Signal peptidase complex catalytic subunit SEC11

Overview
NameSignal peptidase complex catalytic subunit SEC11
Smed IDSMED30014203
Length (bp)736
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Signal peptidase complex catalytic subunit SEC11 (SMED30014203) t-SNE clustered cells

Violin plots show distribution of expression levels for Signal peptidase complex catalytic subunit SEC11 (SMED30014203) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Signal peptidase complex catalytic subunit SEC11 (SMED30014203) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Signal peptidase complex catalytic subunit SEC11 (SMED30014203) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014203

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30014203h1SMcG0009999 dd_Smed_v4_806_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30014203h1SMcG0009999 dd_Smed_v4_806_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30014203h1SMcG0009999 dd_Smed_v4_806_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30014203h1SMcG0009999 dd_Smed_v4_806_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30014203h1SMcG0009999 dd_Smed_v4_806_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Human
Match: SEC11C (SEC11 homolog C, signal peptidase complex subunit [Source:HGNC Symbol;Acc:HGNC:23400])

HSP 1 Score: 300.827 bits (769), Expect = 4.927e-104
Identity = 138/178 (77.53%), Postives = 162/178 (91.01%), Query Frame = 1
Query:   52 SMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
             + IF DL++MNKRQ+YYQVLNF+MIV SALMIWKGLIV+TGSESPIVVVLSGSMEPAF RGDLLFLTNFR++PIR G+I+VF+++GR+IPIVHRVIKVHEK++G IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+GF+PY+GMVTIIMNDYPKFKYA+L  +G +VL  RES
Sbjct:   15 GLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES 192          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Human
Match: SEC11A (SEC11 homolog A, signal peptidase complex subunit [Source:HGNC Symbol;Acc:HGNC:17718])

HSP 1 Score: 284.648 bits (727), Expect = 8.341e-98
Identity = 139/179 (77.65%), Postives = 164/179 (91.62%), Query Frame = 1
Query:   46 IFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRE 582
            + S+   DD+RRMNKRQ+YYQVLNF MIV SALMIWKGL+V+TGSESPIVVVLSGSMEPAF RGDLLFLTN  ++PIRVG+I+VFRI+GREIPIVHRV+K+HEK++G IKFLTKGDNN+VDDRGLY + Q+WLE+KDV+GRA+GF+PYIG+VTI+MNDYPKFKYA+L  LGLFVL HRE
Sbjct:    1 MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE 179          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Human
Match: SEC11A (SEC11 homolog A, signal peptidase complex subunit [Source:HGNC Symbol;Acc:HGNC:17718])

HSP 1 Score: 246.514 bits (628), Expect = 4.406e-83
Identity = 122/153 (79.74%), Postives = 143/153 (93.46%), Query Frame = 1
Query:  124 MIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRE 582
            MIV SALMIWKGL+V+TGSESPIVVVLSGSMEPAF RGDLLFLTN  ++PIRVG+I+VFRI+GREIPIVHRV+K+HEK++G IKFLTKGDNN+VDDRGLY + Q+WLE+KDV+GRA+GF+PYIG+VTI+MNDYPKFKYA+L  LGLFVL HRE
Sbjct:    1 MIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE 153          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Human
Match: SEC11A (SEC11 homolog A, signal peptidase complex subunit [Source:HGNC Symbol;Acc:HGNC:17718])

HSP 1 Score: 243.817 bits (621), Expect = 5.380e-82
Identity = 112/145 (77.24%), Postives = 133/145 (91.72%), Query Frame = 1
Query:   46 IFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGF 480
            + S+   DD+RRMNKRQ+YYQVLNF MIV SALMIWKGL+V+TGSESPIVVVLSGSMEPAF RGDLLFLTN  ++PIRVG+I+VFRI+GREIPIVHRV+K+HEK++G IKFLTKGDNN+VDDRGLY + Q+WLE+KDV+GRA+GF
Sbjct:    1 MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQNGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGF 145          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Human
Match: SEC11C (SEC11 homolog C, signal peptidase complex subunit [Source:HGNC Symbol;Acc:HGNC:23400])

HSP 1 Score: 243.047 bits (619), Expect = 1.246e-81
Identity = 112/147 (76.19%), Postives = 134/147 (91.16%), Query Frame = 1
Query:   52 SMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYI 492
             + IF DL++MNKRQ+YYQVLNF+MIV SALMIWKGLIV+TGSESPIVVVLSGSMEPAF RGDLLFLTNFR++PIR G+I+VF+++GR+IPIVHRVIKVHEK++G IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+G + ++
Sbjct:   15 GLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGMLFWL 161          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Celegans
Match: sec-11 (Signal peptidase complex catalytic subunit SEC11 [Source:UniProtKB/TrEMBL;Acc:Q9N3D0])

