Myosin

Overview
NameMyosin
Smed IDSMED30014199
Length (bp)3873
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myosin (SMED30014199) t-SNE clustered cells

Violin plots show distribution of expression levels for Myosin (SMED30014199) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myosin (SMED30014199) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myosin (SMED30014199) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30014199

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30014199SMESG000047361.1 dd_Smed_v4_4503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30014199SMESG000047361.1 dd_Smed_v4_4503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30014199SMESG000047361.1 dd_Smed_v4_4503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30014199SMESG000047361.1 dd_Smed_v4_4503_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30014199SMESG000047361.1 SMED30014199smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30014199SMESG000047361.1 SMED30014199smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30014199SMESG000047361.1 dd_Smed_v4_4503_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30014199SMESG000047361.1 dd_Smed_v4_4503_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Myosin vs. Ensembl Human
Match: MYO6 (myosin VI [Source:HGNC Symbol;Acc:HGNC:7605])

HSP 1 Score: 1134.4 bits (2933), Expect = 0.000e+0
Identity = 622/1242 (50.08%), Postives = 850/1242 (68.44%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGV-KMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVD---INSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSK--------PVEISNNQKTNN---DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  GN++DIG +++T++ LN + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+NIK+RY ++ IYTYVANILIA+NPY +IPK++S E I  Y+GKS+GT PPHV+AIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG     I+ RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  S V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG S+  REK  L SPDN+ YL  G TRYF  K    ++  + KS E+LK G++ D  L+D  DF     AMK +G+ D+E  ++F +VA +LHLGNI+FEE  ++ GGC + + S  SL+ C  LLG    +L  SL  R+      G + T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P+++HFT A+ Q + +HFRL +PRKSKL  HR++RD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F +E+ +S    +   K+    GKLSF+SV  KF++QL +L+D LR++  +FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ GYPSR  F +LYN+YKK +P  LA LD RLFCK LFKA+GL E+D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V  WL   RW+K Q+  L VIKLKNKIK+R +  IK+QKT+RMW+ +++   +I  + K+  L   L+K   + + LK     + K I   +     + ++I+ T    M    QI   + + +      +++LQK+ + E+   E E+LR IQEEM   +++ E+++   ++ EEE+R+KLEMEA RK+EEE+ K+        QA  ++ + ++ EE     Q+   EQERRD+ELALRIA+ ++ ++ + ++        P  ++          D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T      S ++   Q    + P  + EI     QR+F +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    7 VWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGT-GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESR-----DKFIRELFESSTNNNKDTKQ--KAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGYPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKST----MMTQEQIQKEYDALVKSSEELLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQKEEESQ--QQAVLEQERRDRELALRIAQSEAELISDEAQADLALRRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYAQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1231          
BLAST of Myosin vs. Ensembl Human
Match: MYO6 (myosin VI [Source:HGNC Symbol;Acc:HGNC:7605])

HSP 1 Score: 1129.01 bits (2919), Expect = 0.000e+0
Identity = 625/1253 (49.88%), Postives = 853/1253 (68.08%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGV-KMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVD---INSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSK--------PVEISNNQKTNN---DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEP-KNEISQITV----------QRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  GN++DIG +++T++ LN + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+NIK+RY ++ IYTYVANILIA+NPY +IPK++S E I  Y+GKS+GT PPHV+AIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG     I+ RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  S V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG S+  REK  L SPDN+ YL  G TRYF  K    ++  + KS E+LK G++ D  L+D  DF     AMK +G+ D+E  ++F +VA +LHLGNI+FEE  ++ GGC + + S  SL+ C  LLG    +L  SL  R+      G + T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P+++HFT A+ Q + +HFRL +PRKSKL  HR++RD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F +E+ +S    +   K+    GKLSF+SV  KF++QL +L+D LR++  +FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ GYPSR  F +LYN+YKK +P  LA LD RLFCK LFKA+GL E+D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V  WL   RW+K Q+  L VIKLKNKIK+R +  IK+QKT+RMW+ +++   +I  + K+  L   L+K   + + LK     + K I   +     + ++I+ T    M    QI   + + +      +++LQK+ + E+   E E+LR IQEEM   +++ E+++   ++ EEE+R+KLEMEA RK+EEE+ K+        QA  ++ + ++ EE     Q+   EQERRD+ELALRIA+ ++ ++ + ++        P  ++          D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T T  +   S +     P  N  P +N  +QI            QR+F +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    7 VWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGT-GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESR-----DKFIRELFESSTNNNKDTKQ--KAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGYPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKST----MMTQEQIQKEYDALVKSSEELLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQKEEESQ--QQAVLEQERRDRELALRIAQSEAELISDEAQADLALRRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRN--TETEQRAPKSVTDYDFAPFLNNSPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1240          
BLAST of Myosin vs. Ensembl Human
Match: MYO6 (myosin VI [Source:HGNC Symbol;Acc:HGNC:7605])

HSP 1 Score: 1129.01 bits (2919), Expect = 0.000e+0
Identity = 625/1253 (49.88%), Postives = 853/1253 (68.08%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGV-KMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVD---INSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSK--------PVEISNNQKTNN---DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEP-KNEISQITV----------QRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  GN++DIG +++T++ LN + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+NIK+RY ++ IYTYVANILIA+NPY +IPK++S E I  Y+GKS+GT PPHV+AIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG     I+ RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  S V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG S+  REK  L SPDN+ YL  G TRYF  K    ++  + KS E+LK G++ D  L+D  DF     AMK +G+ D+E  ++F +VA +LHLGNI+FEE  ++ GGC + + S  SL+ C  LLG    +L  SL  R+      G + T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P+++HFT A+ Q + +HFRL +PRKSKL  HR++RD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F +E+ +S    +   K+    GKLSF+SV  KF++QL +L+D LR++  +FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ GYPSR  F +LYN+YKK +P  LA LD RLFCK LFKA+GL E+D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V  WL   RW+K Q+  L VIKLKNKIK+R +  IK+QKT+RMW+ +++   +I  + K+  L   L+K   + + LK     + K I   +     + ++I+ T    M    QI   + + +      +++LQK+ + E+   E E+LR IQEEM   +++ E+++   ++ EEE+R+KLEMEA RK+EEE+ K+        QA  ++ + ++ EE     Q+   EQERRD+ELALRIA+ ++ ++ + ++        P  ++          D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T T  +   S +     P  N  P +N  +QI            QR+F +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    7 VWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGT-GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESR-----DKFIRELFESSTNNNKDTKQ--KAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGYPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKST----MMTQEQIQKEYDALVKSSEELLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQKEEESQ--QQAVLEQERRDRELALRIAQSEAELISDEAQADLALRRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRN--TETEQRAPKSVTDYDFAPFLNNSPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1240          
BLAST of Myosin vs. Ensembl Human
Match: MYO6 (myosin VI [Source:HGNC Symbol;Acc:HGNC:7605])

