%), Query Frame = 3
Query:   33 MNKLDEFLQWMQKNNFFLSSKIS----------------------ITNSQQ---SNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVI--KNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMK-LLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNV-SKDLYKFYVAFVMAYSFTETNVVDDENEELMT-CMVPMADVLNHTSLNNAHLMF 677
            ++ +  FL W ++    LS K+S                      +  S+Q   + YG++A + ++  E++F +PR +LLS +   +   L  E V     S W  L+L        A  S W+ Y  L+P    L+ PMFW +EE + LL  T +  A+ +D  NI  ++Q I++PF+  +P+ F+  V S +LY   VA VMAYSF E    +++ +E  +  MVP AD+LNH + +NA+L +
Sbjct:   10 LDPVACFLSWCRRVGLELSPKVSERAGGRRTRGGARAALTSPPAQVAVSRQGTVAGYGMVARESVQAGELLFVVPRAALLSQHTCSIGGLLERERVALQSQSGWVPLLL-ALLHELQAPASRWRPYFALWPELGRLEHPMFWPEEERRCLLQGTGVPEAVEKDLANIRSEYQSIVLPFMEAHPDLFSLRVRSLELYHQLVALVMAYSFQEPLEEEEDEKEPNSPVMVPAADILNHLANHNANLEY 253          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Celegans
Match: set-29 (SET (Trithorax/polycomb) domain containing [Source:UniProtKB/TrEMBL;Acc:Q9BPP1])

HSP 1 Score: 62.3882 bits (150), Expect = 2.306e-10
Identity = 84/393 (21.37%), Postives = 159/393 (40.46%), Query Frame = 3
Query:   42 LDEFLQWMQKNNF-FLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTN---NSPLYEKLLSEDVIKNSKWASL-ILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQN-----VSKDLYKFYV-----AFVMAYSFTETNVVDDENEEL---------MTCMVPMADVLNHTSLNNAHLMFEEE----LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVE----LTFADLTESDLSSDYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQ--FCEDLSSDDSWQEENEEVEMLADQLDS--FETVKTIP 1112
            ++EF+ W +   + F   +I+         G+ A       +    +P   +++     + P+Y K L++  I   K   + IL +F      ++S W  YL + P       P F                      K I+ D   + +  IRKY  + +Q      +S+ L + +        + A+    T  +  ENEE             ++P  D+LNH       L   E+     V+ A + I++GE+IF  YG   N +LL  YGFTLP +      +     LT A +    ++ ++   ++ +G +   L +   G +  L T    M++    M +G +++  +  D   D+  ++ +E++E++  +L +   E  K +P
Sbjct:    1 MNEFISWCKGRGYQFDGLEITCPPPGNCGNGIYATTGFRTGKAFITLPETDMINAALVVDLPVYRKKLAK--IGGEKLKPMEILTMFFAFEDTEHSAWSPYLKVLPK--EFNTPAF----------------------KGIDYDVNTLPLS-IRKY--WIDQKKEISEISEKLRRLFPELSHDKILWAWHVVNTRCIFVENEEHDNVDNSDGDTIAVIPYVDMLNHDPEKYQGLALHEKRNGRYVVQAKRQIQEGEQIFVCYGAHDNARLLVEYGFTLPHNLGAKVLIPQEMLLTLAKIAGIQVTREHEMVLEEVG-LPSHLYATDEGPSWSLRTNIRVMLLEHWQMANGRWKKIIYSHDPIDDEVDEKIDEKLEIMLKELRNGVAEKAKKMP 363          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Celegans
Match: set-27 (SET (Trithorax/polycomb) domain containing [Source:UniProtKB/TrEMBL;Acc:Q9BL48])

HSP 1 Score: 51.2174 bits (121), Expect = 9.648e-7
Identity = 62/312 (19.87%), Postives = 125/312 (40.06%), Query Frame = 3
Query:   36 NKLDEFLQW-----MQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLS---TNNSPLYEKLLSED-VIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIR-----------------KYPEYFN-----QNVSKDLYKFYVAFVMAYS---FTETNVVDDENEELMTCMVPMADVLNHTSLNNAHLM----------FEEELVMIATKS-IEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFA 836
            + +  FL W     + +NN      ++I +++ +   L A   I K  ++ ++PR ++++      S L +K   +D ++       L L +  +    + S WK Y+ + P       P+F+ +E++  L  + +        + I+R F   ++   +                 + P ++N      N +  LY + V  V        +E  V +D N  ++  ++P+ D+ NH ++    L            EEE  +I +   ++ G E+   YG  S  + L   GF +P    K D ++L   
Sbjct:   72 DSIKTFLAWADGVGIARNN------VTIGSTKTAGLSLQATGPIPKSHIVARVPRHAMITLDLAKKSSLLKKAFEKDPIVGGMDNVGLALFLACQWIQNEKSKWKSYISILPT--TFPTPLFYSEEQLLQLKPSPIFEEAILFYRTISRQFCYFLLAIAKNKIYEAAQRRKDARNAMETPIFYNVPFNVANFTPKLYFWAVGVVTTRVNMVPSENQVGEDGNPVIIPALIPVLDMANHENVLTDVLTEPIEDLVCYSPEEECAVITSHCDVKAGNEVTIFYGCRSKGEHLLHNGF-VPIYHGKFDVLKLKIG 374          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Fly
Match: Setd3 (gene:FBgn0052732 transcript:FBtr0071039)

HSP 1 Score: 69.707 bits (169), Expect = 1.747e-12
Identity = 84/363 (23.14%), Postives = 149/363 (41.05%), Query Frame = 3
Query:   27 VKMNKLDEFLQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSP---LYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPE------------------YFNQ-NVSKDLYKFYVAFVMAYSFTETNVVDDENEE------LMTCMVPMADVLNH--TSLNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSSDYFSKIKALG-KIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDL 1022
             ++ K++ F  W  K+    S  + I        GL A   + KDE++  +PRK +LS  N+    L+ K+     +      +L   +  E    + S W+ Y+D+ P   N  L  ++  ++M+LL  T   +      + I + +      F+ KY                    +F Q  +   LY++ V+ VM    T  N+V  E +E      L++ ++P  D+ NH    + + +     +L   A +++  GE+ F  YG+ SN  LL   GF  P  +N  D+V +         L++   S +  L  +   EL   ++    F++ E LA  +    M       +C DL
Sbjct:  113 TRLAKVEAFSAWA-KDGGVHSEGLEIAIFPGYQLGLRATRPLAKDELVLSVPRKLILSEENNSDCRLFGKMTQATHL------NLAYDLVIEKIRGEFSEWRPYIDVLPAKYNTVL--YFTTKQMELLRGTAAAALAMRQCRVIAKQY-----AFLYKYAHTMTEPSTGNRSHPGERGLFFTQHGLCYKLYRWAVSTVM----TRQNLVPSEKQESEDGPKLISALIPYWDMANHRPGKITSFYATVSRQLECTAQEAVNTGEQFFIYYGDRSNTDLLVHNGFVDP--NNTKDYVNIRVGLSLTDALAAKRASILDKLNIRHTAELR--VLPAPDFISKELLA-FVRVFKMSAEQLDHWCSDL 452          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Zebrafish
Match: setd6 (SET domain containing 6, protein lysine methyltransferase [Source:NCBI gene;Acc:322348])

HSP 1 Score: 188.348 bits (477), Expect = 2.558e-54
Identity = 119/350 (34.00%), Postives = 197/350 (56.29%), Query Frame = 3
Query:   33 MNKLDEFLQWMQKNNFFLSSKISITN-SQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSED---VIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEM-KLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFN-QNVSKDLYKFYVAFVMAYSFTE------TNVVDDENEELMTCMVPMADVLNHTSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTES-----------DLSSDYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQF 1010
            +  L+ FL W +     LS K+ ++     + YG++A + IE+  V+F IPR +LL    + + +K+L E    +   S W  L+L + +E + +  S WK YL L+P+F  L  PMFW +EE  KLL  T++  ++  D + +  ++  +++PF++ +P+ ++ +  + +LYK  VAFVMAYSF E       +  DDE + ++  MVPMAD+LNH S +NA+L +  E L M++ + I KGEE+FNTYG+++N QLLHMYGF  PF +N ++  ++  A + ++            L  D +  +  + ++V E    I G++G L   EL   +  L M    F+ F
Sbjct:   17 LEPLNNFLLWCESVQLTLSDKVYLSKEGTAAEYGMLAKEDIEEGHVLFTIPRDALLHQGTTKV-KKVLEEGKKCLESASGWVPLLLSLMYE-YTSSTSHWKPYLSLWPDFRTLDQPMFWSEEECDKLLKGTEIPESVITDLRKLQDEYNSVVLPFMKSHPDLWDPEKHNLELYKSLVAFVMAYSFQEPVEDDDEDEEDDEKKPILPMMVPMADMLNHISKHNANLEYTPECLKMVSIRRIGKGEEVFNTYGQMANWQLLHMYGFAEPFPNNINETADIKMASVYKAAAQVARSEANQQLLEDKWKMLCEM-EVVGEKGVFIFGQSGSLTYHELYTTLKVLCMSSHIFEDF 363          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Zebrafish
Match: setd6 (SET domain containing 6, protein lysine methyltransferase [Source:NCBI gene;Acc:322348])

HSP 1 Score: 184.882 bits (468), Expect = 5.226e-53
Identity = 119/350 (34.00%), Postives = 194/350 (55.43%), Query Frame = 3
Query:   33 MNKLDEFLQWMQKNNFFLSSKISITN-SQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSED---VIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEM-KLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFN-QNVSKDLYKFYVAFVMAYSFTE------TNVVDDENEELMTCMVPMADVLNHTSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTES-----------DLSSDYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQF 1010
            +  L+ FL W +     LS K+ +      + YG++A + IE+  V+F IPR +LL    + + +K+L E    +   S W  L+L + +E + +  S WK YL L+P+F  L  PMFW +EE  KLL  T +  ++  D + +  ++  +++PF++ +P+ ++ +  + +LYK  VAFVMAYSF E       +  DDE +  +  MVPMAD+LNH S +NA+L +  E L M++ + I KGEE+FNTYG+++N QLLHMYGF  PF +N ++  ++  A + ++            L  D +  +  + ++V E    I G++G L   EL   +  L M    F+ F
Sbjct:   17 LEPLNNFLLWCESVQLTLSDKVYLGKEGTAAEYGMLAKEDIEEGHVLFTIPRDALLHQGTTKV-KKVLEEGKKCLESASGWVPLLLSLMYE-YTSSTSHWKPYLSLWPDFRTLDQPMFWSEEECDKLLKGTGIPESVITDLRRLQDEYNSVVLPFMKSHPDLWDPEKHNLELYKSLVAFVMAYSFQEPVEDDDEDEEDDEKKPNLPMMVPMADMLNHISKHNANLEYTPECLKMVSIRRIGKGEEVFNTYGQMANWQLLHMYGFAEPFPNNINETADIKMASVYKAAAQVARSEANQQLLEDKWKMLCEM-EVVGEKGVFIFGQSGSLTYHELYTTLKVLCMSSQIFEDF 363          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Zebrafish
Match: setd3 (SET domain containing 3, actin histidine methyltransferase [Source:NCBI gene;Acc:337193])