HSP 1 Score: 272.322 bits (695), Expect = 2.747e-93
Identity = 123/177 (69.49%), Postives = 152/177 (85.88%), Query Frame = 1
Query:   55 MSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
            +++F ++R+MN RQ++YQ LNF+M+V SALMIWKG++V+TGS+SP+VVVLSGSMEPAF+RGDLL LTN  ++P+RVGDI VF+++GREIPIVHRVIKVHEK   + K LTKGDNN VDDRGLYA  Q WL R DV+GR KG +PY+GMVTIIMNDYPK KYA+L  LGLFVL H+E+
Sbjct:    7 VAMFSEIRQMNIRQLFYQCLNFAMVVSSALMIWKGMMVITGSDSPVVVVLSGSMEPAFYRGDLLLLTNDLEDPVRVGDITVFKVEGREIPIVHRVIKVHEKSADNTKILTKGDNNQVDDRGLYAPGQLWLSRTDVVGRTKGLLPYVGMVTIIMNDYPKLKYAVLAFLGLFVLLHKEN 183          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Fly
Match: twr (gene:FBgn0262801 transcript:FBtr0081687)

HSP 1 Score: 285.034 bits (728), Expect = 3.422e-98
Identity = 128/175 (73.14%), Postives = 157/175 (89.71%), Query Frame = 1
Query:   58 SIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRE 582
             +  D  RMNKRQ  YQVL+F+MIV SALMIWKGL+VVTGSESPIVVVLSGSMEPAF RGDLLFLTN+++EP+RVG+I+VF+++GR+IPIVHRVIK+HEKEDGS+KFLTKGDNN+VDDRGLYA NQ WL +KD++GRA+GF+PY+G++TI MN+YPK K+A+L  L +FVL HRE
Sbjct:   11 EMLGDFNRMNKRQSLYQVLSFAMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFHRGDLLFLTNYKEEPVRVGEIVVFKVEGRDIPIVHRVIKLHEKEDGSVKFLTKGDNNNVDDRGLYAPNQLWLTKKDIVGRARGFLPYVGIITIFMNEYPKVKWAILSILAIFVLLHRE 185          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Zebrafish
Match: sec11a (SEC11 homolog A, signal peptidase complex subunit [Source:ZFIN;Acc:ZDB-GENE-040718-227])

HSP 1 Score: 302.368 bits (773), Expect = 4.709e-105
Identity = 142/179 (79.33%), Postives = 164/179 (91.62%), Query Frame = 1
Query:   46 IFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRE 582
            + S+   DD+RRMNKRQ+YYQVLNF MIV SALMIWKGL+VVTGSESPIVVVLSGSMEPAF RGDLLFLTN  ++PIRVG+I+VFRI+GREIPIVHRV+K+HEKE+G IKFLTKGDNNSVDDRGLY + Q+WLE+KDV+GRA+GF+PYIG+VTI+MNDYPKFKYA+L  LGLFVL HRE
Sbjct:    1 MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKENGDIKFLTKGDNNSVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLCLLGLFVLVHRE 179          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Zebrafish
Match: sec11a (SEC11 homolog A, signal peptidase complex subunit [Source:ZFIN;Acc:ZDB-GENE-040718-227])

HSP 1 Score: 302.368 bits (773), Expect = 4.709e-105
Identity = 142/179 (79.33%), Postives = 164/179 (91.62%), Query Frame = 1
Query:   46 IFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRE 582
            + S+   DD+RRMNKRQ+YYQVLNF MIV SALMIWKGL+VVTGSESPIVVVLSGSMEPAF RGDLLFLTN  ++PIRVG+I+VFRI+GREIPIVHRV+K+HEKE+G IKFLTKGDNNSVDDRGLY + Q+WLE+KDV+GRA+GF+PYIG+VTI+MNDYPKFKYA+L  LGLFVL HRE
Sbjct:    1 MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKENGDIKFLTKGDNNSVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLCLLGLFVLVHRE 179          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Xenopus
Match: fam3b (family with sequence similarity 3 member B [Source:Xenbase;Acc:XB-GENE-1017247])

HSP 1 Score: 303.908 bits (777), Expect = 1.739e-105
Identity = 141/177 (79.66%), Postives = 162/177 (91.53%), Query Frame = 1
Query:   55 MSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
            M +F DLRRMNKRQ+YYQVLNF+MIV SALMIWKGLIVVTGSESPIVVVLSGSMEPAF RGDLLFLTNF+++PIR G+I+VF+++GR+IPIVHRVIKVHEKE+G IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+GF+PY+GMVTI+MNDYPKFKYA+L  +G FVL  RES
Sbjct:    1 MDLFGDLRRMNKRQLYYQVLNFAMIVSSALMIWKGLIVVTGSESPIVVVLSGSMEPAFHRGDLLFLTNFQEDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKENGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIVMNDYPKFKYAVLAIMGAFVLLKRES 177          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Xenopus
Match: znhit1 (zinc finger, HIT-type containing 1 [Source:Xenbase;Acc:XB-GENE-5848028])

HSP 1 Score: 286.189 bits (731), Expect = 1.563e-98
Identity = 142/179 (79.33%), Postives = 163/179 (91.06%), Query Frame = 1
Query:   46 IFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRE 582
            + SM   DD+RRMNKRQ+YYQVLNF MIV SALMIWKGL+V+TGSESPIVVVLSGSMEPAF RGDLLFLTN  D+PIRVG+I+VFRI+GREIPIVHRV+K+HEKE+G IKFLTKGDNN+VDDRGLY + Q WLE+KDV+GRA+GF+PYIG+VTI+MNDYPKFKYA+L  LGLFVL HRE
Sbjct:    1 MLSMDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVDDPIRVGEIVVFRIEGREIPIVHRVLKIHEKENGDIKFLTKGDNNAVDDRGLYKQGQNWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE 179          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Xenopus
Match: fam3b (family with sequence similarity 3 member B [Source:Xenbase;Acc:XB-GENE-1017247])