HSP 1 Score: 1122.07 bits (2901), Expect = 0.000e+0
Identity = 624/1274 (48.98%), Postives = 852/1274 (66.88%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGV-KMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVD---INSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTIL-------------------------------EELSK---------PVEISNNQKTNN---DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  GN++DIG +++T++ LN + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+NIK+RY ++ IYTYVANILIA+NPY +IPK++S E I  Y+GKS+GT PPHV+AIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG     I+ RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  S V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG S+  REK  L SPDN+ YL  G TRYF  K    ++  + KS E+LK G++ D  L+D  DF     AMK +G+ D+E  ++F +VA +LHLGNI+FEE  ++ GGC + + S  SL+ C  LLG    +L  SL  R+      G + T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P+++HFT A+ Q + +HFRL +PRKSKL  HR++RD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F +E+ +S    +   K+    GKLSF+SV  KF++QL +L+D LR++  +FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ GYPSR  F +LYN+YKK +P  LA LD RLFCK LFKA+GL E+D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V  WL   RW+K Q+  L VIKLKNKIK+R +  IK+QKT+RMW+ +++   +I  + K+  L   L+K   + + LK     + K I   +     + ++I+ T    M    QI   + + +      +++LQK+ + E+   E E+LR IQEEM   +++ E+++   ++ EEE+R+KLEMEA RK+EEE+ K+        QA  ++ + ++ EE     Q+   EQERRD+ELALRIA+ ++ ++                               E+++K         P  ++          D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T      S ++   Q    + P  + EI     QR+F +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    7 VWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGT-GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESR-----DKFIRELFESSTNNNKDTKQ--KAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGYPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKST----MMTQEQIQKEYDALVKSSEELLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQKEEESQ--QQAVLEQERRDRELALRIAQSEAELISDEAQADLALRSLDSYPVTSKNDGTRPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYAQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1263          
BLAST of Myosin vs. Ensembl Human
Match: MYO6 (myosin VI [Source:HGNC Symbol;Acc:HGNC:7605])

HSP 1 Score: 1120.92 bits (2898), Expect = 0.000e+0
Identity = 627/1276 (49.14%), Postives = 855/1276 (67.01%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGV-KMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVD---INSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTIL----------------------EELSK---------PVEISNNQKTNN---DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPK-NEISQITV----------QRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  GN++DIG +++T++ LN + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+NIK+RY ++ IYTYVANILIA+NPY +IPK++S E I  Y+GKS+GT PPHV+AIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG     I+ RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  S V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG S+  REK  L SPDN+ YL  G TRYF  K    ++  + KS E+LK G++ D  L+D  DF     AMK +G+ D+E  ++F +VA +LHLGNI+FEE  ++ GGC + + S  SL+ C  LLG    +L  SL  R+      G + T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P+++HFT A+ Q + +HFRL +PRKSKL  HR++RD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F +E+ +S    +   K+    GKLSF+SV  KF++QL +L+D LR++  +FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ GYPSR  F +LYN+YKK +P  LA LD RLFCK LFKA+GL E+D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V  WL   RW+K Q+  L VIKLKNKIK+R +  IK+QKT+RMW+ +++   +I  + K+  L   L+K   + + LK     + K I   +     + ++I+ T    M    QI   + + +      +++LQK+ + E+   E E+LR IQEEM   +++ E+++   ++ EEE+R+KLEMEA RK+EEE+ K+        QA  ++ + ++ EE     Q+   EQERRD+ELALRIA+ ++ ++                      E+++K         P  ++          D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T T  +   S +     P  N  P+ N  +QI            QR+F +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    7 VWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGT-GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESR-----DKFIRELFESSTNNNKDTKQK--AGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGYPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKST----MMTQEQIQKEYDALVKSSEELLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQKEEESQ--QQAVLEQERRDRELALRIAQSEAELISDEAQADLALRRNDGTRPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRN--TETEQRAPKSVTDYDFAPFLNNSPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1263          
BLAST of Myosin vs. Ensembl Celegans
Match: spe-15 (pep chromosome:WBcel235:I:1446497:1465358:1 gene:WBGene00004969.1 transcript:F47G6.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:spe-15)