HSP 1 Score: 67.0106 bits (162), Expect = 1.674e-11
Identity = 64/263 (24.33%), Postives = 117/263 (44.49%), Query Frame = 3
Query:  102 ITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNS------PLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPN-FDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSK---------DLYKFYVAFVMAYSFTETNVVDDENEELMTCMVPMADVLNHTS--LNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFA 836
            I+N     YGL A   I+ +E+   IPRK L++  ++      PLY +      + N   A  +LC         +S W  Y+   P+ +D    P+++++EE++ L  T+    +    KN  R +       I  +P     N SK         D Y++ V+ VM     +  +   +   +   ++P+ D+ NHT+  +   + + ++    +A K  ++GE+I+  YG  SN + +   GF   F+DN  D V++   
Sbjct:   98 ISNFADEGYGLKATKDIKAEELFLWIPRKMLMTVESAKNSVLGPLYSQDRILQAMGNVTLALHLLCERAN----PSSPWLPYIKTLPSEYDT---PLYFEEEEVRHLLATQAIQDVLSQYKNTARQYA-YFYKVIHTHP-----NASKLPLKDAFTFDDYRWAVSSVMT---RQNQIPTADGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALKDYKEGEQIYIFYGTRSNAEFVIHNGFF--FEDNAHDRVKIKLG 342          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Zebrafish
Match: setd3 (SET domain containing 3, actin histidine methyltransferase [Source:NCBI gene;Acc:337193])

HSP 1 Score: 67.0106 bits (162), Expect = 1.995e-11
Identity = 67/263 (25.48%), Postives = 117/263 (44.49%), Query Frame = 3
Query:  102 ITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLL---STNNS---PLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPN-FDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSK---------DLYKFYVAFVMAYSFTETNVVDDENEELMTCMVPMADVLNHTS--LNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFA 836
            I+N     YGL A   I+ +E+   IPRK L+   S  NS   PLY +      + N   A  +LC         +S W  Y+   P+ +D    P+++++EE++ L  T+    +    KN  R +       I  +P     N SK         D Y++ V+ VM     +  +   +   +   ++P+ D+ NHT+  +   + + ++    +A K  ++GE+I+  YG  SN + +   GF   F+DN  D V++   
Sbjct:   98 ISNFADEGYGLKATKDIKAEELFLWIPRKMLMTVESAKNSVLGPLYSQDRILQAMGNVTLALHLLCERAN----PSSPWLPYIKTLPSEYDT---PLYFEEEEVRHLLATQAIQDVLSQYKNTARQYA-YFYKVIHTHP-----NASKLPLKDAFTFDDYRWAVSSVMT---RQNQIPTADGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALKDYKEGEQIYIFYGTRSNAEFVIHNGFF--FEDNAHDRVKIKLG 342          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Zebrafish
Match: setd4 (SET domain containing 4 [Source:ZFIN;Acc:ZDB-GENE-050808-2])

HSP 1 Score: 55.8398 bits (133), Expect = 5.296e-8
Identity = 62/276 (22.46%), Postives = 113/276 (40.94%), Query Frame = 3
Query:   57 QWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVIKNSKWAS-----LILCIF--HELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIP---FIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMT------CMVPMADVLNHTSLNNAHLMFEEELVMIATKSI---EKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVEL 827
            +W+ +  F   S I + N   +  GL++   I+    +  +P + LL+T+      K    D IK  +W       L LC F   E    + S W  Y+D+ P       P+++ D  ++LL  +  + A  +  +     FQE+      F       FNQ   +   +  + +      T T  ++ +  + ++       + P  D+LNH         F +E      +S+   +K ++ F  YG   N++LL  YGF  P + +   +V+L
Sbjct:   39 RWLNERGFTSQSLIPV-NFHDTGRGLMSTQTIKAKNSLISLPEECLLTTST---VLKSYMADYIK--RWHPPISPLLALCCFLISERHHGEASEWNPYIDILPK--TYTCPLYFPDNVIELLPRSLQKKATQQKEQ-----FQELFSSSQTFFHSLQPLFNQPTEELFSQDALRWAWCSVNTRTVYMEHDQSKYLSREKDVYALAPYLDLLNHCPNVQVEAGFNKETRCYEIRSVNGCKKFQQAFINYGPHDNHRLLLEYGFVAPCNPHSVVYVDL 301          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Xenopus
Match: setd6 (SET domain containing 6 [Source:NCBI gene;Acc:100125156])

HSP 1 Score: 198.364 bits (503), Expect = 4.788e-58
Identity = 135/390 (34.62%), Postives = 210/390 (53.85%), Query Frame = 3
Query:   51 FLQWMQKNNFFLSSKISI-TNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSE-DVIKN-SKWASLILCIFHELFLADNST-WKIYLDLFPNFDNLKLPMFWDDEEM-KLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFN-QNVSKDLYKFYVAFVMAYSFTETNVVDDENEE----LMTCMVPMADVLNHTSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSS--------------DYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQ--EENEEVEMLADQLDSFETVKTIPIIHRNILNV 1139
            FL W +K    L+ K+ I T    S YG++A + +   E++F IPR ++LS N + + + +  E D +++ S W  L++ + +E    D+S+ W  Y  L+P  D   +PMFW +EE  KLL  T +  A+ +D KNI +++  I++PFIR+ PE F     + DLYK  VAFVMAYSF E    D+E +     L   MVP+AD+LNH + +NAHL F  E L MI TKS+  G+E+FNTYG+++N QLLHMYGF  P   N ++  ++    + E+                  D+   I    +IV E  + + G    +  EEL   +  L M   +F ++ E    +D W+  E+N+E  +L  +      +  +PI  R +L++
Sbjct:   25 FLAWCKKVGLELNPKVYISTEGTVSQYGMLAREDLSDGELLFSIPRSAILSQNTTRIRDLIEKEQDSLQSCSGWVPLLISLLYEA--TDSSSHWAPYFGLWPELDPPDMPMFWSEEEQTKLLQGTGILEAVHKDLKNIEKEYNSIVLPFIRRNPEKFCPMKHTLDLYKRLVAFVMAYSFQEPQEEDEEEDIEKDILPPMMVPVADLLNHVAQHNAHLEFTPECLRMITTKSVCAGQELFNTYGQMANWQLLHMYGFAEPHPQNCNETADIQMVTVREAAFQVARTEEDRLEMQKRWDFLCHI----EIVGEEGAFVFGLEEVMTEEELKACLKVLCMSTDEFAEYKE----NDGWEEDEDNDEQTLLTQE------ISRLPIPWRKLLHL 398          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Xenopus
Match: setd6 (SET domain containing 6 [Source:NCBI gene;Acc:100125156])

HSP 1 Score: 197.978 bits (502), Expect = 7.590e-58
Identity = 135/390 (34.62%), Postives = 210/390 (53.85%), Query Frame = 3
Query:   51 FLQWMQKNNFFLSSKISI-TNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSE-DVIKN-SKWASLILCIFHELFLADNST-WKIYLDLFPNFDNLKLPMFWDDEEM-KLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFN-QNVSKDLYKFYVAFVMAYSFTETNVVDDENEE----LMTCMVPMADVLNHTSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSS--------------DYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQ--EENEEVEMLADQLDSFETVKTIPIIHRNILNV 1139
            FL W +K    L+ K+ I T    S YG++A + +   E++F IPR ++LS N + + + +  E D +++ S W  L++ + +E    D+S+ W  Y  L+P  D   +PMFW +EE  KLL  T +  A+ +D KNI +++  I++PFIR+ PE F     + DLYK  VAFVMAYSF E    D+E +     L   MVP+AD+LNH + +NAHL F  E L MI TKS+  G+E+FNTYG+++N QLLHMYGF  P   N ++  ++    + E+                  D+   I    +IV E  + + G    +  EEL   +  L M   +F ++ E    +D W+  E+N+E  +L  +      +  +PI  R +L++
Sbjct:   24 FLAWCKKVGLELNPKVYISTEGTVSQYGMLAREDLSDGELLFSIPRSAILSQNTTRIRDLIEKEQDSLQSCSGWVPLLISLLYEA--TDSSSHWAPYFGLWPELDPPDMPMFWSEEEQTKLLQGTGILEAVHKDLKNIEKEYNSIVLPFIRRNPEKFCPMKHTLDLYKRLVAFVMAYSFQEPQEEDEEEDIEKDILPPMMVPVADLLNHVAQHNAHLEFTPECLRMITTKSVCAGQELFNTYGQMANWQLLHMYGFAEPHPQNCNETADIQMVTVREAAFQVARTEEDRLEMQKRWDFLCHI----EIVGEEGAFVFGLEEVMTEEELKACLKVLCMSTDEFAEYKE----NDGWEEDEDNDEQTLLTQE------ISRLPIPWRKLLHL 397          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Xenopus
Match: prrg1 (proline rich Gla (G-carboxyglutamic acid) 1 [Source:Xenbase;Acc:XB-GENE-990443])

HSP 1 Score: 64.6994 bits (156), Expect = 1.483e-10
Identity = 68/284 (23.94%), Postives = 134/284 (47.18%), Query Frame = 3
Query:   48 EFLQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNS------PLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPN-FDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRD---FQEIII--PFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMT-CMVPMADVLNHTS--LNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESD 854
            E ++W ++N    +    +    +  +GL A   I+ +E+   +PRK L++  ++      PLY +      + N   A  +LC   +     NS W  Y+   PN +D    P++++++E++ L  T+    +    KN  R    F ++I   P   K P     + + D Y++ V+ VM    T  N +  E+   +T  ++P+ D+ NHT+  +   + + ++    +A +  + GE+I+  YG  SN + +   GF   F++N  D V++    +++SD
Sbjct:   81 ELMEWCKENGAS-TDGFELVEFPEEGFGLKATREIKAEELFLWVPRKLLMTVESAKGSVLGPLYSQDRILQAMGNITLAFHLLCERAD----PNSFWLPYIKTLPNEYDT---PLYFNEDEVQYLQSTQAILDVFSQYKNTARQYAYFYKVIQTHPNANKLP--LKDSFTFDDYRWAVSSVM----TRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALQDFKSGEQIYIFYGTRSNAEFVIHNGFF--FENNLHDRVKIKLG-VSKSD 347          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Xenopus
Match: prrg1 (proline rich Gla (G-carboxyglutamic acid) 1 [Source:Xenbase;Acc:XB-GENE-990443])

HSP 1 Score: 64.3142 bits (155), Expect = 1.707e-10
Identity = 68/284 (23.94%), Postives = 134/284 (47.18%), Query Frame = 3
Query:   48 EFLQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNS------PLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPN-FDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRD---FQEIII--PFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMT-CMVPMADVLNHTS--LNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESD 854
            E ++W ++N    +    +    +  +GL A   I+ +E+   +PRK L++  ++      PLY +      + N   A  +LC   +     NS W  Y+   PN +D    P++++++E++ L  T+    +    KN  R    F ++I   P   K P     + + D Y++ V+ VM    T  N +  E+   +T  ++P+ D+ NHT+  +   + + ++    +A +  + GE+I+  YG  SN + +   GF   F++N  D V++    +++SD
Sbjct:   81 ELMEWCKENGAS-TDGFELVEFPEEGFGLKATREIKAEELFLWVPRKLLMTVESAKGSVLGPLYSQDRILQAMGNITLAFHLLCERAD----PNSFWLPYIKTLPNEYDT---PLYFNEDEVQYLQSTQAILDVFSQYKNTARQYAYFYKVIQTHPNANKLP--LKDSFTFDDYRWAVSSVM----TRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALQDFKSGEQIYIFYGTRSNAEFVIHNGFF--FENNLHDRVKIKLG-VSKSD 347          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Xenopus
Match: setd4 (SET domain containing 4 [Source:NCBI gene;Acc:549859])

HSP 1 Score: 63.929 bits (154), Expect = 1.820e-10
Identity = 64/273 (23.44%), Postives = 114/273 (41.76%), Query Frame = 3
Query:   48 EFLQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVIKNSKWAS--LILCIF--HELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDEN--------EELMTCMVPMADVLNHTSLNNAHLMFEEELVMIATKS---IEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFV 821
            +  +W+++  F     +       +  GL+A   ++  E+I  +P   L++T    + +  L + +   S   S  L LC F   E    + S WK YLD+ P+  +   P++W+ E + LL     + A+ E    +     E    F+   P  F  N++ D+Y  Y A   A+    T  V  ++        ++ +  M P  D+LNH+        F EE      ++     K ++ F  YG   N +LL  YGF    + ++  +V
Sbjct:   35 QLRRWLKERGF-QGRHLRAAEFTDTGRGLMATRDLQPGELIISLPDSCLITTET--VLQSYLGKYIRTWSPPVSPLLALCTFLIAERVARERSPWKPYLDVLPS--SYSCPVYWESEIISLLPAPLRQKAL-EQQTEVKELHTESWSFFVSLQP-LFGGNIT-DIYT-YGALRWAWCTVNTRTVYMKHPRRHGLSAQQDVYAMAPYLDLLNHSPAVQVEAAFNEERRCYEIRTNSGCRKHDQAFICYGPHDNQRLLLEYGFIAANNPHRSVYV 298          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Mouse
Match: Setd6 (SET domain containing 6 [Source:MGI Symbol;Acc:MGI:1913333])