HSP 1 Score: 265.774 bits (678), Expect = 2.324e-90
Identity = 123/157 (78.34%), Postives = 142/157 (90.45%), Query Frame = 1
Query:   91 RQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGL 561
            R +YYQVLNF+MIV SALMIWKGLIVVTGSESPIVVVLSGSMEPAF RGDLLFLTNF+++PIR G+I+VF+++GR+IPIVHRVIKVHEKE+G IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+GF+PY+GMVTI+MNDYPKFK +    L L
Sbjct:   12 RHLYYQVLNFAMIVSSALMIWKGLIVVTGSESPIVVVLSGSMEPAFHRGDLLFLTNFQEDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKENGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIVMNDYPKFKISRYASLAL 168          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Xenopus
Match: fam3b (family with sequence similarity 3 member B [Source:Xenbase;Acc:XB-GENE-1017247])

HSP 1 Score: 265.388 bits (677), Expect = 4.220e-90
Identity = 123/156 (78.85%), Postives = 142/156 (91.03%), Query Frame = 1
Query:   94 QVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGL 561
            Q+YYQVLNF+MIV SALMIWKGLIVVTGSESPIVVVLSGSMEPAF RGDLLFLTNF+++PIR G+I+VF+++GR+IPIVHRVIKVHEKE+G IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+GF+PY+GMVTI+MNDYPKFK +    L L
Sbjct:   18 QLYYQVLNFAMIVSSALMIWKGLIVVTGSESPIVVVLSGSMEPAFHRGDLLFLTNFQEDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKENGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIVMNDYPKFKISRYASLAL 173          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Mouse
Match: Sec11c (SEC11 homolog C, signal peptidase complex subunit [Source:MGI Symbol;Acc:MGI:1913536])

HSP 1 Score: 303.908 bits (777), Expect = 2.006e-105
Identity = 140/178 (78.65%), Postives = 163/178 (91.57%), Query Frame = 1
Query:   52 SMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
            S+ IF DLR+MNKRQ+YYQVLNF+MIV SALMIWKGLIV+TGSESPIVVVLSGSMEPAF RGDLLFLTNFR++PIR G+I+VF+++GR+IPIVHRVIKVHEK++G IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+GF+PY+GMVTIIMNDYPKFKYA+L  +G +VL  RES
Sbjct:   15 SLDIFGDLRKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES 192          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Mouse
Match: Sec11c (SEC11 homolog C, signal peptidase complex subunit [Source:MGI Symbol;Acc:MGI:1913536])

HSP 1 Score: 293.508 bits (750), Expect = 3.901e-101
Identity = 140/192 (72.92%), Postives = 163/192 (84.90%), Query Frame = 1
Query:   52 SMSIFDDLRRMNKRQ--------------VYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
            S+ IF DLR+MNKRQ              +YYQVLNF+MIV SALMIWKGLIV+TGSESPIVVVLSGSMEPAF RGDLLFLTNFR++PIR G+I+VF+++GR+IPIVHRVIKVHEK++G IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+GF+PY+GMVTIIMNDYPKFKYA+L  +G +VL  RES
Sbjct:   15 SLDIFGDLRKMNKRQCTIISSIVPEKYDRLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES 206          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Mouse
Match: Sec11a (SEC11 homolog A, signal peptidase complex subunit [Source:MGI Symbol;Acc:MGI:1929464])

HSP 1 Score: 286.189 bits (731), Expect = 1.335e-98
Identity = 140/179 (78.21%), Postives = 164/179 (91.62%), Query Frame = 1
Query:   46 IFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRE 582
            + S+   DD+RRMNKRQ+YYQVLNF MIV SALMIWKGL+V+TGSESPIVVVLSGSMEPAF RGDLLFLTN  ++PIRVG+I+VFRI+GREIPIVHRV+K+HEK+DG IKFLTKGDNN+VDDRGLY + Q+WLE+KDV+GRA+GF+PYIG+VTI+MNDYPKFKYA+L  LGLFVL HRE
Sbjct:    1 MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQDGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE 179          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Mouse
Match: Sec11a (SEC11 homolog A, signal peptidase complex subunit [Source:MGI Symbol;Acc:MGI:1929464])

HSP 1 Score: 278.485 bits (711), Expect = 1.035e-95
Identity = 128/163 (78.53%), Postives = 151/163 (92.64%), Query Frame = 1
Query:   46 IFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFK 534
            + S+   DD+RRMNKRQ+YYQVLNF MIV SALMIWKGL+V+TGSESPIVVVLSGSMEPAF RGDLLFLTN  ++PIRVG+I+VFRI+GREIPIVHRV+K+HEK+DG IKFLTKGDNN+VDDRGLY + Q+WLE+KDV+GRA+GF+PYIG+VTI+MNDYPKFK
Sbjct:    1 MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQDGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFK 163          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Mouse
Match: Sec11a (SEC11 homolog A, signal peptidase complex subunit [Source:MGI Symbol;Acc:MGI:1929464])