HSP 1 Score: 976.852 bits (2524), Expect = 0.000e+0
Identity = 557/1243 (44.81%), Postives = 784/1243 (63.07%), Query Frame = 2
Query:   17 EMNEVVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQKTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTF----NAMKSLGITDKENTEIFGIVAAILHLGNIEFEE-VNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKS--DKGVKMIAANKQKFSKIQSQIRITPSN-KMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPKSLIVKEHEETESYIQELSKEQ-ERRDKELALRIAEGDSTIL---EELSKPVEISNNQKTNNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQ-----------VQLQPVKNPEPKNEISQITVQRYFSLPFTT----VSGKSTQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEI 3661
            +   +VW  +  EG+V   + DI  N  T+    + +T+   Y+ T+  EE+ +++V+DNC+L+ LN   LLNN ++RY    IYTYVANILI+INPY  I  L+S ETI +Y+GKS+G + PH++AIAD+AYR+M+  K +QSIIVSGESGAGKTE+ K +L+YL E +G  AGPI+QR+ E+NP+LEAFGN+KT+RNNNSSR+GKFV+IHF +N  VAGGFVSHYLLE SR+C+Q++ ERNYHIFY++ AG S    +K  L    ++NYLK+G T +F   N  S L TD+      +    N S  + +      F     A+   G++D E   I+  VA ILHLGNIEFEE  + S+GGC I+S +++SL +   LLG +P E+   LC RI      G + T +R+ LK  +A   RDALAKAIYS+LFD +VA IN++IPF++S  Y+G+LD+AGFEYF  NSFEQFCIN+CNEKLQ FFNER+L +EQ +YE EGL + KI+F DN DCI+L EKK SG+ D+LDEE+KLP+   +HFT    ++N NHFRL  PRKSK+K+HR++RD EG LIRH+AG VCY T  F+EKNND LH+SL+ L+E SS  L+  +F  E        +  +K G   G+L  VSV  KF+SQL  L+D L N+ T+F+RC+KPN  M A  F+G +IL QLQC+GM  VL LMQ+G+PSR  F DLY +Y+K LP +LA LD RLF K LF A+GL ++DF+FG TKVFF  GK AEFDQ+++ DPE V  +++KV  WL+K RWRK Q+G   VIKLKNKI +R ++I KIQ  +R ++VRK+F +++   +K   L     ++T I A++ +S  DK  +   +   +  ++   I+    N ++   ++  +     +   I  L+ ++E +++ +E E+ R   E+    + + +      K       ++ +ME  R+K +++ +    + K  +  E EE    ++  +KE+ +R D  ++ R+A  D   L   E  + P +    Q++  D+  + Y +LR  IN+S D++L+ AC+ EFHRR+  YN WKSK    +++  T    +    Q           VQ  P  NP        +T QRYF + F T     +G S  G W AHF+G+YI RQ+ I   +   LLVAG DDL MC LPL  TGL+ +KGAEI+   FE +W + GG  I
Sbjct:   10 DFGRLVWISDEAEGFVAARITDIAENGFTLATEKTSETVNRRYEDTWACEEDPQKSVEDNCALVHLNEATLLNNCRLRYANGKIYTYVANILISINPYQLIDGLYSPETIKEYRGKSLGQMEPHIFAIADKAYREMRRIKTSQSIIVSGESGAGKTESQKAVLKYLCENWGTDAGPIQQRLLETNPILEAFGNAKTLRNNNSSRFGKFVQIHFSDNGTVAGGFVSHYLLETSRVCRQAAGERNYHIFYQLIAGSSPDLYKKLRLAPASSFNYLKHGATLFFV--NSKSSLKTDAS-----RFSETNSSVSDSIISDIDDFAKLERALALSGVSDDEKMFIWSTVAGILHLGNIEFEENASDSRGGCMITSGTENSLMAAAELLGLEPEEMKLGLCARIMQTTKGGVKGTLIRVPLKAHEASAGRDALAKAIYSKLFDWLVAQINKSIPFEKSTGYIGVLDVAGFEYFAVNSFEQFCINFCNEKLQHFFNERILKQEQEMYEAEGLNIQKIEFTDNLDCIELFEKKASGLFDLLDEEAKLPRATFQHFTQRAHESNKNHFRLDAPRKSKVKSHREMRDDEGLLIRHYAGTVCYETRYFVEKNNDQLHNSLEMLIEQSSFPLVVSLFTSEA-------TGAVKTG---GRLKAVSVGAKFKSQLSSLLDKLNNTGTHFVRCVKPNSQMKAWHFDGSAILGQLQCAGMASVLRLMQEGFPSRTSFADLYAMYEKNLPPSLARLDPRLFSKCLFHALGLDQNDFQFGNTKVFFTAGKFAEFDQMMKQDPETVMELISKVTDWLVKARWRKVQYGAWSVIKLKNKILYRAEKIKKIQAWIRGYLVRKRFHKRLAIFRKACALLENSREMTDILARMNESSQDKWREAADSTTGELDELVKTIKNDDLNTEIDRAVKCYEDCVKRVDSIIADLKLQLENDEL-AEVERARKEAEDKERREAEEKAAAEQEKI------LRRKMEEEREKAQKEYELQLEMQKQKLAAEAEEE---VKRRNKEERDRLDAAVSSRLASSDGVALVAQEASAAPPK----QQSKYDLGNWKYADLRDAINTSNDMELLVACKEEFHRRLRIYNEWKSKNSANRDVPPTRAPLTVYNQQKPSSSSMMVSRVQAAPHLNP-------ALTQQRYFKVSFATDNKKKNGGSQSGMWYAHFNGQYIRRQLTIRPSQKPQLLVAGKDDLQMCELPLEQTGLLRKKGAEISSNDFETMWYHYGGKPI 1214          
BLAST of Myosin vs. Ensembl Celegans
Match: hum-8 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:Q6EZG5])