HSP 1 Score: 189.119 bits (479), Expect = 1.867e-54
Identity = 121/362 (33.43%), Postives = 190/362 (52.49%), Query Frame = 3
Query:   51 FLQWMQKNNFFLSSKISITNSQQ-SNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVIKNS--KWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEE-MKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNV-SKDLYKFYVAFVMAYSFTET-NVVDDENEELMTCMVPMADVLNHTSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSS--------------DYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQEENEEVEMLA 1073
            FL+W ++    LS K++++     + YG++A + +   E++F +PR +LLS +   +   L  E     S   W  L+L        A  S W  Y  L+P    L+ PMFW +EE ++LL  T +  A+ +D  NI  ++  I++PF+  + + F+ +V S +LY+  VA VMAYSF E     DDE E     MVP AD+LNH + +NA+L +  + L M+AT+ I +G EIFNTYG+++N QL+HMYGF  P+ +N DD  ++    + ++ L                D+  K + +G    E  + ++G    L  EELA  +  L MP  +F+ + E       W EE  E + LA
Sbjct:   49 FLRWCRRVGLELSPKVTVSRQGTVAGYGMVARESVRAGELLFAVPRSALLSPHTCSISGLLERERGALQSLSGWVPLLL-ALLHELQAPASPWSPYFALWPELGRLEHPMFWPEEERLRLLKGTGVPEAVEKDLVNIRSEYYSIVLPFMEAHSDLFSPSVRSLELYQQLVALVMAYSFQEPLEEDDDEKEPNSPLMVPAADILNHIANHNANLEYSADYLRMVATQPILEGHEIFNTYGQMANWQLIHMYGFAEPYPNNTDDTADIQMVTVRDAALQGTKDETEKLLVCERWDFLCKQEMVG----EEGAFVIGCEEVLTEEELATTLKVLCMPAEEFRDYKERA----GWGEEETEDDSLA 401          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Mouse
Match: Setd6 (SET domain containing 6 [Source:MGI Symbol;Acc:MGI:1913333])

HSP 1 Score: 93.5893 bits (231), Expect = 1.505e-22
Identity = 55/144 (38.19%), Postives = 84/144 (58.33%), Query Frame = 3
Query:  387 EMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNV-SKDLYKFYVAFVMAYSFTETNVVDDENEELMTCMVPMADVLNHTSLNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDD 815
             ++LL  T +  A+ +D  NI  ++  I++PF+  + + F+ +V S +LY+  VA VMAYSF E    DD+ +E                  N+ LM  + L M+AT+ I +G EIFNTYG+++N QL+HMYGF  P+ +N DD
Sbjct:    1 RLRLLKGTGVPEAVEKDLVNIRSEYYSIVLPFMEAHSDLFSPSVRSLELYQQLVALVMAYSFQEPLEEDDDEKE-----------------PNSPLM--DYLRMVATQPILEGHEIFNTYGQMANWQLIHMYGFAEPYPNNTDD 125          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Mouse
Match: Setd3 (SET domain containing 3 [Source:MGI Symbol;Acc:MGI:1289184])

HSP 1 Score: 72.7886 bits (177), Expect = 2.681e-13
Identity = 70/284 (24.65%), Postives = 137/284 (48.24%), Query Frame = 3
Query:   48 EFLQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLL---STNNS---PLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPN-FDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRD---FQEIII--PFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMT-CMVPMADVLNHTS--LNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESD 854
            + ++W  +N   +     + N ++  +GL A   I+ +E+   +PRK L+   S  NS   PLY +      + N   A  +LC       + NS W+ Y+   P+ +D    P+++++EE++ L  T+    +    KN  R    F ++I   P   K P    ++ + + Y++ V+ VM    T  N +  E+   +T  ++P+ D+ NHT+  +   + + ++    +A +  + G++I+  YG  SN + +   GF   FD+N  D V++    +++SD
Sbjct:   81 DLMKWASENGASVEG-FEMVNFKEEGFGLRATRDIKAEELFLWVPRKLLMTVESAKNSVLGPLYSQDRILQAMGNIALAFHLLC----ERASPNSFWQPYIQTLPSEYDT---PLYFEEEEVRCLQSTQAIHDVFSQYKNTARQYAYFYKVIQTHPHANKLP--LKESFTYEDYRWAVSSVM----TRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALQDFQAGDQIYIFYGTRSNAEFVIHSGFF--FDNNSHDRVKIKLG-VSKSD 347          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Mouse
Match: Setd4 (SET domain containing 4 [Source:MGI Symbol;Acc:MGI:2136890])

HSP 1 Score: 58.151 bits (139), Expect = 1.074e-8
Identity = 69/270 (25.56%), Postives = 109/270 (40.37%), Query Frame = 3
Query:   48 EFLQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVIKNS------KWAS-----LILCIF--HELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVV--DDENEELM-----TC-MVPMADVLNHTSLNNAHLMFEEELVM--IATKS-IEKGEEIFNTYGELSNNQLLHMYGF 785
            E  +W+++  F   + +   +   +  GL++   +++ +V+  +P   LL+T+            VI++S      KW       L LC F   E      S WK YLD+ P   +   P+  + E + LL       A AE+ +   +D       F       F + V  D    Y AF+ A+    T  V      +E +     TC + P  D+LNH+        F E+     I T S   K +E+F  YG   N +LL  YGF
Sbjct:   34 ELRKWLKERKF-EDTDLVPASFPGTGRGLMSKASLQEGQVMISLPESCLLTTDT-----------VIRSSLGPYIKKWKPPVSPLLALCTFLVSEKHAGCRSLWKSYLDILPK--SYTCPVCLEPEVVDLLPSPL--KAKAEEQRARVQDLFTSARGFFSTLQPLFAEPV--DSVFSYRAFLWAWCTVNTRAVYLRSRRQECLSAEPDTCALAPFLDLLNHSPHVQVKAAFNEKTRCYEIRTASRCRKHQEVFICYGPHDNQRLLLEYGF 285          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Mouse
Match: Setd4 (SET domain containing 4 [Source:MGI Symbol;Acc:MGI:2136890])

HSP 1 Score: 58.151 bits (139), Expect = 1.074e-8
Identity = 69/270 (25.56%), Postives = 109/270 (40.37%), Query Frame = 3
Query:   48 EFLQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVIKNS------KWAS-----LILCIF--HELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVV--DDENEELM-----TC-MVPMADVLNHTSLNNAHLMFEEELVM--IATKS-IEKGEEIFNTYGELSNNQLLHMYGF 785
            E  +W+++  F   + +   +   +  GL++   +++ +V+  +P   LL+T+            VI++S      KW       L LC F   E      S WK YLD+ P   +   P+  + E + LL       A AE+ +   +D       F       F + V  D    Y AF+ A+    T  V      +E +     TC + P  D+LNH+        F E+     I T S   K +E+F  YG   N +LL  YGF
Sbjct:   34 ELRKWLKERKF-EDTDLVPASFPGTGRGLMSKASLQEGQVMISLPESCLLTTDT-----------VIRSSLGPYIKKWKPPVSPLLALCTFLVSEKHAGCRSLWKSYLDILPK--SYTCPVCLEPEVVDLLPSPL--KAKAEEQRARVQDLFTSARGFFSTLQPLFAEPV--DSVFSYRAFLWAWCTVNTRAVYLRSRRQECLSAEPDTCALAPFLDLLNHSPHVQVKAAFNEKTRCYEIRTASRCRKHQEVFICYGPHDNQRLLLEYGF 285          
BLAST of N-lysine methyltransferase SETD6 vs. UniProt/SwissProt
Match: sp|E1BI64|SETD6_BOVIN (N-lysine methyltransferase SETD6 OS=Bos taurus OX=9913 GN=SETD6 PE=2 SV=1)

HSP 1 Score: 202.601 bits (514), Expect = 6.065e-59
Identity = 120/360 (33.33%), Postives = 191/360 (53.06%), Query Frame = 3
Query:   51 FLQWMQKNNFFLSSKISITNSQQ-SNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSED--VIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMK-LLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNV-SKDLYKFYVAFVMAYSF----TETNVVDDENEELMTCMVPMADVLNHTSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSS--------------DYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQEENEE 1058
            FL W Q+    LS K++++     + YG++A + ++  E++F +PR +LLS +   +   L  E   +   S W  L+L + HE+  A  S W  Y  L+P    L+ PMFW +EE + LL  T +  A+ +D  NI  ++  I++PF+  +P+ F+  V S +LY+  VA VMAYSF     E     + N  LM   VP AD+LNH + +NA+L +    L M+A + I KG EIFNTYG+++N QL+HMYGF  P+ DN +D  ++    + E+ L                D+  K++ +G    E  + ++G+   L  EELA  +  L MP  +F+ F       + W+++  E
Sbjct:   26 FLSWCQRVGLELSPKVAVSRQGTVAGYGMVARESVQPGELLFAVPRAALLSQHTCSISGVLERERGALQSQSGWVPLLLALLHEM-QAPASPWSPYFALWPELGRLQHPMFWPEEERRRLLQGTGVPEAVEKDLVNIRSEYYSIVLPFMDAHPDLFSPRVRSLELYRQLVALVMAYSFQEPLEEEEDEKEPNSPLM---VPAADILNHLANHNANLEYSPTCLRMVAIQPIPKGHEIFNTYGQMANWQLIHMYGFAEPYPDNTNDTADIQMVTVREAALQGTKVEAERLLLYERWDFLCKLEMVG----EEGAFVIGREEVLTEEELATTLKVLCMPAEEFRAF----KDQNGWEDDKSE 373          
BLAST of N-lysine methyltransferase SETD6 vs. UniProt/SwissProt
Match: sp|A4QNG5|SETD6_XENTR (N-lysine methyltransferase setd6 OS=Xenopus tropicalis OX=8364 GN=setd6 PE=2 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 2.759e-57
Identity = 134/389 (34.45%), Postives = 208/389 (53.47%), Query Frame = 3
Query:   51 FLQWMQKNNFFLSSKISI-TNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSE-DVIKN-SKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEM-KLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFN-QNVSKDLYKFYVAFVMAYSFTETNVVDDENEE----LMTCMVPMADVLNHTSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSS--------------DYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQ--EENEEVEMLADQLDSFETVKTIPIIHRNILNV 1139
            FL W +K    L+ K+ I T    S YG++A + +   E++F IPR ++LS N + + + +  E D +++ S W  L++ + +E     +S W  Y  L+P  D   +PMFW +EE  KLL  T +  A+ +D KNI +++  I++PFIR+ PE F     + DLYK  VAFVMAYSF E    D+E +     L   MVP+AD+LNH + +NAHL F  E L MI TKS+  G+E+FNTYG+++N QLLHMYGF  P   N ++  ++    + E+                  D+   I    +IV E  + + G    +  EEL   +  L M   +F ++ E    +D W+  E+N+E  +L  +      +  +PI  R +L++
Sbjct:   25 FLAWCKKVGLELNPKVYISTEGTVSQYGMLAREDLSDGELLFSIPRSAILSQNTTRIRDLIEKEQDSLQSCSGWVPLLISLLYEA-TDSSSHWAPYFGLWPELDPPDMPMFWSEEEQTKLLQGTGILEAVHKDLKNIEKEYNSIVLPFIRRNPEKFCPMKHTLDLYKRLVAFVMAYSFQEPQEEDEEEDIEKDILPPMMVPVADLLNHVAQHNAHLEFTPECLRMITTKSVCAGQELFNTYGQMANWQLLHMYGFAEPHPQNCNETADIQMVTVREAAFQVARTEEDRLEMQKRWDFLCHI----EIVGEEGAFVFGLEEVMTEEELKACLKVLCMSTDEFAEYKE----NDGWEEDEDNDEQTLLTQE------ISRLPIPWRKLLHL 398          
BLAST of N-lysine methyltransferase SETD6 vs. UniProt/SwissProt
Match: sp|Q5ZK17|SETD6_CHICK (N-lysine methyltransferase SETD6 OS=Gallus gallus OX=9031 GN=SETD6 PE=2 SV=2)