HSP 1 Score: 280.411 bits (716), Expect = 3.039e-95
Identity = 129/165 (78.18%), Postives = 152/165 (92.12%), Query Frame = 1
Query:   46 IFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYA 540
            + S+   DD+RRMNKRQ+YYQVLNF MIV SALMIWKGL+V+TGSESPIVVVLSGSMEPAF RGDLLFLTN  ++PIRVG+I+VFRI+GREIPIVHRV+K+HEK+DG IKFLTKGDNN+VDDRGLY + Q+WLE+KDV+GRA+GF+PYIG+VTI+MNDYPKFK A
Sbjct:    1 MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQDGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKPA 165          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. UniProt/SwissProt
Match: sp|Q9D8V7|SC11C_MOUSE (Signal peptidase complex catalytic subunit SEC11C OS=Mus musculus OX=10090 GN=Sec11c PE=1 SV=3)

HSP 1 Score: 303.908 bits (777), Expect = 1.403e-104
Identity = 140/178 (78.65%), Postives = 163/178 (91.57%), Query Frame = 1
Query:   52 SMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
            S+ IF DLR+MNKRQ+YYQVLNF+MIV SALMIWKGLIV+TGSESPIVVVLSGSMEPAF RGDLLFLTNFR++PIR G+I+VF+++GR+IPIVHRVIKVHEK++G IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+GF+PY+GMVTIIMNDYPKFKYA+L  +G +VL  RES
Sbjct:   15 SLDIFGDLRKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES 192          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. UniProt/SwissProt
Match: sp|Q9WTR7|SC11C_RAT (Signal peptidase complex catalytic subunit SEC11C OS=Rattus norvegicus OX=10116 GN=Sec11c PE=2 SV=3)

HSP 1 Score: 302.368 bits (773), Expect = 5.279e-104
Identity = 139/178 (78.09%), Postives = 163/178 (91.57%), Query Frame = 1
Query:   52 SMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
            S+ IF DLR+MNKRQ+YYQVLNF+MIV SALMIWKGLIV+TGSESPIVVVLSGSMEPAF RGDLLFLTNFR++PIR G+I+VF+++GR+IPIVHRVIKVHEK++G IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+GF+PY+GMVTIIMNDYPKFKYA++  +G +VL  RES
Sbjct:   15 SLDIFGDLRKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALVAVMGAYVLLKRES 192          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. UniProt/SwissProt
Match: sp|P13679|SC11C_CANLF (Signal peptidase complex catalytic subunit SEC11C OS=Canis lupus familiaris OX=9615 GN=SEC11C PE=1 SV=3)

HSP 1 Score: 301.982 bits (772), Expect = 8.546e-104
Identity = 139/178 (78.09%), Postives = 162/178 (91.01%), Query Frame = 1
Query:   52 SMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
             + IF DLR+MNKRQ+YYQVLNF+MIV SALMIWKGLIV+TGSESPIVVVLSGSMEPAF RGDLLFLTNFR++PIR G+I+VF+++GR+IPIVHRVIKVHEK++G IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+GF+PY+GMVTIIMNDYPKFKYA+L  +G +VL  RES
Sbjct:   15 GLDIFGDLRKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES 192          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. UniProt/SwissProt
Match: sp|Q5RC30|SC11C_PONAB (Signal peptidase complex catalytic subunit SEC11C OS=Pongo abelii OX=9601 GN=SEC11C PE=2 SV=3)

HSP 1 Score: 300.827 bits (769), Expect = 2.366e-103
Identity = 138/178 (77.53%), Postives = 162/178 (91.01%), Query Frame = 1
Query:   52 SMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
             + IF DL++MNKRQ+YYQVLNF+MIV SALMIWKGLIV+TGSESPIVVVLSGSMEPAF RGDLLFLTNFR++PIR G+I+VF+++GR+IPIVHRVIKVHEK++G IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+GF+PY+GMVTIIMNDYPKFKYA+L  +G +VL  RES
Sbjct:   15 GLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES 192          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. UniProt/SwissProt
Match: sp|Q9BY50|SC11C_HUMAN (Signal peptidase complex catalytic subunit SEC11C OS=Homo sapiens OX=9606 GN=SEC11C PE=1 SV=3)