HSP 1 Score: 907.131 bits (2343), Expect = 0.000e+0
Identity = 526/1230 (42.76%), Postives = 771/1230 (62.68%), Query Frame = 2
Query:   17 EMNEVVWAPEPIEGYVKGNVIDIGSNTITVKLL-NSQKTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFC--TKNEISKLSTDSKS-AEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEE-VNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANK--QKFSKIQSQIRITPS---------NKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSKPVEISNNQKT----NNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKN-ITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGKSTQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWR 3640
            +    VW  +  +G+    +ID+ +   T++LL N+  T+T  ++     E++  R+V+DNC LM LN   LLNNI++RY    IY+YVANILI+INPY  I   +S + I +Y+GKS+G   PH++AIAD++YR+M  ++ +QSIIVSGESGAGKTE+ K +L+YL E +G+ AG I++R+ E+NP+LEAFGN+KT+RNNNSSR+GKFV+IHF +   VAGG+VSHYLLE SRIC+Q++ ERNYHIFY++ AG S +  +   L  P+ +NYLK G   +F   +    SK+  +  S  +F +     DS ++D  DF     A+K  G++++E   I+  +AAILHLGN+EFEE ++ S+GGC++ + S+  L    RLLG +  EL   LC RI      GA+ T +R+ LK  +A + RDAL+KAIYS+LFD +V+ IN +IPF++S N+VG+LD+AGFE++ KNSFEQFCIN+CNEKLQ FFN+R+L EEQ LYEKEGL + KI+F+DNQDCI+L E KG+G+ D+LDEE+K P  N + FT    + N  HFRL  PRKSK+K+HR+LRD EG LIRH+AG+VCY T+ F+EKN+D LH+SL+ L+E S++ L+  +F       G    P         KL  +SV  KF++QL  L+  L ++ T+F+RCIKPN  M+   F+G +ILSQLQC+GMT VL LMQ G+PSR  F DLY  Y+K LP  L+ LD R+FCK LF+A+GL + DF+FG+TKVFFR GK AEFDQ+++ DPE +  ++ KV +WL+  RW+++Q+ V  VIKLKNKI WR  Q+ ++Q   R ++ R++F ++I   +K   L    +++  I  +L +  +     +A+   +   K+ S I++T S         N     ++ +DS        I  L+K+ +++++   + K R  +E+ R+       E    K+AE ++ IK ++E   ++++   K  +    S I K  EETE   Q  ++E+E+ DK ++ R+AE D   L      +E S+   T      DV   ++  LR  IN+S D+ L++AC+ EF RR+  YN WKS+    ++     +   +  E    ++ +  P      S   +QRYF   F   + K     W  HF G+ I RQ+     +    L+AG DD  MC+L L  T L+ ++GAEI+E +FE  W+
Sbjct:   74 DYGRTVWITDATDGFRAARIIDLSATGFTLRLLDNTGDTVTRVFEDVLACEDDSRRHVEDNCQLMHLNEATLLNNIRLRYQNGKIYSYVANILISINPYQTIDGFYSLQKIKEYRGKSLGQKEPHIFAIADKSYREMIRHRKSQSIIVSGESGAGKTESQKAVLRYLCENWGSGAGEIQKRLLETNPILEAFGNAKTLRNNNSSRFGKFVQIHFADTGNVAGGYVSHYLLETSRICRQAAGERNYHIFYQLIAGSSPELFKFLALGQPNQFNYLKRGFIGFFTHPSSGTTSKIPKNRLSDPKFTQ-----DSMVDDFSDFQRLEYALKLTGLSEQEIHFIWTTIAAILHLGNVEFEESLDDSRGGCKVFNGSEQDLIQAARLLGLETMELKMGLCARIMQTTKGGARGTLIRVPLKPHEACSGRDALSKAIYSKLFDWLVSRINDSIPFEKSTNFVGVLDVAGFEFYAKNSFEQFCINFCNEKLQNFFNQRILREEQELYEKEGLNVRKIEFIDNQDCIELFELKGNGLFDLLDEEAKFPTSNYKSFTKRAHEENRKHFRLDTPRKSKVKSHRELRDDEGLLIRHYAGSVCYETKHFVEKNDDLLHNSLQILIEQSTIRLLVSLF-------GSTAYPTK------SKLKALSVGAKFKNQLSTLLIKLESTGTHFVRCIKPNNQMIPFEFDGSAILSQLQCAGMTSVLKLMQDGFPSRTGFGDLYACYQKKLPPKLSKLDPRMFCKCLFRALGLDQHDFQFGLTKVFFRAGKFAEFDQMMKQDPETMTSLIQKVNEWLVGARWKQSQYAVWSVIKLKNKIAWRSAQVTRLQSIARGYLTRQRFSRQIALYRKSVALLKNSKEIEKILFRLNEHSRAKYTSSAHSTIRDLEKLVSHIKLTTSANDHFEKAENAYEHYVKRVDSM-------IADLKKQQKSDELAEIERKRRESEEKERL-------EIEAKKEAERQREIKRKLE---EQQQNAQKEHENYLISEIHKAAEETEKKRQ--NEEKEKLDKMVSNRLAEADGVALISSKMEIEPSSGSATFRDGKYDVGGCSFAYLRDTINTSMDINLLKACEEEFRRRLRIYNEWKSRNAPVQDRPPARAALSTVCEELSIMRSIATP------SAPQIQRYFKCEFKENNQKDQVSMWFVHFSGQQIQRQLTFTSSRPPQTLIAGRDDAQMCTLALQETLLVGKRGAEISEDEFESHWK 1260          
BLAST of Myosin vs. Ensembl Celegans
Match: hum-8 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:Q6EZG5])

HSP 1 Score: 899.812 bits (2324), Expect = 0.000e+0
Identity = 528/1244 (42.44%), Postives = 773/1244 (62.14%), Query Frame = 2
Query:   17 EMNEVVWAPEPIEGYVKGNVIDIGSNTITVKLL-NSQKTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFC--TKNEISKLSTDSKS-AEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEE-VNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANK--QKFSKIQSQIRITPS---------NKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSKPVEISNNQKT----NNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKN-ITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPF-------TTVSGKSTQ-------GTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWR 3640
            +    VW  +  +G+    +ID+ +   T++LL N+  T+T  ++     E++  R+V+DNC LM LN   LLNNI++RY    IY+YVANILI+INPY  I   +S + I +Y+GKS+G   PH++AIAD++YR+M  ++ +QSIIVSGESGAGKTE+ K +L+YL E +G+ AG I++R+ E+NP+LEAFGN+KT+RNNNSSR+GKFV+IHF +   VAGG+VSHYLLE SRIC+Q++ ERNYHIFY++ AG S +  +   L  P+ +NYLK G   +F   +    SK+  +  S  +F +     DS ++D  DF     A+K  G++++E   I+  +AAILHLGN+EFEE ++ S+GGC++ + S+  L    RLLG +  EL   LC RI      GA+ T +R+ LK  +A + RDAL+KAIYS+LFD +V+ IN +IPF++S N+VG+LD+AGFE++ KNSFEQFCIN+CNEKLQ FFN+R+L EEQ LYEKEGL + KI+F+DNQDCI+L E KG+G+ D+LDEE+K P  N + FT    + N  HFRL  PRKSK+K+HR+LRD EG LIRH+AG+VCY T+ F+EKN+D LH+SL+ L+E S++ L+  +F       G    P         KL  +SV  KF++QL  L+  L ++ T+F+RCIKPN  M+   F+G +ILSQLQC+GMT VL LMQ G+PSR  F DLY  Y+K LP  L+ LD R+FCK LF+A+GL + DF+FG+TKVFFR GK AEFDQ+++ DPE +  ++ KV +WL+  RW+++Q+ V  VIKLKNKI WR  Q+ ++Q   R ++ R++F ++I   +K   L    +++  I  +L +  +     +A+   +   K+ S I++T S         N     ++ +DS        I  L+K+ +++++   + K R  +E+ R+       E    K+AE ++ IK ++E   ++++   K  +    S I K  EETE   Q  ++E+E+ DK ++ R+AE D   L      +E S+   T      DV   ++  LR  IN+S D+ L++AC+ EF RR+  YN WKS+    ++     +   +  E    ++ +  P      S   +QRYF   F       T   G S +         W  HF G+ I RQ+     +    L+AG DD  MC+L L  T L+ ++GAEI+E +FE  W+
Sbjct:   74 DYGRTVWITDATDGFRAARIIDLSATGFTLRLLDNTGDTVTRVFEDVLACEDDSRRHVEDNCQLMHLNEATLLNNIRLRYQNGKIYSYVANILISINPYQTIDGFYSLQKIKEYRGKSLGQKEPHIFAIADKSYREMIRHRKSQSIIVSGESGAGKTESQKAVLRYLCENWGSGAGEIQKRLLETNPILEAFGNAKTLRNNNSSRFGKFVQIHFADTGNVAGGYVSHYLLETSRICRQAAGERNYHIFYQLIAGSSPELFKFLALGQPNQFNYLKRGFIGFFTHPSSGTTSKIPKNRLSDPKFTQ-----DSMVDDFSDFQRLEYALKLTGLSEQEIHFIWTTIAAILHLGNVEFEESLDDSRGGCKVFNGSEQDLIQAARLLGLETMELKMGLCARIMQTTKGGARGTLIRVPLKPHEACSGRDALSKAIYSKLFDWLVSRINDSIPFEKSTNFVGVLDVAGFEFYAKNSFEQFCINFCNEKLQNFFNQRILREEQELYEKEGLNVRKIEFIDNQDCIELFELKGNGLFDLLDEEAKFPTSNYKSFTKRAHEENRKHFRLDTPRKSKVKSHRELRDDEGLLIRHYAGSVCYETKHFVEKNDDLLHNSLQILIEQSTIRLLVSLF-------GSTAYPTK------SKLKALSVGAKFKNQLSTLLIKLESTGTHFVRCIKPNNQMIPFEFDGSAILSQLQCAGMTSVLKLMQDGFPSRTGFGDLYACYQKKLPPKLSKLDPRMFCKCLFRALGLDQHDFQFGLTKVFFRAGKFAEFDQMMKQDPETMTSLIQKVNEWLVGARWKQSQYAVWSVIKLKNKIAWRSAQVTRLQSIARGYLTRQRFSRQIALYRKSVALLKNSKEIEKILFRLNEHSRAKYTSSAHSTIRDLEKLVSHIKLTTSANDHFEKAENAYEHYVKRVDSM-------IADLKKQQKSDELAEIERKRRESEEKERL-------EIEAKKEAERQREIKRKLE---EQQQNAQKEHENYLISEIHKAAEETEKKRQ--NEEKEKLDKMVSNRLAEADGVALISSKMEIEPSSGSATFRDGKYDVGGCSFAYLRDTINTSMDINLLKACEEEFRRRLRIYNEWKSRNAPVQDRPPARAALSTVCEELSIMRSIATP------SAPQIQRYFKCEFKENNQKGTCSWGSSIKCEDLDQVSMWFVHFSGQQIQRQLTFTSSRPPQTLIAGRDDAQMCTLALQETLLVGKRGAEISEDEFESHWK 1274          
BLAST of Myosin vs. Ensembl Celegans
Match: hum-8 (Heavy chain, Unconventional Myosin [Source:UniProtKB/TrEMBL;Acc:Q6EZG5])