HSP 1 Score: 196.438 bits (498), Expect = 1.090e-56
Identity = 118/355 (33.24%), Postives = 190/355 (53.52%), Query Frame = 3
Query:   51 FLQWMQKNNFFLSSKISITNSQQ-SNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKL--LSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEE-MKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNV-SKDLYKFYVAFVMAYSFTE-----TNVVDDENEELMTCMVPMADVLNHTSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSS--------------DYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSW 1040
            F+ W +     LS K+SI+     S YGL+A   +E  E++F +PR +LLS +   +   L    E +   S W  L+L + HE +    S W+ Y  L+ +F +L  PMFW +EE ++LL  T +  A+ +D  NI  ++  II+PF++ +P+ F+  + + +LYK  VAFVMAYSF E            N  +M   VP+AD+LNH + +NA L +    L M+ T+ I KG+EIFNTYG+++N QLLHMYGF  P+  N +D  ++    + ++ L                D+  +++ +G    E  + ++G    L  EEL++ +  L M + +F+++ E     D W
Sbjct:   21 FVAWCEAAGVELSPKVSISRRGTVSGYGLLAAADLEPGELLFSVPRSALLSQHTCAIRALLHDAQESLQSQSVWVPLLLALLHE-YTTGTSRWRPYFSLWQDFSSLDHPMFWPEEERVRLLQGTGIPEAVDKDLANIQLEYSSIILPFMKSHPDIFDPELHTLELYKQLVAFVMAYSFQEPLEEEDEDEKGPNPPMM---VPVADILNHVANHNASLEYAPTCLRMVTTQPISKGQEIFNTYGQMANWQLLHMYGFAEPYPGNTNDTADIQMVTVRKAALQRAKNEAQQQLVAEQWDFLCQLEMVG----EEGAFVLGWDEVLTEEELSVTLKVLCMSEEEFKEYKE----QDGW 363          
BLAST of N-lysine methyltransferase SETD6 vs. UniProt/SwissProt
Match: sp|Q6INM2|SETD6_XENLA (N-lysine methyltransferase setd6 OS=Xenopus laevis OX=8355 GN=setd6 PE=2 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 1.683e-56
Identity = 134/388 (34.54%), Postives = 203/388 (52.32%), Query Frame = 3
Query:   51 FLQWMQKNNFFLSSKISI-TNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLL--SEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEM-KLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFN-QNVSKDLYKFYVAFVMAYSFTETNVVDDENEE-----LMTCMVPMADVLNHTSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSS--------------DYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQEENEEVEMLADQLDSFETVKTIPIIHRNILNV 1139
            FL W +K    L+ K+ I T    S YG++A + I   E++F +PR ++LS N + + E L    E +   S W  L++ + +E     +S W  Y  L+P  D   +PMFW +EE  KLL  T +  AI  D KNI  ++  I++PFI + PE F     + DLYK  VAFVMAYSF E    +DE +E     L   MVP+AD+LNH + +NAHL F  E L M+ TKS+  G+E+FNTYGE++N QLLHMYGF  P   N ++  ++    + E+ L +              D+   I+ +G    E  + + G    +  EEL + +  L M   +F ++ E    +D W+E+  + E    Q    + +  +P   R +L++
Sbjct:   25 FLAWCEKVGLELNPKVYISTEGTVSQYGMLAREDIADGELLFTVPRSAILSQNTTRIQELLEKEQESLQSTSGWVPLLISLLYEA-TDSSSLWAPYFGLWPELDPPDMPMFWSEEEQTKLLQGTGVLEAIRNDLKNIEEEYNSIVLPFITRNPEKFCPMKHTLDLYKRLVAFVMAYSFQEPLEENDEEDEDEKDILPPMMVPVADLLNHVAHHNAHLEFTPECLRMVTTKSVHAGQELFNTYGEMANWQLLHMYGFAEPHPQNSNETADIQMVTMREAALQAAQTEDDRLEMQKRWDFLCHIEMVG----EEGAFVFGLEEVMTEEELKVSLKVLCMSKEEFAEYKE----NDGWEEDEGDDE----QTLMIQEISHLPTPWRKLLHL 399          
BLAST of N-lysine methyltransferase SETD6 vs. UniProt/SwissProt
Match: sp|C0H8I2|SETD6_SALSA (N-lysine methyltransferase setd6 OS=Salmo salar OX=8030 GN=setd6 PE=2 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 2.535e-54
Identity = 125/389 (32.13%), Postives = 218/389 (56.04%), Query Frame = 3
Query:   36 NKLDEFLQWMQKNNFFLSSKISITNSQQ-SNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKL--LSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWD-DEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFN-QNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMT--CMVPMADVLNHTSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSSDYFSKIKALGKIVPELLSV-------------IVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQEENEEVEMLADQLDSFETVKTIPIIHRNILNV 1139
            + L  FLQW +     L++K+ I+     + YG++A + I++ E++F IPR +LL    + +   L      +   S W  L+L + +E + +  S W+ YL L+ +F  L  PMFW  DE  +LL  T +  A+  D  NI +++++I++PFI  +P+ ++ +  + DLY+  VAFVMAYSF E    +DE+E+      MVP+AD+LNH S +NA+L +  E L M++ +SI KGEE+FNTYG+++N QLLHMYG   P+  N +D  ++  +++ ++ +     ++ +A  +++ E  S+             I GK+G L   E+   +  L M   +F    ED   ++ W+E +++ E +   L S E + ++P + R +++ 
Sbjct:   14 DPLQSFLQWCEGVGLKLNNKVYISKEGTVAEYGMLAKEDIDEGELLFTIPRMALLHQGTTKVLAVLEEGKASLENTSGWVPLLLALMYE-YTSPQSHWRPYLSLWSDFTALDHPMFWSKDERDRLLKGTGIPEAVDTDLTNIQKEYKDIVLPFITLHPDLWDPERHTLDLYRSLVAFVMAYSFQEPLDEEDEDEKDPNPPMMVPIADMLNHVSNHNANLEYTPECLKMVSVRSIRKGEEVFNTYGQMANWQLLHMYGLXEPYQSNSNDTADIPMSNVYKAAVQ---VTRSEAEQRLLVEKWSLLCEMEMVGDKGVFIFGKSGSLTDTEMYTTLKILCMSVEEF----EDFRENEGWEEADDDEEKMLQAL-SNEGLPSLPPVWRCLVHA 393          
BLAST of N-lysine methyltransferase SETD6 vs. TrEMBL
Match: A0A3Q2TPJ0 (N-lysine methyltransferase SETD6 OS=Fundulus heteroclitus OX=8078 PE=3 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 1.123e-61
Identity = 128/348 (36.78%), Postives = 204/348 (58.62%), Query Frame = 3
Query:   33 MNKLDEFLQWMQKNNFFLSSKISITNSQQ-SNYGLIAIDHIEKDEVIFKIPRKSLL--STNNSPLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEM-KLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNV-SKDLYKFYVAFVMAYSFTETNVVDDENEELMT--------CMVPMADVLNHTSLNNAHLMF-EEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTES---DLSSD-----YFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQF 1010
            + +L +FLQW  K    LS K+ +T     ++YG++A + IE+ EV+F IPR  LL   T       K     +  +S W  L+L + +E   +  S WK YL L+P+F  L  PMFW  EE  KLL  T +  A+A+D  NI R+++++++PF+ ++PE +N +  + +LY   VAF+MAYSF E    ++++++            MVPMAD+LNH S +NA+L F  + L M++ ++I KGEE+FNTYG+++N QLLHMYGFT P+ DN +D  ++  + L ++   D+ SD     +  +++ L +++ E  +V+ GK G L   EL   +  L M   +F +F
Sbjct:   14 LGRLQDFLQWCDKVGLVLSKKVCVTTEGTVADYGMVAKEDIEEGEVLFTIPRSDLLDQETTKVSALLKKEKSSLESSSGWVPLLLALLYE-STSSQSHWKPYLSLWPDFKALDHPMFWSKEERDKLLKGTGVPEAVAKDLSNIQREYRDVVLPFMTRHPELWNPHTHTLELYTQLVAFIMAYSFQEPQEEEEDDDDEEQENKASSPPMMVPMADMLNHISSHNANLEFNPDSLKMVSLRAIRKGEEVFNTYGQMANWQLLHMYGFTEPYPDNNNDTADIPISCLYQAAKQDIQSDAEQQLFKERLEVLCQLMQENGAVVFGKRGCLTESELHAALKLLCMSQDEFSEF 360          
BLAST of N-lysine methyltransferase SETD6 vs. TrEMBL
Match: A0A3Q3J240 (SET domain containing 6, protein lysine methyltransferase OS=Monopterus albus OX=43700 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.569e-60
Identity = 130/356 (36.52%), Postives = 199/356 (55.90%), Query Frame = 3
Query:   57 QWMQKNNFFLSSKISITNSQQ-SNYGLIAIDHIEKDEVIFKIPRKSLL---STNNSPLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEM-KLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNV-SKDLYKFYVAFVMAYSFTETNVVDDENEELMTC----MVPMADVLNHTSLNNAHLMFE-EELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADL-------TESDLSSDYF-SKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQEENEEVEM 1067
            QW  +    LS+K+ ++     + YG++A D IE+ EV+F IPR +LL   +T  S L EK     +  +S W  L+L + +E + +  S WK YL L  +F  L LPMFW  EE  +LL  T +  A+  D  NI R++ ++++PFI ++P+ +N +  + DLY   VAFVMAYSF E    +D  E         MVPMAD+LNH S ++A+L F  + L M+  + I KGEE+FNTYG+++N QLLHMYGFT P+  N +D  ++   +L        +SDL       + + L ++  E  + +  K G L   EL   +  L M   +F +F E    ++ W+E++EE+ +
Sbjct:    1 QWCHQVGLKLSNKVYVSKEGTVAQYGMLAKDSIEEGEVLFTIPRSALLHQGTTRVSALLEKGEKSSLESSSGWVPLLLALLYE-YTSSQSPWKPYLSLCTDFKTLDLPMFWSKEERDRLLRGTGIPEAVDTDLANIQREYTDVVLPFITRHPDLWNPDTHTLDLYTQMVAFVMAYSFQEPQGEEDGEEGEKPINPPMMVPMADMLNHMSNHSANLEFTPDSLKMVCVRPIRKGEEVFNTYGQMANWQLLHMYGFTEPYPSNSNDTADIPITNLYKAATQGIQSDLDRQLLEERWEMLCQMTQEKGAFVFDKQGCLTDTELHTYLRVLCMSKEEFSEFRE----NEGWEEDDEEISL 351          
BLAST of N-lysine methyltransferase SETD6 vs. TrEMBL
Match: V4BRV0 (SET domain-containing protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_217400 PE=4 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 2.978e-60
Identity = 139/343 (40.52%), Postives = 200/343 (58.31%), Query Frame = 3
Query:   42 LDEFLQWMQKNNFFLSSKISIT-NSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLL--SEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEM-KLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVS-KDLYKFYVAFVMAYSFTETNVVDDENEELMTC--MVPMADVLNHTSLNNAHLMFEEELV-MIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTF------ADLTESDLSSDYF--SKIKALG--KIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQFCE 1016
            LD FL W ++++  LS K+ I+ N   + YG+IA   IE+ E +F IPR  LL  N + + + L   S+++   S W  L++ + +E +    S W+ YLDL P+F  L LPMFWD EE  KLL  T +  A+  D K+IN +F +I++PFI K+P+ F      KD YK  VAFVMAYSFTE  V    NE + +   MVP+AD+LN  + NNAHL F+++++ M+A KSI K EEIFN+YGE  N  LL MYG+   +  N +D VE+ F      A  T S+   +    +K + L   +IV E  S+++G TG L+  E   +I  L M + +F  F +
Sbjct:   32 LDAFLTWCKESHIKLSEKVRISKNGSCAQYGMIAQADIEEGECLFTIPRDKLLFENTTSISDILAKGSKELQSESGWVPLLISLMYE-YNNPQSPWRPYLDLVPDFKELNLPMFWDREEREKLLTGTGVIEAVDRDLKSINTEFNKIVLPFINKHPDSFMPICKEKDFYKKMVAFVMAYSFTEDTVA---NETITSSPMMVPVADILNSIAKNNAHLEFDKDVLKMVAIKSISKDEEIFNSYGEPDNAHLLQMYGYAEKYPHNHNDTVEIPFKLIFDVARETNSENGGEEILDNKWEYLETMEIVDEDGSIVIGMTGVLSDYECEKVIKILLMRESEFDNFIQ 370          
BLAST of N-lysine methyltransferase SETD6 vs. TrEMBL
Match: A0A3P9Q1J2 (N-lysine methyltransferase SETD6 OS=Poecilia reticulata OX=8081 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 4.038e-60
Identity = 132/345 (38.26%), Postives = 199/345 (57.68%), Query Frame = 3
Query:   39 KLDEFLQWMQKNNFFLSSKISI-TNSQQSNYGLIAIDHIEKDEVIFKIPRKSLL---STNNSPLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEM-KLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNV-SKDLYKFYVAFVMAYSFTETNVVDDENEELMT------CMVPMADVLNHTSLNNAHLMF-EEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTES---DLSSD-----YFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQF 1010
            +L +FLQW  +    LS K+ + T     +YG++A + IE+ EV+F IPR +LL   +T  S L +K  S  +   S W  L+L + +E   +  S W+ YL L+P F  L  PMFW  EE  KLL  T +  A+A D  NI R++ +I++PFI ++PE +N N  + +LY   VAFVMAYSF E    +D+ E+          MVPMAD+LNH S +NA+L F  + L M++ + + KGEE+FNTYG+++N QLLHMYGFT P+ +N +D  ++  A L ++   D+ S+     +  + K L +++ E  + +    G L   EL   +  LSM   +F +F
Sbjct:    9 RLQDFLQWCDRVGLVLSKKVCLSTEGTVVDYGMLAKEDIEEGEVLFTIPRSALLHQETTKVSALLKKEKS-SLESTSGWVPLLLALLYE-STSPESHWRPYLSLWPGFKALDHPMFWSKEERDKLLKGTGVPEAVATDLSNIQREYADIVLPFIMRHPELWNPNTHTLELYTQLVAFVMAYSFQEPQEEEDDEEDEEQRAPNPPMMVPMADMLNHVSTHNANLEFNPDSLKMVSVRRLRKGEEVFNTYGQMANWQLLHMYGFTEPYPENSNDTADIPVACLYQAAAQDVQSEPERQLFDERFKVLSQMMEENAAFVFSDQGCLTDSELHSALKLLSMSQEEFSEF 351          
BLAST of N-lysine methyltransferase SETD6 vs. TrEMBL
Match: A0A4U5UHX7 (N-lysine methyltransferase SETD6 OS=Collichthys lucidus OX=240159 GN=D9C73_007153 PE=3 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 4.487e-60
Identity = 132/351 (37.61%), Postives = 201/351 (57.26%), Query Frame = 3
Query:   30 KMNKLDEFLQWMQKNNFFLSSKISITNSQQ-SNYGLIAIDHIEKDEVIFKIPRKSLL---STNNSPLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEM-KLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNV-SKDLYKFYVAFVMAYSFTETNVVDDENEELMT---------CMVPMADVLNHTSLNNAHLMFE-EELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTE-------SDLSSDYFSKIKALG-KIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQF 1010
            +++ L  FLQW  + +  LSSK+ ++     ++YG++A D I++ EV+F IPR +LL   +T  S L EK  S  +   S W  L+L + +E + +  S WK YL L+ +F  L  PMFW  EE  +LL  T +  A+ +D  NI R+++++++PFI K+P+ +N +  + DLY   VAFVMAYSF E    DD+ E+             MVPMAD+LNH S +NA+L F  + L M+  + I KGEE+FNTYG+++N QLLHMYGF  P+  N +D  ++   +L E       SDL      +   +  +I+ E  + + GK G L   EL  ++  +SM   +F +F
Sbjct:   13 ELSPLQNFLQWCDRVHLVLSSKVCVSKEGTVADYGMLAKDDIDEGEVLFTIPRSALLHQGTTKISALLEKERS-SLESPSGWVPLLLSLLYE-YTSSGSHWKPYLSLWTDFKTLDHPMFWSKEERDRLLRGTGIPEAVDKDLANIQREYRDVVLPFIAKHPDLWNPDTHTLDLYTQLVAFVMAYSFQEPQEEDDDEEDEEDEEQEAPNPPMMVPMADMLNHVSNHNANLEFTPDSLKMVCVRPIRKGEEVFNTYGQMANWQLLHMYGFVEPYQSNSNDTADIPIGNLYEIATQGIQSDLDRQLLEEQWEMACEILQEKAAFVFGKQGCLTDTELHTVLKVISMSGKEFSEF 361          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Cavefish
Match: setd6 (SET domain containing 6, protein lysine methyltransferase [Source:NCBI gene;Acc:103036579])