HSP 1 Score: 300.827 bits (769), Expect = 2.366e-103
Identity = 138/178 (77.53%), Postives = 162/178 (91.01%), Query Frame = 1
Query:   52 SMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
             + IF DL++MNKRQ+YYQVLNF+MIV SALMIWKGLIV+TGSESPIVVVLSGSMEPAF RGDLLFLTNFR++PIR G+I+VF+++GR+IPIVHRVIKVHEK++G IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+GF+PY+GMVTIIMNDYPKFKYA+L  +G +VL  RES
Sbjct:   15 GLDIFGDLKKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES 192          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. TrEMBL
Match: K1QMT2 (Signal peptidase complex catalytic subunit SEC11 OS=Crassostrea gigas OX=29159 GN=CGI_10022282 PE=3 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 5.611e-106
Identity = 146/184 (79.35%), Postives = 168/184 (91.30%), Query Frame = 1
Query:   31 F*EMDIFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRE 582
            F +M +  M   DD+RRMN RQ+YYQVLNF MIV SALMIWKGL+VVTGSESPIVVVLSGSMEPAFFRGDLLFLTN+R+EPIRVG+I+VF+I+GR+IPIVHRV+KVHEKEDG +KFLTKGDNNSVDDRGLYA  Q WLE+KDV+GRA+GF+PY+G+VTI+MNDYPKFKYA+L CLGLFVL HRE
Sbjct:   40 FFKMGLLDMDFLDDVRRMNPRQLYYQVLNFGMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNYREEPIRVGEIVVFKIEGRDIPIVHRVLKVHEKEDGKVKFLTKGDNNSVDDRGLYAPGQLWLEKKDVVGRARGFVPYVGIVTILMNDYPKFKYAILACLGLFVLIHRE 223          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. TrEMBL
Match: K1RK52 (Signal peptidase complex catalytic subunit SEC11 OS=Crassostrea gigas OX=29159 GN=CGI_10012947 PE=3 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 4.746e-105
Identity = 144/176 (81.82%), Postives = 164/176 (93.18%), Query Frame = 1
Query:   55 MSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRE 582
            M   DD+RRMN RQ+YYQVLNF MIV SALMIWKGL+VVTGSESPIVVVLSGSMEPAFFRGDLLFLTN+R+EPIRVG+I+VF+I+GR+IPIVHRV+KVHEKEDG +KFLTKGDNNSVDDRGLYA  Q WLE+KDV+GRA+GF+PY+G+VTI+MNDYPKFKYA+L CLGLFVL HRE
Sbjct:    1 MDFLDDVRRMNPRQLYYQVLNFGMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNYREEPIRVGEIVVFKIEGRDIPIVHRVLKVHEKEDGKVKFLTKGDNNSVDDRGLYAPGQLWLEKKDVVGRARGFVPYVGIVTILMNDYPKFKYAILACLGLFVLIHRE 176          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. TrEMBL
Match: A0A1W7RDM2 (Signal peptidase complex catalytic subunit SEC11 OS=Agkistrodon contortrix contortrix OX=8713 PE=3 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 8.114e-104
Identity = 143/177 (80.79%), Postives = 163/177 (92.09%), Query Frame = 1
Query:   55 MSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
            M IF DLRRMNKRQ+YYQVLNF+MIV SALMIWKGLIV+TGSESPIVVVLSGSMEPAF RGDLLFLTNFRD+PIR G+I+VF+++GR+IPIVHRVIKVHEKE+G+IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+GF+PY+GMVTIIMNDYPKFKYA+L  +G +VL  RES
Sbjct:    1 MDIFGDLRRMNKRQLYYQVLNFAMIVSSALMIWKGLIVITGSESPIVVVLSGSMEPAFHRGDLLFLTNFRDDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKENGNIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES 177          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. TrEMBL
Match: A0A0B8RWB5 (Signal peptidase complex catalytic subunit SEC11 OS=Boiga irregularis OX=92519 PE=3 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 8.114e-104
Identity = 143/177 (80.79%), Postives = 163/177 (92.09%), Query Frame = 1
Query:   55 MSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
            M IF DLRRMNKRQ+YYQVLNF+MIV SALMIWKGLIV+TGSESPIVVVLSGSMEPAF RGDLLFLTNFRD+PIR G+I+VF+++GR+IPIVHRVIKVHEKE+G+IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+GF+PY+GMVTIIMNDYPKFKYA+L  +G +VL  RES
Sbjct:    1 MDIFGDLRRMNKRQLYYQVLNFAMIVSSALMIWKGLIVITGSESPIVVVLSGSMEPAFHRGDLLFLTNFRDDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKENGNIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES 177          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. TrEMBL
Match: J3S0T9 (Signal peptidase complex catalytic subunit SEC11 OS=Crotalus adamanteus OX=8729 PE=2 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 8.114e-104
Identity = 143/177 (80.79%), Postives = 163/177 (92.09%), Query Frame = 1
Query:   55 MSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
            M IF DLRRMNKRQ+YYQVLNF+MIV SALMIWKGLIV+TGSESPIVVVLSGSMEPAF RGDLLFLTNFRD+PIR G+I+VF+++GR+IPIVHRVIKVHEKE+G+IKFLTKGDNN VDDRGLY E Q WLE+KDV+GRA+GF+PY+GMVTIIMNDYPKFKYA+L  +G +VL  RES
Sbjct:    1 MDIFGDLRRMNKRQLYYQVLNFAMIVSSALMIWKGLIVITGSESPIVVVLSGSMEPAFHRGDLLFLTNFRDDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKENGNIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALLAVMGAYVLLKRES 177          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Cavefish
Match: sec11a (signal peptidase complex catalytic subunit SEC11A [Source:NCBI gene;Acc:103040897])