HSP 1 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 427/860 (49.65%), Postives = 599/860 (69.65%), Query Frame = 2
Query:   17 EMNEVVWAPEPIEGYVKGNVIDIGSNTITVKLL-NSQKTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFC--TKNEISKLSTDSKS-AEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEE-VNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKI----KSMKKLRN 2566
            +    VW  +  +G+    +ID+ +   T++LL N+  T+T  ++     E++  R+V+DNC LM LN   LLNNI++RY    IY+YVANILI+INPY  I   +S + I +Y+GKS+G   PH++AIAD++YR+M  ++ +QSIIVSGESGAGKTE+ K +L+YL E +G+ AG I++R+ E+NP+LEAFGN+KT+RNNNSSR+GKFV+IHF +   VAGG+VSHYLLE SRIC+Q++ ERNYHIFY++ AG S +  +   L  P+ +NYLK G   +F   +    SK+  +  S  +F +     DS ++D  DF     A+K  G++++E   I+  +AAILHLGN+EFEE ++ S+GGC++ + S+  L    RLLG +  EL   LC RI      GA+ T +R+ LK  +A + RDAL+KAIYS+LFD +V+ IN +IPF++S N+VG+LD+AGFE++ KNSFEQFCIN+CNEKLQ FFN+R+L EEQ LYEKEGL + KI+F+DNQDCI+L E KG+G+ D+LDEE+K P  N + FT    + N  HFRL  PRKSK+K+HR+LRD EG LIRH+AG+VCY T+ F+EKN+D LH+SL+ L+E S++ L+  +F       G    P         KL  +SV  KF++QL  L+  L ++ T+F+RCIKPN  M+   F+G +ILSQLQC+GMT VL LMQ G+PSR  F DLY  Y+K LP  L+ LD R+FCK LF+A+GL + DF+FG+TKVFFR GK AEFDQ+++ DPE +  ++ KV +WL+  RW+++Q+ V  VIKLKNKI WR  Q+ ++Q   R ++ R++F ++I    KS+  L+N
Sbjct:   74 DYGRTVWITDATDGFRAARIIDLSATGFTLRLLDNTGDTVTRVFEDVLACEDDSRRHVEDNCQLMHLNEATLLNNIRLRYQNGKIYSYVANILISINPYQTIDGFYSLQKIKEYRGKSLGQKEPHIFAIADKSYREMIRHRKSQSIIVSGESGAGKTESQKAVLRYLCENWGSGAGEIQKRLLETNPILEAFGNAKTLRNNNSSRFGKFVQIHFADTGNVAGGYVSHYLLETSRICRQAAGERNYHIFYQLIAGSSPELFKFLALGQPNQFNYLKRGFIGFFTHPSSGTTSKIPKNRLSDPKFTQ-----DSMVDDFSDFQRLEYALKLTGLSEQEIHFIWTTIAAILHLGNVEFEESLDDSRGGCKVFNGSEQDLIQAARLLGLETMELKMGLCARIMQTTKGGARGTLIRVPLKPHEACSGRDALSKAIYSKLFDWLVSRINDSIPFEKSTNFVGVLDVAGFEFYAKNSFEQFCINFCNEKLQNFFNQRILREEQELYEKEGLNVRKIEFIDNQDCIELFELKGNGLFDLLDEEAKFPTSNYKSFTKRAHEENRKHFRLDTPRKSKVKSHRELRDDEGLLIRHYAGSVCYETKHFVEKNDDLLHNSLQILIEQSTIRLLVSLF-------GSTAYPTK------SKLKALSVGAKFKNQLSTLLIKLESTGTHFVRCIKPNNQMIPFEFDGSAILSQLQCAGMTSVLKLMQDGFPSRTGFGDLYACYQKKLPPKLSKLDPRMFCKCLFRALGLDQHDFQFGLTKVFFRAGKFAEFDQMMKQDPETMTSLIQKVNEWLVGARWKQSQYAVWSVIKLKNKIAWRSAQVTRLQSIARGYLTRQRFSRQIALYRKSVALLKN 915          