HSP 1 Score: 201.445 bits (511), Expect = 2.028e-59
Identity = 126/347 (36.31%), Postives = 197/347 (56.77%), Query Frame = 3
Query:   42 LDEFLQWMQKNNFFLSSKISITNSQQ-SNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSED---VIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEM-KLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFN-QNVSKDLYKFYVAFVMAYSF-TETNVVDDENEELMTCMVPMADVLNHTSLNNAHLMFE-EELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSSDYFSKIKALGKIVPELLSVIV-------------GKTGFLNTEELAMIIHALSMPDGDFQQFCED 1019
            L  FL W  K N  LS+K+ ++     + YG++A D IE+  V+F IPR++LL    S   +K+L E    +  +S W  L+L + +E +   +S W+ YL L+ +F  L  PMFW  EE  +LL  T +  A+  D  NI  ++ + ++PF+R +PE ++ +  + +LY+  VAFVMAYSF       +++ +     MVPMAD+LNH S +NA+L +  + L M+A + I+KGEEIFNTYG+++N QLLHMYGFT PF  N +D  ++  + L ++ +     ++ +A  ++V E  SV+              GK G L   EL   +  L M   DF++F E+
Sbjct:   20 LQNFLLWCDKVNLTLSNKVYLSKEGTVAEYGMLAKDDIEEGHVLFSIPRQALLHQGTSKT-KKVLEEGKECLESSSGWVPLLLALMYE-YTCPDSHWRPYLSLWTDFKKLDHPMFWSKEERERLLKGTGIPEAVDTDLTNIQTEYNDTVLPFMRSHPELWDPERHTVELYQCLVAFVMAYSFQEPLEDDEEDEDPNPPMMVPMADMLNHVSNHNANLEYTPDNLKMVAVRQIKKGEEIFNTYGQMANWQLLHMYGFTEPFSTNSNDAADIQMSSLYKAAVQ---VTQSEAEHRLVVEKWSVLCEMEMVGEKGVFVFGKNGSLTDTELYTSLKVLCMSKEDFKEFQEN 361          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Cavefish
Match: setd3 (SET domain containing 3, actin histidine methyltransferase [Source:NCBI gene;Acc:103046172])

HSP 1 Score: 60.077 bits (144), Expect = 2.249e-9
Identity = 67/257 (26.07%), Postives = 114/257 (44.36%), Query Frame = 3
Query:  123 NYGLIAIDHIEKDEVIFKIPRKSLL---STNNS---PLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFP-NFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSK---------DLYKFYVAFVMAYSFTETNVVDDENEELMT-CMVPMADVLNHTS--LNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFA 836
             YGL A   I+ +E+   IPRK L+   S  NS   PLY +      + N   A  +LC          S W  Y+   P ++D    P+++++EE+  L  T+    +    KN  R +       I  +P     N SK         D Y++ V+ VM    T  N +  E+   +T  ++P+ D+ NHT+  +   + + ++    +A +  ++ E+I+  YG  SN + +   GF   F+DN  D V++   
Sbjct:  105 GYGLKATRDIKAEELFLWIPRKMLMTVESAKNSVLGPLYSQDRILQAMGNVTLALHLLCERAN----PASPWLPYIKTLPSDYDT---PLYFEEEEVHHLLATQAIQDVLSQYKNTARQYA-YFYKVIHTHP-----NASKLPLKDAFTFDDYRWAVSSVM----TRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALQDYKENEQIYIFYGTRSNAEFVIHNGFF--FEDNAHDRVKIKLG 342          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Cavefish
Match: setd3 (SET domain containing 3, actin histidine methyltransferase [Source:NCBI gene;Acc:103046172])

HSP 1 Score: 60.077 bits (144), Expect = 2.249e-9
Identity = 67/257 (26.07%), Postives = 114/257 (44.36%), Query Frame = 3
Query:  123 NYGLIAIDHIEKDEVIFKIPRKSLL---STNNS---PLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFP-NFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSK---------DLYKFYVAFVMAYSFTETNVVDDENEELMT-CMVPMADVLNHTS--LNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFA 836
             YGL A   I+ +E+   IPRK L+   S  NS   PLY +      + N   A  +LC          S W  Y+   P ++D    P+++++EE+  L  T+    +    KN  R +       I  +P     N SK         D Y++ V+ VM    T  N +  E+   +T  ++P+ D+ NHT+  +   + + ++    +A +  ++ E+I+  YG  SN + +   GF   F+DN  D V++   
Sbjct:  105 GYGLKATRDIKAEELFLWIPRKMLMTVESAKNSVLGPLYSQDRILQAMGNVTLALHLLCERAN----PASPWLPYIKTLPSDYDT---PLYFEEEEVHHLLATQAIQDVLSQYKNTARQYA-YFYKVIHTHP-----NASKLPLKDAFTFDDYRWAVSSVM----TRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALQDYKENEQIYIFYGTRSNAEFVIHNGFF--FEDNAHDRVKIKLG 342          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Cavefish
Match: setd3 (SET domain containing 3, actin histidine methyltransferase [Source:NCBI gene;Acc:103046172])

HSP 1 Score: 60.077 bits (144), Expect = 2.717e-9
Identity = 67/257 (26.07%), Postives = 114/257 (44.36%), Query Frame = 3
Query:  123 NYGLIAIDHIEKDEVIFKIPRKSLL---STNNS---PLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFP-NFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSK---------DLYKFYVAFVMAYSFTETNVVDDENEELMT-CMVPMADVLNHTS--LNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFA 836
             YGL A   I+ +E+   IPRK L+   S  NS   PLY +      + N   A  +LC          S W  Y+   P ++D    P+++++EE+  L  T+    +    KN  R +       I  +P     N SK         D Y++ V+ VM    T  N +  E+   +T  ++P+ D+ NHT+  +   + + ++    +A +  ++ E+I+  YG  SN + +   GF   F+DN  D V++   
Sbjct:  131 GYGLKATRDIKAEELFLWIPRKMLMTVESAKNSVLGPLYSQDRILQAMGNVTLALHLLCERAN----PASPWLPYIKTLPSDYDT---PLYFEEEEVHHLLATQAIQDVLSQYKNTARQYA-YFYKVIHTHP-----NASKLPLKDAFTFDDYRWAVSSVM----TRQNQIPTEDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALQDYKENEQIYIFYGTRSNAEFVIHNGFF--FEDNAHDRVKIKLG 368          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Cavefish
Match: setd4 (SET domain containing 4 [Source:NCBI gene;Acc:103024767])