HSP 1 Score: 301.212 bits (770), Expect = 1.302e-104
Identity = 142/179 (79.33%), Postives = 163/179 (91.06%), Query Frame = 1
Query:   46 IFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRE 582
            + S+   DD+RRMNKRQ+YYQVLNF MIV SALMIWKGL+VVTGSESPIVVVLSGSMEPAF RGDLLFLTN  ++PIRVG+I+VFRI+GREIPIVHRV+K+HEKE+G IKFLTKGDNNSVDDRGLY   Q+WLE+KDV+GRA+GF+PYIG+VTI+MNDYPKFKYA+L  LGLFVL HRE
Sbjct:    1 MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKENGDIKFLTKGDNNSVDDRGLYKRGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLCMLGLFVLVHRE 179          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Cavefish
Match: sec11a (signal peptidase complex catalytic subunit SEC11A [Source:NCBI gene;Acc:103041208])

HSP 1 Score: 295.049 bits (754), Expect = 3.585e-102
Identity = 139/179 (77.65%), Postives = 161/179 (89.94%), Query Frame = 1
Query:   46 IFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRE 582
            + S+   DD+RRMNKRQ+YYQVLNF MIV SALMIWKGL+VVTGSESPIVVVLSGSMEPAF RGDLLFLTN  +EPIRVG+I+VF+I+GR+IPIVHRV+K+HEKE+G IKFLTKGDNNSVDDRGLY   Q+WLE+KDV+GRA+GF+PYIG+VTI+MNDYPKFKY +L  LGLFVL  RE
Sbjct:    1 MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFHRGDLLFLTNHVEEPIRVGEIVVFKIEGRDIPIVHRVLKIHEKENGDIKFLTKGDNNSVDDRGLYKRGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYIVLCMLGLFVLLQRE 179          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Sea Lamprey
Match: sec11a (SEC11 homolog A, signal peptidase complex subunit [Source:ZFIN;Acc:ZDB-GENE-040718-227])

HSP 1 Score: 303.523 bits (776), Expect = 7.142e-106
Identity = 140/177 (79.10%), Postives = 161/177 (90.96%), Query Frame = 1
Query:   52 SMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRE 582
             + + DD+RRMNKRQ+YYQVLNF MIV SALMIWKGL+VVT SESPIVVVLSGSMEPAF RGDLLFLTN ++ PIRVG+I+VF+++GREIPIVHRVIK+HEKE+G +KFLTKGDNNSVDDRGLY   Q WLERKDV+GRA+GF+PYIG+VTI+MNDYPKFKYA+L CLGLFVL HRE
Sbjct:   25 GLHVLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVVTNSESPIVVVLSGSMEPAFHRGDLLFLTNHQETPIRVGEIVVFKVEGREIPIVHRVIKIHEKENGEVKFLTKGDNNSVDDRGLYKPGQNWLERKDVVGRARGFVPYIGIVTILMNDYPKFKYALLACLGLFVLIHRE 201          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Yeast
Match: SEC11 (18kDa catalytic subunit of the Signal Peptidase Complex (SPC); the Signal Peptidase Complex cleaves the signal sequence of proteins targeted to the endoplasmic reticulum; other members are Spc1p, Spc2p, Spc3p, and Sec11p [Source:SGD;Acc:S000001461])

HSP 1 Score: 151.754 bits (382), Expect = 7.077e-47
Identity = 77/164 (46.95%), Postives = 110/164 (67.07%), Query Frame = 1
Query:   82 MNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLER-KDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVL 570
            MN R    ++LN   +  SA M W+GL + T S SPIVVVLSGSMEPAF RGD+LFL N R+   +VGD++V+ ++G++IPIVHRV++ H         LTKGDNN+ +D  LYA  + +L + K+++G  KG+ P +G +TI +++    K+A+LG LGL  L
Sbjct:    1 MNLRFELQKLLNVCFLFASAYMFWQGLAIATNSASPIVVVLSGSMEPAFQRGDILFLWN-RNTFNQVGDVVVYEVEGKQIPIVHRVLRQHNNHADKQFLLTKGDNNAGNDISLYANKKIYLNKSKEIVGTVKGYFPQLGYITIWISENKYAKFALLGMLGLSAL 163          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Nematostella
Match: EDO41033 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5L9])

HSP 1 Score: 301.982 bits (772), Expect = 2.069e-105
Identity = 139/175 (79.43%), Postives = 164/175 (93.71%), Query Frame = 1
Query:   58 SIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRE 582
             +FDD+RRMNKRQ++YQVLNF++IV SALMIWKGL+VVTGSESPIVVVLSGSMEPAF RGDLLFLTN++++PIRVG+I+VF+++GREIPIVHRV+KVHEKE+G IKFLTKGDNNSVDDRGLYA  Q WL +KDV+GRA+GF+PY+GMVTI+MNDYPKFKYA+L  LGLFVL HRE
Sbjct:    5 EMFDDVRRMNKRQLFYQVLNFAIIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFQRGDLLFLTNYKEDPIRVGEIVVFKVEGREIPIVHRVLKVHEKENGDIKFLTKGDNNSVDDRGLYAPGQLWLAKKDVVGRARGFVPYVGMVTILMNDYPKFKYAILAALGLFVLIHRE 179          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Medaka
Match: sec11a (SEC11 homolog A, signal peptidase complex subunit [Source:NCBI gene;Acc:101165964])