HSP 2 Score: 104.76 bits (260), Expect = 2.823e-22
Identity = 67/215 (31.16%), Postives = 102/215 (47.44%), Query Frame = 2
Query: 3008 ESYIQELSKEQ---ERRDKELALRIAEGDSTILEELSKPVEISNNQKTNNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKN-ITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGKSTQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWR 3640
            +S I +L K+Q   E  + E   R +E    +  E  K  E         DV   ++  LR  IN+S D+ L++AC+ EF RR+  YN WKS+    ++     +   +  E    ++ +  P      S   +QRYF   F   + K     W  HF G+ I RQ+     +    L+AG DD  MC+L L  T L+ ++GAEI+E +FE  W+
Sbjct:  977 DSMIADLKKQQKSDELAEIERKRRESEEKERLEIEAKKEAERQREIDGKYDVGGCSFAYLRDTINTSMDINLLKACEEEFRRRLRIYNEWKSRNAPVQDRPPARAALSTVCEELSIMRSIATP------SAPQIQRYFKCEFKENNQKDQVSMWFVHFSGQQIQRQLTFTSSRPPQTLIAGRDDAQMCTLALQETLLVGKRGAEISEDEFESHWK 1185          
BLAST of Myosin vs. Ensembl Celegans
Match: nmy-1 (Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:Q20641])

HSP 1 Score: 429.869 bits (1104), Expect = 9.234e-126
Identity = 263/817 (32.19%), Postives = 446/817 (54.59%), Query Frame = 2
Query:   14 YEMNEVVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQKTITAEYDQTFPVEEEE-RNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARA----------------------GPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALK-----------REDARNARDALAKAIYSRLFDEIVAFINRAIP--FKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKF-VDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGI--GKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYK----KILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQ 2335
            +   ++ W P+  EG++ G++    ++ + V+L+++ + +T   D        +   ++D   L +LN  ++L+N+K RY+ + IYTY     + INPY ++P ++S++ I ++KGK    +PPH++AIAD AYR M   + +QSI+ +GESGAGKTE TK ++QYL    GA                        G +E ++ ++NP+LEAFGNSKTV+N+NSSR+GKF+ I+FD +  ++G  +  YLLEKSR+ +Q+ +ER++HIFY++  G S KE+ +Y L+  DNY +L N   R     N                        ++DV++F +T N+M+ +G  D E + I  +V+A+L LGN+EF                  + +        +   + + +C+ +     +  Q   LR  +K           +E A  A +A+AKA Y RLF  +V  IN+++    ++ A+++GILDIAGFE F+ NSFEQ CINY NEKLQQ FN  +   EQ  Y++EG+    I F +D Q  IDL+E K  G++ +LDEE   PK N++ F   L +T+  H +  +P         D+R    F + H+AG V Y  ++++ KN D L++++  L++ S+   +  ++ K+   +G+  + + +   G+   K  F +V+   + QL  LM  LRN++ +F+RCI PN    +       +L QL+C+G+   + + +QG+P+R+ F +  + Y+     ++P N   +D +   + +  A+ +  + ++ G +KVFFR G +A  ++
Sbjct:   23 WAQRKLCWVPDQNEGFLIGSIKRETNDEVLVELVDTSRQVTISRDDVQKANPPKFDKIEDMSELTYLNEASVLHNLKDRYYSSLIYTYSGLFCVVINPYKKLP-IYSEDLIEEFKGKKRHEMPPHIFAIADTAYRSMLQEREDQSILCTGESGAGKTENTKKVIQYLAHVAGATRNKSLNAAAQQNIVQKPDVRNPIGELEHQLLQANPILEAFGNSKTVKNDNSSRFGKFIRINFDMSGYISGANIEFYLLEKSRVLRQAQDERSFHIFYQILRGCSAKEKSEYLLEGVDNYRFLVN---RGITLPN------------------------VDDVQEFHSTINSMRIMGFADDEISSIMRVVSAVLLLGNLEF------------------TQEKKSDQAMLQDDRVIQKVCHLLGLPVIE-LQKAFLRPRIKVGREFVNKAQNQEQAEFAVEAIAKASYERLFKWLVTRINKSLDRTHRQGASFIGILDIAGFEIFDINSFEQICINYTNEKLQQLFNNTMFILEQEEYQREGIEWDFIDFGLDLQPTIDLIE-KPMGVLALLDEECLFPKANDKSFVEKLQKTHNKHPKFIVP---------DMRSKSHFAVVHYAGRVDYSADQWLMKNMDPLNENVVGLMQNSTDPFVAGIW-KDAEFAGICAAEMNETAFGMRSRKGMFRTVSQLHKEQLTKLMTTLRNTSPHFVRCIIPNHEKKSGKINSNLVLEQLRCNGVLEGIRICRQGFPNRVPFQEFRHRYEILTPDVIPKNF--IDGKESVRKMITALDIDTNLYRIGQSKVFFRTGVLAHLEE 779          
BLAST of Myosin vs. Ensembl Fly
Match: jar (gene:FBgn0011225 transcript:FBtr0345266)