HSP 1 Score: 56.225 bits (134), Expect = 3.604e-8
Identity = 64/261 (24.52%), Postives = 111/261 (42.53%), Query Frame = 3
Query:   57 QWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVIKNSKWAS--LILCIF--HELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIII---PFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDEN--------EELMTCMVPMADVLNHTSLNNAHLMFEEELVMIATKSIE---KGEEIFNTYGELSNNQLLHMYGF 785
            +W+ K  F   S I   N   +  GL++   I+ ++V+  +P + LL+T  S + +  L E + +     S  + LC F   E    + + W  Y+ + P   +   P+++  + M+LL     + A+ +  +     FQE+     PF       F Q V ++L+    AF  A+    T  V  E+        E+ +  + P  D+LNH         F +       +SI+   K ++ F  YG   N +LL  YGF
Sbjct:   35 RWLTKKAFNSQSLIP-ANFSDTGRGLMSTQPIKANDVVISLPERCLLTT--STVLKSYLGEYIKRWKPSVSPLVALCTFLIAERHYGEAADWSPYIRVLPK--SYTCPVYFSADIMELLPRDVRKKAVEQKER-----FQELYFSSQPFFLSLQPLFTQPV-ENLFT-QDAFCWAWCSVNTRTVYMEHAQSEFLSREKDVFALAPYLDLLNHCPTVQVEAGFNKLTSCYEIRSIQGCRKFQQAFICYGPHDNQRLLLEYGF 283          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Sea Lamprey
Match: setd6 (SET domain containing 6, protein lysine methyltransferase [Source:NCBI gene;Acc:322348])

HSP 1 Score: 213.001 bits (541), Expect = 3.648e-64
Identity = 137/367 (37.33%), Postives = 205/367 (55.86%), Query Frame = 3
Query:   42 LDEFLQWMQKNNFFLSSKISIT-NSQQSNYGLIAIDHIEKDEVIFKIPRKSLLS---TNNSPLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMK-LLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFN-QNVSKDLYKFYVAFVMAYSFTE-----TNVVDDENEELMTCMVPMADVLNHTSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSSDYFSK---IKALGKIVPELLSV------IVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQEENEEVEMLADQ 1079
            + EF  W    N  LS K+ ++ +     YGL A+++I + EV+F +PR +LLS   T+ S + EK  +  +   S W +LI+ + +E F   NS WK YL L P  D L LPMFW +EE K LL  T +  A+  D +NI  +F  ++ PF+  +P  F+ +  + +LYK  VAFVMAYSF E          D N  +M   VPMAD+LNH S +NA+L F ++ L MI+T+ I KGEE++NTYG+L+N QLLHMYGF  P   N +D  E+    L ++ L     S+   ++   K++ E+L V      ++G+ G L  EEL   +  L M + +     ED   ++ W+E++   E L ++
Sbjct:   50 VREFESWCSSVNLELSPKVVLSEDGLVDRYGLQAVENISEGEVLFSVPRDALLSSVTTSISQVLEKAEAASLKSQSGWVALIVALMYE-FTCPNSRWKPYLALCPEPDQLDLPMFWPEEERKRLLRGTGVPEAVHLDLENIELEFNSVVQPFLAAHPTLFDSKQHTLNLYKRMVAFVMAYSFQEPLEEEDEDEKDPNPPIM---VPMADILNHVSNHNANLEFTKDCLKMISTRPIAKGEEVYNTYGDLANWQLLHMYGFVEPHPANNNDAAEIQMTTLYKAALQVFGESRKQLVEKKWKVLCEMLLVGEEGAFVIGREGVLTEEELYAALKVLCMSEDEL----EDYQENEGWEEDDAADESLTNE 408          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Sea Lamprey
Match: setd3 (SET domain containing 3, actin histidine methyltransferase [Source:NCBI gene;Acc:337193])

HSP 1 Score: 68.1662 bits (165), Expect = 1.154e-12
Identity = 71/300 (23.67%), Postives = 135/300 (45.00%), Query Frame = 3
Query:   45 DEFLQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNN--SPLYEKLLSED----VIKNSKWASLILCIFHELFLADNSTWKIYLDLFPN-FDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIII-----PFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMT-CMVPMADVLNHTS--LNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSSDYFSKIKALGKI 899
            +EF+ W   N   L+  + I       YGL A+  I+ DE+   IPR+  ++  +  S +   L++ED     ++N   A  +LC         +S W+ Y+   P+ +D    P++   +E+     T+    +    K+I R +          P   K P     + + D Y++ ++ VM    T  N +  E+   +T  ++P+ D+ NHT+  +   + M ++    +A +  + G++I+  YG  SN   +   GF   F+ N +D V++    +++S+      S+I A G I
Sbjct:   82 EEFMNWAVGNGI-LAEGVEIVTFADEGYGLKAMRDIKADELFLWIPRRMTMTAESVKSSVLGPLMAEDRVMQAMENVALALQLLCERAN----PSSFWQPYIRSLPSTYDT---PLYCQADELAYFRATQALPDVLAQYKSIARQYAYFYRLMQNHPAASKLP--LRDSFTYDDYRWAISTVM----TRQNQIPMEDASTVTLALIPLWDMCNHTNGLITTGYNMEDDRCECVALRDFKPGDQIYIFYGIRSNADFVIHNGFF--FEGNANDRVKIKLG-VSKSERLYAMKSEILARGGI 364          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Yeast
Match: RKM4 (Ribosomal lysine methyltransferase; specific for monomethylation of Rpl42ap and Rpl42bp (lysine 55); nuclear SET-domain containing protein [Source:SGD;Acc:S000002665])

HSP 1 Score: 117.857 bits (294), Expect = 2.403e-29
Identity = 91/293 (31.06%), Postives = 154/293 (52.56%), Query Frame = 3
Query:   51 FLQWMQKN-NFFLSSKISITNSQQSNYG--LIAIDHIEKDEVIFKIPRKSLLSTNNSPL---YEKLLSEDVIKNSKWASLILCIFHEL-FLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSK---DLYKFYVAFVMAYSF--------------TETNVVDDENEELMTCMVPMADVLNH-TSLNNAHLMFEEE-LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTES 851
            F+ W++      +S KI I +    N G  ++A   I+KDE +FKIPR S+LS   S L   Y  L  + + +   W  LI+CI +E+  L + S W  Y  ++    ++   +FWDD E++LL  + +   I    K   ++  E II  I++    F++  +    D + +  + +++YSF               ET+  + ENE  +  M+P+AD+LN  TS  NA+L ++   L M+A + IEK E+++N YGE  N++LL  YG+ + +D +K DF E+   ++ E+
Sbjct:   11 FVCWLKTTAEIEVSPKIEIKDLCCDNQGRAVVATQKIKKDETLFKIPRSSVLSVTTSQLIKDYPSLKDKFLNETGSWEGLIICILYEMEVLQERSRWAPYFKVWNKPSDMNALIFWDDNELQLLKPSLVLERIG---KKEAKEMHERIIKSIKQIGGEFSRVATSFEFDNFAYIASIILSYSFDLEMQDSSVNENEEEETSEEELENERYLKSMIPLADMLNADTSKCNANLTYDSNCLKMVALRDIEKNEQVYNIYGEHPNSELLRRYGY-VEWDGSKYDFGEVLLENIVEA 299          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Yeast
Match: RKM2 (Ribosomal protein lysine methyltransferase; responsible for trimethylation of the lysine residue at position 3 of Rpl12Ap and Rpl12Bp [Source:SGD;Acc:S000002606])

HSP 1 Score: 47.3654 bits (111), Expect = 2.527e-6
Identity = 77/354 (21.75%), Postives = 144/354 (40.68%), Query Frame = 3
Query:   36 NKLDEFLQWMQKNN-FFLSSKISITNSQQSNYGLI-AIDHIEKDEVIFKIPRKSLL---------------------STNNSPL-YEKLLSEDVIKNSKWASLILCIFHEL-----------------FLADN------------STWKIYLDLFPNFDNLK-LPMFWDDEEMKLLNHTKLESAIAEDNKNINR------DFQEIIIPFIRKYPE-YFNQNVSKDLYKF-----YVAFVMAYSFTETNVV------DDENEELMTCMVPMADVLNHTSLNNAHLMFE---------EELVMIATKSIEKG--------EEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELT 830
             K+D  L W++K++ F+++  ISI  S ++  G++ +   I K+++I  +P    L                     + +  P+ YE  + E   +N  WA     ++ EL                  L +N            S WK + D++P+ + L+ +P  W+ +      H+ +E   A   K++ R      +  E I   + K+ E Y + + +K+  KF     +  FV  Y    +  +        E+      +VP  D +NH   ++ H   +         E ++ I   +I  G        EE+F  YG  SN+ LL+ YGF +  D NK ++++++
Sbjct:    3 GKVDVLLTWLKKSDKFYIAPNISICESPETGRGIVLSHGSIRKNDIIVSVPSSKQLNFHTILYHISKFNKELNIPGITIDRKPINYEDNIIE--AENKAWADPRYGLYSELSKEFLLSLSSFQLVSFYILVENFLLPKWTHNEIYSDWKPFFDVWPSMEELRSIPAIWNCDPNSRY-HSLIEYLPAASRKHMARISGLVREDWETISEVVLKWNEIYGSLSCTKNSDKFTSDELFSLFVHVYFIINSRCLYAKIPLKIEDSPSNFTLVPYVDFMNHICESDLHCYPQLSPQLRSEGENIIGIGQFTIRCGDHLYDNINEELFLNYGAHSNDFLLNEYGFVV--DGNKWNYLDIS 351          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Nematostella
Match: EDO37756 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SES5])

HSP 1 Score: 171.4 bits (433), Expect = 2.000e-50
Identity = 108/273 (39.56%), Postives = 156/273 (57.14%), Query Frame = 3
Query:   36 NKLDEFLQWMQKNNFFLSSKIS-ITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVIKN-----SKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDE-EMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFN-QNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMTCMVPMADVLNHTSLNNAHLMF-EEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVEL 827
            + +  FL W   N+  L++K+S +       YG++A++ I  DE +FK+PR  LL      +  K+L+  VI+N       W  L+L + +E +    S WK Y+D+ P  D L  PMFW DE    LL  T  E  + +D + I R +  + +P ++K+ ++F+ +  S  LYK   AF+MAYSFTE +     N   +  MVPMAD+LNH S NNA L F EEEL M++T+ I KG E+FNTYG+L+N  LL  YGF +   DN +D V L
Sbjct:   14 SAISSFLLWCHDNDLKLNNKVSSMQKGSCHRYGMVAMEDISPDECLFKVPRGLLLEPKTCGI-SKILTGKVIQNMLSQHEGWVPLLLALMYE-YTNPTSLWKPYMDIVPGIDILDQPMFWPDETRQSLLQGTGFEDDVEDDKQRIERQYFTVAVPIMKKFKKFFDLKRHSLSLYKHMAAFIMAYSFTEDSPSFHGNN--VPVMVPMADILNHHSNNNARLEFGEEELSMVSTQHILKGGEVFNTYGQLANCHLLQSYGF-VEGPDNPNDTVSL 281          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Nematostella
Match: EDO33223 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSW0])