HSP 1 Score: 285.804 bits (730), Expect = 1.255e-98
Identity = 141/179 (78.77%), Postives = 164/179 (91.62%), Query Frame = 1
Query:   46 IFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRE 582
            + S+   DD+RRMNKRQ+YYQVLNF MIV SALMIWKGL+VVTGSESPIVVVLSGSMEPAF RGDLLFLTN  ++PIRVG+I+VFRI+GREIPIVHRV+K+HEKE+G IKFLTKGDNN+VDDRGLY + Q+WLE+KDV+GRA+GF+PYIG+VTI+MNDYPKFKYA+L  LGLFVL HRE
Sbjct:    1 MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMVVTGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKENGDIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFKYAVLFLLGLFVLVHRE 179          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Planmine SMEST
Match: SMESG000064284.1 (SMESG000064284.1)

HSP 1 Score: 372.474 bits (955), Expect = 5.630e-133
Identity = 182/182 (100.00%), Postives = 182/182 (100.00%), Query Frame = 1
Query:   40 MDIFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
            MDIFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES
Sbjct:    1 MDIFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 182          
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Planmine SMEST
Match: SMESG000064284.1 (SMESG000064284.1)

HSP 1 Score: 363.229 bits (931), Expect = 2.944e-129
Identity = 177/177 (100.00%), Postives = 177/177 (100.00%), Query Frame = 1
Query:   55 MSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 585
            MSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES
Sbjct:    1 MSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESPIVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRVIKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPYIGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES 177          
The following BLAST results are available for this feature:
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEC11C4.927e-10477.53SEC11 homolog C, signal peptidase complex subunit ... [more]
SEC11A8.341e-9877.65SEC11 homolog A, signal peptidase complex subunit ... [more]
SEC11A4.406e-8379.74SEC11 homolog A, signal peptidase complex subunit ... [more]
SEC11A5.380e-8277.24SEC11 homolog A, signal peptidase complex subunit ... [more]
SEC11C1.246e-8176.19SEC11 homolog C, signal peptidase complex subunit ... [more]
back to top
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sec-112.747e-9369.49Signal peptidase complex catalytic subunit SEC11 ... [more]
back to top
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
twr3.422e-9873.14gene:FBgn0262801 transcript:FBtr0081687[more]
back to top
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sec11a4.709e-10579.33SEC11 homolog A, signal peptidase complex subunit ... [more]
sec11a4.709e-10579.33SEC11 homolog A, signal peptidase complex subunit ... [more]
back to top
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fam3b1.739e-10579.66family with sequence similarity 3 member B [Source... [more]
znhit11.563e-9879.33zinc finger, HIT-type containing 1 [Source:Xenbase... [more]
fam3b2.324e-9078.34family with sequence similarity 3 member B [Source... [more]
fam3b4.220e-9078.85family with sequence similarity 3 member B [Source... [more]
back to top
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sec11c2.006e-10578.65SEC11 homolog C, signal peptidase complex subunit ... [more]
Sec11c3.901e-10172.92SEC11 homolog C, signal peptidase complex subunit ... [more]
Sec11a1.335e-9878.21SEC11 homolog A, signal peptidase complex subunit ... [more]
Sec11a1.035e-9578.53SEC11 homolog A, signal peptidase complex subunit ... [more]
Sec11a3.039e-9578.18SEC11 homolog A, signal peptidase complex subunit ... [more]
back to top
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9D8V7|SC11C_MOUSE1.403e-10478.65Signal peptidase complex catalytic subunit SEC11C ... [more]
sp|Q9WTR7|SC11C_RAT5.279e-10478.09Signal peptidase complex catalytic subunit SEC11C ... [more]
sp|P13679|SC11C_CANLF8.546e-10478.09Signal peptidase complex catalytic subunit SEC11C ... [more]
sp|Q5RC30|SC11C_PONAB2.366e-10377.53Signal peptidase complex catalytic subunit SEC11C ... [more]
sp|Q9BY50|SC11C_HUMAN2.366e-10377.53Signal peptidase complex catalytic subunit SEC11C ... [more]
back to top
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QMT25.611e-10679.35Signal peptidase complex catalytic subunit SEC11 O... [more]
K1RK524.746e-10581.82Signal peptidase complex catalytic subunit SEC11 O... [more]
A0A1W7RDM28.114e-10480.79Signal peptidase complex catalytic subunit SEC11 O... [more]
A0A0B8RWB58.114e-10480.79Signal peptidase complex catalytic subunit SEC11 O... [more]
J3S0T98.114e-10480.79Signal peptidase complex catalytic subunit SEC11 O... [more]
back to top
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sec11a1.302e-10479.33signal peptidase complex catalytic subunit SEC11A ... [more]
sec11a3.585e-10277.65signal peptidase complex catalytic subunit SEC11A ... [more]
back to top
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sec11a7.142e-10679.10SEC11 homolog A, signal peptidase complex subunit ... [more]
back to top
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SEC117.077e-4746.9518kDa catalytic subunit of the Signal Peptidase Co... [more]
back to top
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO410332.069e-10579.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sec11a1.255e-9878.77SEC11 homolog A, signal peptidase complex subunit ... [more]
back to top
BLAST of Signal peptidase complex catalytic subunit SEC11 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000064284.15.630e-133100.00SMESG000064284.1[more]
SMESG000064284.12.944e-129100.00SMESG000064284.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014203 ID=SMED30014203|Name=Signal peptidase complex catalytic subunit SEC11|organism=Schmidtea mediterranea sexual|type=transcript|length=736bp
TTCAATATTATACGTGTAATATTTTCAAATTTCTAAGAAATGGATATATT
TAGTATGAGTATTTTCGACGATCTTCGTCGAATGAATAAACGTCAAGTTT
ATTATCAAGTCTTAAACTTCTCAATGATCGTATGTAGTGCATTAATGATA
TGGAAAGGATTAATAGTAGTTACAGGAAGCGAAAGTCCAATAGTAGTCGT
ATTAAGTGGAAGTATGGAACCTGCTTTTTTTAGAGGCGATTTATTATTTT
TAACAAATTTCCGAGATGAACCAATTAGAGTTGGTGACATTATCGTTTTT
AGGATAGATGGAAGAGAAATACCAATTGTTCATCGAGTCATAAAAGTACA
TGAAAAAGAAGACGGCTCAATTAAATTTTTAACTAAAGGAGACAATAATT
CAGTAGATGATAGAGGATTATATGCTGAAAACCAATATTGGTTAGAAAGA
AAAGATGTTATTGGTAGAGCGAAGGGGTTCATGCCCTACATTGGCATGGT
TACCATAATAATGAATGATTACCCGAAATTCAAATACGCAATGCTTGGCT
GTCTTGGATTATTTGTTTTAGCCCACCGTGAATCTTAAGTTGCATTTTTA
AAAGTTAATTTGGGGTTGTTTATAAAATATATTTTATGGTCTTTTTTGGT
ATTTGTTTTTATTTATATTCGTTGGAATCAATTTCTCGCGTTCTTTTATG
CTAAATTTTGAATTGATTTTTTAAAGTTATTTTCTG
back to top