HSP 1 Score: 1021.92 bits (2641), Expect = 0.000e+0
Identity = 579/1243 (46.58%), Postives = 807/1243 (64.92%), Query Frame = 2
Query:   11 LYEMNEVVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEEERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGA-RAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEV-NTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDK----GVKMIAAN-KQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPK--SLIVKEHEETES-----YIQELSKEQERRDKELALRIAEGDSTILEELSKPVEISNNQKTNN--------DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNP---EPKNEISQITVQ-RYFSLPFTTVSGK--STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGG 3652
            + E  ++VW  +  EGY++G + +IG+    V   + +    T  +D      +  ++ DDNC LM LN    L+N+K RY+++ IYTYVANILIA+NPY EI +L++ +TI KY G+S+G LPPHV+AIAD+A RDM++ K++QSIIVSGESGAGKTE+TKY+L+YL  CY    AGPIE +I ++NP+LEAFGN+KT RNNNSSR+GKF+E+H+D    V GG++SHYLLEKSRIC QS+ ERNYH+FY + AG  Q+ R+K  L  PD+Y YL +G T+YF        +    KS    + G L D  ++D + F     A+  LG++D E   I+ +VAA+LHLGNI FEE+ +  +GGCQ+S +S+ SL     LLG   TEL  +L +R+  + G G + T + + LK  +A NARDALAKAIYSRLFD IV  IN++IPF+ S  Y+G+LDIAGFEYF  NSFEQFCINYCNEKLQ+FFN+ +L  EQ LY++EGL + +I F DNQD I+L+E K +GI  +LDEESKLPKP+  HFT  + ++  NH+RL LPR S+LKAHR LRD EGFL+RHFAGAVCY+TE+FIEKNNDALH SL+ L++     L+  +FP     SG  TS         GKL+F+SV +KF++QL  LM+ L  + TNFIRCIKPN  M+ + FEG   L+QL+CSG   VL+LM+ GYPSR+ F DLY++YK +LP  L +L  R FC+ +F+++ L   DFKFG+TKVFFRPGK  EFD+++RSDPEN+  +VAKV+KWLI+ RW K+  G L VIKL+N+I +R + ++  Q+  R ++ RK+   + + + K+  +     K   IA+ LK   +    GV  I         KI+   RIT   +M  +  ++ +  ++LTVD+N+   +++ ++   E+E+LR IQE +   +   E E+   ++  E KR+K EME  RK  E +  R +   +  +L ++E  E E+     Y Q+L  EQERRD ELALR+A   +  +E+    +  S N +           D++++ Y ELR  IN+SCD++L+EAC+ EFHRR+  Y+ WK+K +++    TT  ++  +   V     K P   +P  EI  +T Q RYF +PF   +    + +G W AHFDG++IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI E +F   W   GG
Sbjct:    1 MLEDTQLVWVRDAAEGYIQGRITEIGAKEFEVTPTDRKYPKRTCHFDDIHSSCDGPQDHDDNCELMLLNEATFLDNLKTRYYKDKIYTYVANILIAVNPYREIKELYAPDTIKKYNGRSLGELPPHVFAIADKAIRDMRVYKLSQSIIVSGESGAGKTESTKYLLKYL--CYSHDSAGPIETKILDANPVLEAFGNAKTTRNNNSSRFGKFIEVHYDAKCQVVGGYISHYLLEKSRICTQSAEERNYHVFYMLLAGAPQQLRDKLSLGKPDDYRYL-SGCTQYFANAKTEQLIPGSQKSKNHQQKGPLKDPIIDDYQHFHNLDKALGRLGLSDTEKLGIYSLVAAVLHLGNIAFEEIPDDVRGGCQVSEASEQSLTITSGLLGVDQTELRTALVSRVMQSKGGGFKGTVIMVPLKIYEASNARDALAKAIYSRLFDRIVGLINQSIPFQASNFYIGVLDIAGFEYFTVNSFEQFCINYCNEKLQKFFNDNILKNEQELYKREGLNVPEITFTDNQDIIELIEAKSNGIFTLLDEESKLPKPSYSHFTAEVHKSWANHYRLGLPRSSRLKAHRTLRDEEGFLVRHFAGAVCYNTEQFIEKNNDALHASLEGLVQECDNPLLQTLFP-----SGSSTSV-------RGKLNFISVGSKFKTQLGELMEKLEQNGTNFIRCIKPNSKMIDRQFEGSLALAQLKCSGTISVLELMEHGYPSRVLFADLYSMYKSVLPPELVSLPARTFCEAMFQSLNLSAKDFKFGITKVFFRPGKFVEFDRIMRSDPENMLAIVAKVKKWLIRSRWVKSALGALCVIKLRNRIIYRNKCVLIAQRIARGFLARKQHRPRYQGIGKINKIRTNTLKTIEIASGLKMGREEIISGVNDIYRQIDDAIKKIKMNPRIT-QREMDSMYTVVMANMNKLTVDLNT---KLKEQQQAEEQERLRKIQEALEAERAAKEAEEQRQREEIENKRLKAEMETRRKAAEAQRLRQEEEDRRAALALQEQLEKEAKDDAKYRQQL--EQERRDHELALRLANESNGQVEDSPPVIRKSENVRAQQQALGKQKYDLSKWKYSELRDAINTSCDIELLEACRQEFHRRLKVYHAWKAKNRKR----TTMDENERAPRSVMEAAFKQPPLVQPIQEI--VTAQHRYFRIPFMRANAPDNTKRGLWYAHFDGQWIARQMELHADKPPILLVAGTDDMQMCELSLEETGLTRKRGAEILEHEFNREWERNGG 1216          
BLAST of Myosin vs. Ensembl Fly
Match: jar (gene:FBgn0011225 transcript:FBtr0334872)