HSP 1 Score: 60.4622 bits (145), Expect = 4.883e-10
Identity = 68/302 (22.52%), Postives = 123/302 (40.73%), Query Frame = 3
Query:   51 FLQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVIKNSKWAS-------LILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSKDLYKF--YVAFVMAYSFTETNVV--DDENEELM-----TCMVPMADVLNHT-------SLNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFD-DNKDDFVELTFADLTESDLSSDYFSKIK 884
             L+W ++N      KI       +  G++AI+ I   E +  +P + L++   S + E  +   V +  K  +       L+L + +E +L   S W  Y+   P  D    P ++  +E+ LL     E A  E    I + ++     F + Y +   Q+   + ++   + +F  A+    T  V  D+ N           + P+ D+LNH          N++   +E  ++       +KG ++F  YG   N +L   YGF LP +  N   F   T   L+   +S+ + S  K
Sbjct:   53 LLKWAKRNGMVFK-KIRPAIFSSTGRGMLAIERIHSSECVISVPERLLITA--SSVLESAIGNYVAERMKGGAKSSNDYLLVLFLMYEKYLEKGSFWAPYIRTLP--DTFNTPCYFTRKELFLLPEQCREQAF-EQVTQIKQSYKS----FAKAYNDVL-QDFDCNFWRTVDFESFKWAWCVVNTRSVYHDEPNRRAQPIDGNCALAPLLDLLNHCDKAEMCGRFNSSSKNYEINVIT----EYQKGTQVFINYGPHDNTRLFLEYGFVLPRNVHNSYRFTRSTI--LSHLGMSNSFLSNAK 337          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Nematostella
Match: EDO41198 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S586])

HSP 1 Score: 50.0618 bits (118), Expect = 8.893e-7
Identity = 70/327 (21.41%), Postives = 143/327 (43.73%), Query Frame = 3
Query:   69 KNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRK---SLLSTNNSPLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRD---FQEIII-PFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMTCMVPMADVLNH------TSLNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSSDYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQF 1010
            K N   +  + I +      GL A   +++++V   +P K   S+++   S L   +  E  +++     L L +  E  L ++STW  YL++ P   +  L  F  D+ M L     +  A+ +    + +    F+ + I P   + P     + + D +++ V+ VM    T  N V   + E +  ++PM D+ NH      T  +++     +E+  +A K    G+++F  YG  +N   L   GF   + + ++D+V +    ++++D      ++I A+  +     S  V +     + EL + +   SM  G+ + +
Sbjct:    3 KANGGTAEHVEIHDFGDQGLGLRATADLQENQVFVAVPEKLLMSVVTAKKSSLGPLISREHGLRSMPHVVLALHVLCER-LHEDSTWAPYLNILPRSYSTCL-YFSPDDMMALQGSPSMGEALKQFRGIVKQYVYFFRLVQINPEASRLP--LKNSFTFDDFRWAVSTVM----TRQNDVKVSSNETVKALIPMWDMCNHCNGPFTTGFDDS----TKEVKSLAFKPTRAGDQVFIFYGRRNNADRLFHNGFV--YTEAEEDWVNIQLG-VSKNDRLYAMKAQILAMVGLDASGRSYRVLRGPEPISPELRIFLRVFSMNTGELKPY 314          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Medaka
Match: setd6 (SET domain containing 6, protein lysine methyltransferase [Source:NCBI gene;Acc:101166221])

HSP 1 Score: 195.282 bits (495), Expect = 4.137e-57
Identity = 124/357 (34.73%), Postives = 194/357 (54.34%), Query Frame = 3
Query:   15 FCTVVKMNKLDE-------FLQWMQKNNFFLSSKISITNSQQ-SNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSE--DVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEM-KLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSK-DLYKFYVAFVMAYSFTETNVVDDE----NEELMTCMVPMADVLNHTSLNNAHLMFE-EELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSSDYFSKIKALGKIVPELLS--------VIVGKTGFLNTEELAMIIHALSMPDGDFQQF 1010
              T  K  K+DE       FLQW  K +  LS K+ +      ++YG++A   IE+ EV+F IPR +LL    + +   L  E   +  +S W  L+L + +E + +  S WK YL L+P+   L  PMFW  EE  +LL  T +  A+ +D  NI R+++++++PF+ ++P+ +N      +LY   VAFVMAYSF E    +D+           MVPMAD+LNH S +NA+L F  + L M++ + I  GEE+FNTYG+++N QLLHMYGFT P+ +N ++  ++  A+L ++ +    F   +A+ ++  E LS         I  + G L   EL   +    M + +F  F
Sbjct:    1 MATAAKRQKVDEGADLLHDFLQWCDKVSLHLSEKVCVCQEGTVADYGMLAKADIEEGEVLFTIPRSALLHQRTTAVSALLQKEAASLQSSSCWVPLLLALLYE-YTSPQSDWKPYLSLWPDLRRLDHPMFWSKEERDRLLRGTGVPEAVDKDLSNIQREYEDVVLPFMTRHPDLWNPKTHTLELYTELVAFVMAYSFQEPQEDEDDDEEEKPPNPPMMVPMADMLNHVSDHNANLEFSADSLKMVSVRRIHAGEEVFNTYGQMANWQLLHMYGFTEPYPNNSNETADIPAANLHKAAMQEALFDSERAMVEVRWETLSGMTQDREAFIFSEHGCLTDSELHTALKVFCMSEEEFSDF 356          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Medaka
Match: setd6 (SET domain containing 6, protein lysine methyltransferase [Source:NCBI gene;Acc:101166221])

HSP 1 Score: 179.874 bits (455), Expect = 1.208e-51
Identity = 111/314 (35.35%), Postives = 178/314 (56.69%), Query Frame = 3
Query:  120 SNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSE--DVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEM-KLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNV-SKDLYKFYVAFVMAYSFTETNVVDDE----NEELMTCMVPMADVLNHTSLNNAHLMFE-EELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSSDYFSKIKALGKIVPELLS--------VIVGKTGFLNTEELAMIIHALSMPDGDFQQF 1010
            ++YG++A   IE+ EV+F IPR +LL    + +   L  E   +  +S W  L+L + +E + +  S WK YL L+P+   L  PMFW  EE  +LL  T +  A+ +D  NI R+++++++PF+ ++P+ +N    + +LY   VAFVMAYSF E    +D+           MVPMAD+LNH S +NA+L F  + L M++ + I  GEE+FNTYG+++N QLLHMYGFT P+ +N ++  ++  A+L ++ +    F   +A+ ++  E LS         I  + G L   EL   +    M + +F  F
Sbjct:   19 ADYGMLAKADIEEGEVLFTIPRSALLHQRTTAVSALLQKEAASLQSSSCWVPLLLALLYE-YTSPQSDWKPYLSLWPDLRRLDHPMFWSKEERDRLLRGTGVPEAVDKDLSNIQREYEDVVLPFMTRHPDLWNPKTHTLELYTELVAFVMAYSFQEPQEDEDDDEEEKPPNPPMMVPMADMLNHVSDHNANLEFSADSLKMVSVRRIHAGEEVFNTYGQMANWQLLHMYGFTEPYPNNSNETADIPAANLHKAAMQEALFDSERAMVEVRWETLSGMTQDREAFIFSEHGCLTDSELHTALKVFCMSEEEFSDF 331          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Medaka
Match: setd3 (SET domain containing 3, actin histidine methyltransferase [Source:NCBI gene;Acc:101172704])

HSP 1 Score: 68.1662 bits (165), Expect = 7.025e-12
Identity = 71/292 (24.32%), Postives = 126/292 (43.15%), Query Frame = 3
Query:   12 AFCTVVKMNKLDEF---LQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLL---STNNS---PLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPN-FDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRD---FQEIII--PFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMTCMVPMADVLNHTS--LNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFA 836
               TV + ++ D F   + W Q+N        +ITN     YGL     I+ +E+   +PRK L+   S  NS   P+Y +      + N   A  +LC   +      S W  Y+   P  +D    P+++  E+++LL  T+    +    KN  R    F +++   P   K P       S D Y++ V+ VM     +  +   +   +   ++P+ D+ NHT+  +   + + ++    +A +  +K E+I+  YG  SN + +   GF   F DN  D V++   
Sbjct:   66 GLSTVFEGSREDSFADLMSWAQENGASCDG-FTITNFGTEGYGLRTTRDIKAEELFLWVPRKMLMTVESAQNSVLGPIYSQDRILQAMGNVTLALHLLCERGD----PASFWSPYIRSLPQEYDT---PLYYQQEDVQLLLGTQAVQDVLNQYKNTARQYAYFYKLVQTHPAASKLP--LKDGFSFDDYRWAVSSVMT---RQNQIPTVDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALQDYKKNEQIYIFYGTRSNAEFVIHNGFF--FQDNAHDRVKIKLG 342          
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Medaka
Match: setd3 (SET domain containing 3, actin histidine methyltransferase [Source:NCBI gene;Acc:101172704])

HSP 1 Score: 68.1662 bits (165), Expect = 7.070e-12
Identity = 71/292 (24.32%), Postives = 126/292 (43.15%), Query Frame = 3
Query:   12 AFCTVVKMNKLDEF---LQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLL---STNNS---PLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPN-FDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRD---FQEIII--PFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMTCMVPMADVLNHTS--LNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFA 836
               TV + ++ D F   + W Q+N        +ITN     YGL     I+ +E+   +PRK L+   S  NS   P+Y +      + N   A  +LC   +      S W  Y+   P  +D    P+++  E+++LL  T+    +    KN  R    F +++   P   K P       S D Y++ V+ VM     +  +   +   +   ++P+ D+ NHT+  +   + + ++    +A +  +K E+I+  YG  SN + +   GF   F DN  D V++   
Sbjct:   80 GLSTVFEGSREDSFADLMSWAQENGASCDG-FTITNFGTEGYGLRTTRDIKAEELFLWVPRKMLMTVESAQNSVLGPIYSQDRILQAMGNVTLALHLLCERGD----PASFWSPYIRSLPQEYDT---PLYYQQEDVQLLLGTQAVQDVLNQYKNTARQYAYFYKLVQTHPAASKLP--LKDGFSFDDYRWAVSSVMT---RQNQIPTVDGSRVTLALIPLWDMCNHTNGLITTGYNLEDDRCECVALQDYKKNEQIYIFYGTRSNAEFVIHNGFF--FQDNAHDRVKIKLG 356          
BLAST of N-lysine methyltransferase SETD6 vs. Planmine SMEST
Match: SMESG000024285.1 (SMESG000024285.1)

HSP 1 Score: 846.655 bits (2186), Expect = 0.000e+0
Identity = 417/419 (99.52%), Postives = 418/419 (99.76%), Query Frame = 3
Query:   33 MNKLDEFLQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMTCMVPMADVLNHTSLNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSSDYFSKIKALGKIVPELLSVIVGKTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQEENEEVEMLADQLDSFETVKTIPIIHRNILNVLISKQYEMKKKALEDLQDSKPNSPSPKLFVTILLSSHVQILENYLRIIQL 1289
            MNKLDEFLQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMTCMVPMADVLNHTSLNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSSDYFSKIKALGKIVPELLSVIVG TGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQEENEEVEMLADQLDSFETVKTIPIIHRNILNVL+SKQYEMKKKALEDLQDSKPNSPSPKLFVTILLSSHVQILENYLRIIQL
Sbjct:    1 MNKLDEFLQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIPRKSLLSTNNSPLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYLDLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMTCMVPMADVLNHTSLNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFVELTFADLTESDLSSDYFSKIKALGKIVPELLSVIVGNTGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQEENEEVEMLADQLDSFETVKTIPIIHRNILNVLVSKQYEMKKKALEDLQDSKPNSPSPKLFVTILLSSHVQILENYLRIIQL 419          
BLAST of N-lysine methyltransferase SETD6 vs. Planmine SMEST
Match: SMESG000022767.1 (SMESG000022767.1)