protein sequence of SMED30014203-orf-1

>SMED30014203-orf-1 ID=SMED30014203-orf-1|Name=SMED30014203-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=183bp
MDIFSMSIFDDLRRMNKRQVYYQVLNFSMIVCSALMIWKGLIVVTGSESP
IVVVLSGSMEPAFFRGDLLFLTNFRDEPIRVGDIIVFRIDGREIPIVHRV
IKVHEKEDGSIKFLTKGDNNSVDDRGLYAENQYWLERKDVIGRAKGFMPY
IGMVTIIMNDYPKFKYAMLGCLGLFVLAHRES*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR037710SEC11C
IPR036286LexA/Signal_pep-like_sf
IPR001733Peptidase_S26B
IPR028360Peptidase_S24/S26_b-rbn
IPR019759Peptidase_S24_S26
IPR019758Pept_S26A_signal_pept_1_CS
IPR019756Pept_S26A_signal_pept_1_Ser-AS
IPR015927Peptidase_S24_S26A/B/C
Vocabulary: cellular component
TermDefinition
GO:0005787signal peptidase complex
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
Vocabulary: molecular function
TermDefinition
GO:0008233peptidase activity
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006465signal peptide processing
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001733Peptidase S26BPRINTSPR00728SIGNALPTASEcoord: 54..69
score: 70.83
coord: 113..124
score: 66.67
IPR001733Peptidase S26BTIGRFAMTIGR02228TIGR02228coord: 24..159
e-value: 2.0E-31
score: 107.0
IPR001733Peptidase S26BPANTHERPTHR10806SIGNAL PEPTIDASE COMPLEX CATALYTIC SUBUNIT SEC11coord: 5..182
IPR015927Peptidase S24/S26A/S26B/S26CPFAMPF00717Peptidase_S24coord: 54..105
e-value: 3.7E-11
score: 42.8
NoneNo IPR availableGENE3DG3DSA:2.10.109.10coord: 50..158
e-value: 3.5E-6
score: 28.8
NoneNo IPR availableCDDcd06530S26_SPase_Icoord: 50..144
e-value: 5.46858E-21
score: 80.3223
NoneNo IPR availableTMHMMTMhelixcoord: 20..42
IPR037710Signal peptidase complex catalytic subunit SEC11CPANTHERPTHR10806:SF12SIGNAL PEPTIDASE COMPLEX CATALYTIC SUBUNIT SEC11Ccoord: 5..182
IPR019758Peptidase S26A, signal peptidase I, conserved sitePROSITEPS00761SPASE_I_3coord: 113..126
IPR019756Peptidase S26A, signal peptidase I, serine active sitePROSITEPS00501SPASE_I_1coord: 56..63
IPR036286LexA/Signal peptidase-like superfamilySUPERFAMILYSSF51306LexA/Signal peptidasecoord: 51..151