HSP 1 Score: 48.9062 bits (115), Expect = 5.024e-6
Identity = 68/287 (23.69%), Postives = 122/287 (42.51%), Query Frame = 3
Query:   42 LDEFLQWMQKNNFFLSSKISITNS-QQSNYGLIAIDHIEK--DEVIFKIPRKSLLSTNNSPLYEKLLSEDVIKNS----KWAS------LILCIFHELFLADNSTWKIYLDLFP-NFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPFIRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETN---VVDDENEELMTC-------MVPMADVLNHTSLNNAHLMFEEE---LVMIATKSIEKGEEIFNTYGELSNNQLLHMYGFTLPFDDNKDDFV 821
            ++ F QW+Q   F  +  +      +    GLI+   I K    VI +IP  +++   +S  Y K  S   IKN     KW +      LIL +FHE  +   S +  YL   P +++N    ++++D E+K +  + L++A+ +         +E     ++      NQ +S   +   V  +  +S++  N   V    +  L          +VP  D  NH     A +    E   +++   K    G+++F  YG  SN+ L+  YGF    +DN ++ +
Sbjct:    1 MNSFNQWLQNEGFNTNEAVVFEKKIEDMGSGLISRKDINKVHSNVILEIPMSAVIFPRSSLDYLK--SCSCIKNLTSWLKWINFDGLRILILFLFHEKIIGHKSKFCPYLSHIPQSYNNF---LYFEDWELKFIPKSLLKTALCQ---------REFFKSSLKSLELELNQIISHHHFSGDVESIFKWSYSAVNSRCVYCQTSNSLFASFSNHHVILVPFFDKFNHRFGYKAEIKSNNERGKIIVSTEKEYISGQQVFIDYGPHSNSGLITEYGFVC--EDNPNELI 271          
The following BLAST results are available for this feature:
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SETD61.060e-5233.52SET domain containing 6, protein lysine methyltran... [more]
SETD63.002e-4932.19SET domain containing 6, protein lysine methyltran... [more]
SETD62.502e-3329.46SET domain containing 6, protein lysine methyltran... [more]
SETD68.254e-3133.48SET domain containing 6, protein lysine methyltran... [more]
SETD61.775e-2731.43SET domain containing 6, protein lysine methyltran... [more]
back to top
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
set-292.306e-1021.37SET (Trithorax/polycomb) domain containing [Sourc... [more]
set-279.648e-719.87SET (Trithorax/polycomb) domain containing [Sourc... [more]
back to top
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Setd31.747e-1223.14gene:FBgn0052732 transcript:FBtr0071039[more]
back to top
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setd62.558e-5434.00SET domain containing 6, protein lysine methyltran... [more]
setd65.226e-5334.00SET domain containing 6, protein lysine methyltran... [more]
setd31.674e-1124.33SET domain containing 3, actin histidine methyltra... [more]
setd31.995e-1125.48SET domain containing 3, actin histidine methyltra... [more]
setd45.296e-822.46SET domain containing 4 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setd64.788e-5834.62SET domain containing 6 [Source:NCBI gene;Acc:1001... [more]
setd67.590e-5834.62SET domain containing 6 [Source:NCBI gene;Acc:1001... [more]
prrg11.483e-1023.94proline rich Gla (G-carboxyglutamic acid) 1 [Sourc... [more]
prrg11.707e-1023.94proline rich Gla (G-carboxyglutamic acid) 1 [Sourc... [more]
setd41.820e-1023.44SET domain containing 4 [Source:NCBI gene;Acc:5498... [more]
back to top
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Setd61.867e-5433.43SET domain containing 6 [Source:MGI Symbol;Acc:MGI... [more]
Setd61.505e-2238.19SET domain containing 6 [Source:MGI Symbol;Acc:MGI... [more]
Setd32.681e-1324.65SET domain containing 3 [Source:MGI Symbol;Acc:MGI... [more]
Setd41.074e-825.56SET domain containing 4 [Source:MGI Symbol;Acc:MGI... [more]
Setd41.074e-825.56SET domain containing 4 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of N-lysine methyltransferase SETD6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|E1BI64|SETD6_BOVIN6.065e-5933.33N-lysine methyltransferase SETD6 OS=Bos taurus OX=... [more]
sp|A4QNG5|SETD6_XENTR2.759e-5734.45N-lysine methyltransferase setd6 OS=Xenopus tropic... [more]
sp|Q5ZK17|SETD6_CHICK1.090e-5633.24N-lysine methyltransferase SETD6 OS=Gallus gallus ... [more]
sp|Q6INM2|SETD6_XENLA1.683e-5634.54N-lysine methyltransferase setd6 OS=Xenopus laevis... [more]
sp|C0H8I2|SETD6_SALSA2.535e-5432.13N-lysine methyltransferase setd6 OS=Salmo salar OX... [more]
back to top
BLAST of N-lysine methyltransferase SETD6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q2TPJ01.123e-6136.78N-lysine methyltransferase SETD6 OS=Fundulus heter... [more]
A0A3Q3J2401.569e-6036.52SET domain containing 6, protein lysine methyltran... [more]
V4BRV02.978e-6040.52SET domain-containing protein (Fragment) OS=Lottia... [more]
A0A3P9Q1J24.038e-6038.26N-lysine methyltransferase SETD6 OS=Poecilia retic... [more]
A0A4U5UHX74.487e-6037.61N-lysine methyltransferase SETD6 OS=Collichthys lu... [more]
back to top
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
setd62.028e-5936.31SET domain containing 6, protein lysine methyltran... [more]
setd32.249e-926.07SET domain containing 3, actin histidine methyltra... [more]
setd32.249e-926.07SET domain containing 3, actin histidine methyltra... [more]
setd32.717e-926.07SET domain containing 3, actin histidine methyltra... [more]
setd43.604e-824.52SET domain containing 4 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
setd63.648e-6437.33SET domain containing 6, protein lysine methyltran... [more]
setd31.154e-1223.67SET domain containing 3, actin histidine methyltra... [more]
back to top
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RKM42.403e-2931.06Ribosomal lysine methyltransferase; specific for m... [more]
RKM22.527e-621.75Ribosomal protein lysine methyltransferase; respon... [more]
back to top
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO377562.000e-5039.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332234.883e-1022.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411988.893e-721.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of N-lysine methyltransferase SETD6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
setd64.137e-5734.73SET domain containing 6, protein lysine methyltran... [more]
setd61.208e-5135.35SET domain containing 6, protein lysine methyltran... [more]
setd37.025e-1224.32SET domain containing 3, actin histidine methyltra... [more]
setd37.070e-1224.32SET domain containing 3, actin histidine methyltra... [more]
back to top
BLAST of N-lysine methyltransferase SETD6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000024285.10.000e+099.52SMESG000024285.1[more]
SMESG000022767.15.024e-623.69SMESG000022767.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014205 ID=SMED30014205|Name=N-lysine methyltransferase SETD6|organism=Schmidtea mediterranea sexual|type=transcript|length=1297bp
TTTAAAATATAGCATTTTGTACTGTGGTTAAAATGAATAAGCTTGATGAG
TTTTTACAATGGATGCAAAAAAATAATTTTTTTCTTTCATCTAAAATTTC
TATAACTAATAGTCAACAGTCAAATTATGGTTTAATAGCTATCGATCATA
TTGAAAAAGATGAAGTTATTTTTAAAATTCCTCGCAAAAGTTTGCTTTCT
ACAAATAATTCTCCCCTCTACGAGAAATTGCTGTCTGAAGATGTAATTAA
AAATTCTAAATGGGCTAGCTTAATACTTTGCATTTTTCATGAGTTATTTT
TAGCAGATAATAGCACATGGAAAATCTATTTAGATTTATTTCCAAATTTT
GATAATCTCAAATTACCCATGTTTTGGGATGATGAAGAAATGAAATTATT
AAATCACACAAAATTAGAATCCGCCATTGCCGAAGATAATAAAAATATCA
ACAGAGATTTCCAAGAAATTATTATTCCGTTTATTAGAAAATATCCAGAA
TATTTTAATCAAAATGTTAGCAAAGACCTATATAAATTTTATGTGGCGTT
TGTAATGGCTTACAGCTTTACTGAGACTAATGTAGTTGATGATGAAAATG
AAGAATTGATGACTTGCATGGTACCAATGGCTGATGTATTAAATCACACA
TCACTGAACAATGCGCATTTAATGTTTGAAGAGGAGTTAGTAATGATTGC
TACAAAATCAATTGAAAAGGGCGAAGAAATATTCAATACATACGGTGAAT
TATCGAACAATCAACTATTACACATGTATGGATTCACACTTCCCTTTGAC
GATAATAAAGACGATTTTGTGGAATTAACTTTTGCTGATCTGACTGAATC
GGATTTATCATCCGATTATTTTTCAAAAATAAAAGCATTGGGTAAAATTG
TTCCAGAACTTTTGTCTGTTATAGTTGGAAAAACTGGATTTTTAAATACC
GAAGAATTAGCAATGATAATTCACGCTCTCAGCATGCCAGATGGCGATTT
CCAGCAATTCTGTGAAGATTTGTCATCCGACGATTCGTGGCAGGAAGAAA
ACGAAGAAGTGGAAATGCTGGCAGATCAATTGGATTCATTTGAAACCGTC
AAAACTATCCCAATAATACACAGAAATATCCTTAATGTTCTCATTAGCAA
ACAATATGAAATGAAAAAGAAAGCATTGGAAGATCTTCAAGACAGCAAAC
CGAATTCGCCTTCTCCGAAATTATTTGTAACAATTTTATTATCTAGTCAT
GTTCAAATTCTAGAAAATTACCTTAGAATAATTCAATTATAATTTGT
back to top

protein sequence of SMED30014205-orf-1

>SMED30014205-orf-1 ID=SMED30014205-orf-1|Name=SMED30014205-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=420bp
MNKLDEFLQWMQKNNFFLSSKISITNSQQSNYGLIAIDHIEKDEVIFKIP
RKSLLSTNNSPLYEKLLSEDVIKNSKWASLILCIFHELFLADNSTWKIYL
DLFPNFDNLKLPMFWDDEEMKLLNHTKLESAIAEDNKNINRDFQEIIIPF
IRKYPEYFNQNVSKDLYKFYVAFVMAYSFTETNVVDDENEELMTCMVPMA
DVLNHTSLNNAHLMFEEELVMIATKSIEKGEEIFNTYGELSNNQLLHMYG
FTLPFDDNKDDFVELTFADLTESDLSSDYFSKIKALGKIVPELLSVIVGK
TGFLNTEELAMIIHALSMPDGDFQQFCEDLSSDDSWQEENEEVEMLADQL
DSFETVKTIPIIHRNILNVLISKQYEMKKKALEDLQDSKPNSPSPKLFVT
ILLSSHVQILENYLRIIQL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036464Rubisco_LSMT_subst-bd_sf
IPR011383N-lys_methylase_SETD6
IPR001214SET_dom
Vocabulary: molecular function
TermDefinition
GO:0016279protein-lysine N-methyltransferase activity
GO:0005515protein binding
GO:0008168methyltransferase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0018026peptidyl-lysine monomethylation
GO:0032259methylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011383N-lysine methyltransferase SETD6PIRSFPIRSF011771RMS1_SETcoord: 1..393
e-value: 3.5E-71
score: 238.0
NoneNo IPR availableGENE3DG3DSA:3.90.1410.10coord: 1..252
e-value: 1.9E-76
score: 258.8
NoneNo IPR availablePANTHERPTHR13271:SF34N-LYSINE METHYLTRANSFERASE SETD6coord: 3..351
NoneNo IPR availablePANTHERPTHR13271UNCHARACTERIZED PUTATIVE METHYLTRANSFERASEcoord: 3..351
NoneNo IPR availableSUPERFAMILYSSF82199SET domaincoord: 3..254
IPR036464Rubisco LSMT, substrate-binding domain superfamilyGENE3DG3DSA:3.90.1420.10coord: 254..393
e-value: 5.1E-7
score: 31.3
IPR001214SET domainPFAMPF00856SETcoord: 32..238
e-value: 1.7E-19
score: 70.9
IPR001214SET domainPROSITEPS50280SETcoord: 20..238
score: 11.678