HSP 1 Score: 1013.06 bits (2618), Expect = 0.000e+0
Identity = 583/1260 (46.27%), Postives = 809/1260 (64.21%), Query Frame = 2
Query:   11 LYEMNEVVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEEERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGA-RAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEV-NTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDK----GVKMIAAN-KQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPK--SLIVKEHEETES-----YIQELSKEQERRDKELALRIAEGDSTILEELSKPVEISNN-------------------------QKTNNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNP---EPKNEISQITVQ-RYFSLPFTTVSGK--STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGG 3652
            + E  ++VW  +  EGY++G + +IG+    V   + +    T  +D      +  ++ DDNC LM LN    L+N+K RY+++ IYTYVANILIA+NPY EI +L++ +TI KY G+S+G LPPHV+AIAD+A RDM++ K++QSIIVSGESGAGKTE+TKY+L+YL  CY    AGPIE +I ++NP+LEAFGN+KT RNNNSSR+GKF+E+H+D    V GG++SHYLLEKSRIC QS+ ERNYH+FY + AG  Q+ R+K  L  PD+Y YL +G T+YF        +    KS    + G L D  ++D + F     A+  LG++D E   I+ +VAA+LHLGNI FEE+ +  +GGCQ+S +S+ SL     LLG   TEL  +L +R+  + G G + T + + LK  +A NARDALAKAIYSRLFD IV  IN++IPF+ S  Y+G+LDIAGFEYF  NSFEQFCINYCNEKLQ+FFN+ +L  EQ LY++EGL + +I F DNQD I+L+E K +GI  +LDEESKLPKP+  HFT  + ++  NH+RL LPR S+LKAHR LRD EGFL+RHFAGAVCY+TE+FIEKNNDALH SL+ L++     L+  +FP     SG  TS         GKL+F+SV +KF++QL  LM+ L  + TNFIRCIKPN  M+ + FEG   L+QL+CSG   VL+LM+ GYPSR+ F DLY++YK +LP  L +L  R FC+ +F+++ L   DFKFG+TKVFFRPGK  EFD+++RSDPEN+  +VAKV+KWLI+ RW K+  G L VIKL+N+I +R + ++  Q+  R ++ RK+   + + + K+  +     K   IA+ LK   +    GV  I         KI+   RIT   +M  +  ++ +  ++LTVD+N+   +++ ++   E+E+LR IQE +   +   E E+   ++  E KR+K EME  RK  E +  R +   +  +L ++E  E E+     Y Q+L  EQERRD ELALR+A   +  +E+ S PV I N                           K   D++++ Y ELR  IN+SCD++L+EAC+ EFHRR+  Y+ WK+K +++    TT  ++  +   V     K P   +P  EI  +T Q RYF +PF   +    + +G W AHFDG++IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI E +F   W   GG
Sbjct:    1 MLEDTQLVWVRDAAEGYIQGRITEIGAKEFEVTPTDRKYPKRTCHFDDIHSSCDGPQDHDDNCELMLLNEATFLDNLKTRYYKDKIYTYVANILIAVNPYREIKELYAPDTIKKYNGRSLGELPPHVFAIADKAIRDMRVYKLSQSIIVSGESGAGKTESTKYLLKYL--CYSHDSAGPIETKILDANPVLEAFGNAKTTRNNNSSRFGKFIEVHYDAKCQVVGGYISHYLLEKSRICTQSAEERNYHVFYMLLAGAPQQLRDKLSLGKPDDYRYL-SGCTQYFANAKTEQLIPGSQKSKNHQQKGPLKDPIIDDYQHFHNLDKALGRLGLSDTEKLGIYSLVAAVLHLGNIAFEEIPDDVRGGCQVSEASEQSLTITSGLLGVDQTELRTALVSRVMQSKGGGFKGTVIMVPLKIYEASNARDALAKAIYSRLFDRIVGLINQSIPFQASNFYIGVLDIAGFEYFTVNSFEQFCINYCNEKLQKFFNDNILKNEQELYKREGLNVPEITFTDNQDIIELIEAKSNGIFTLLDEESKLPKPSYSHFTAEVHKSWANHYRLGLPRSSRLKAHRTLRDEEGFLVRHFAGAVCYNTEQFIEKNNDALHASLEGLVQECDNPLLQTLFP-----SGSSTSV-------RGKLNFISVGSKFKTQLGELMEKLEQNGTNFIRCIKPNSKMIDRQFEGSLALAQLKCSGTISVLELMEHGYPSRVLFADLYSMYKSVLPPELVSLPARTFCEAMFQSLNLSAKDFKFGITKVFFRPGKFVEFDRIMRSDPENMLAIVAKVKKWLIRSRWVKSALGALCVIKLRNRIIYRNKCVLIAQRIARGFLARKQHRPRYQGIGKINKIRTNTLKTIEIASGLKMGREEIISGVNDIYRQIDDAIKKIKMNPRIT-QREMDSMYTVVMANMNKLTVDLNT---KLKEQQQAEEQERLRKIQEALEAERAAKEAEEQRQREEIENKRLKAEMETRRKAAEAQRLRQEEEDRRAALALQEQLEKEAKDDAKYRQQL--EQERRDHELALRLANESNGQVED-SPPV-IRNGVNDASPMGPNKLIRSENVRAQQQALGKQKYDLSKWKYSELRDAINTSCDIELLEACRQEFHRRLKVYHAWKAKNRKR----TTMDENERAPRSVMEAAFKQPPLVQPIQEI--VTAQHRYFRIPFMRANAPDNTKRGLWYAHFDGQWIARQMELHADKPPILLVAGTDDMQMCELSLEETGLTRKRGAEILEHEFNREWERNGG 1231          
BLAST of Myosin vs. Ensembl Fly
Match: jar (gene:FBgn0011225 transcript:FBtr0084636)

HSP 1 Score: 1013.06 bits (2618), Expect = 0.000e+0
Identity = 583/1260 (46.27%), Postives = 809/1260 (64.21%), Query Frame = 2
Query:   11 LYEMNEVVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEEERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGA-RAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEV-NTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDK----GVKMIAAN-KQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPK--SLIVKEHEETES-----YIQELSKEQERRDKELALRIAEGDSTILEELSKPVEISNN-------------------------QKTNNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNP---EPKNEISQITVQ-RYFSLPFTTVSGK--STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGG 3652
            + E  ++VW  +  EGY++G + +IG+    V   + +    T  +D      +  ++ DDNC LM LN    L+N+K RY+++ IYTYVANILIA+NPY EI +L++ +TI KY G+S+G LPPHV+AIAD+A RDM++ K++QSIIVSGESGAGKTE+TKY+L+YL  CY    AGPIE +I ++NP+LEAFGN+KT RNNNSSR+GKF+E+H+D    V GG++SHYLLEKSRIC QS+ ERNYH+FY + AG  Q+ R+K  L  PD+Y YL +G T+YF        +    KS    + G L D  ++D + F     A+  LG++D E   I+ +VAA+LHLGNI FEE+ +  +GGCQ+S +S+ SL     LLG   TEL  +L +R+  + G G + T + + LK  +A NARDALAKAIYSRLFD IV  IN++IPF+ S  Y+G+LDIAGFEYF  NSFEQFCINYCNEKLQ+FFN+ +L  EQ LY++EGL + +I F DNQD I+L+E K +GI  +LDEESKLPKP+  HFT  + ++  NH+RL LPR S+LKAHR LRD EGFL+RHFAGAVCY+TE+FIEKNNDALH SL+ L++     L+  +FP     SG  TS         GKL+F+SV +KF++QL  LM+ L  + TNFIRCIKPN  M+ + FEG   L+QL+CSG   VL+LM+ GYPSR+ F DLY++YK +LP  L +L  R FC+ +F+++ L   DFKFG+TKVFFRPGK  EFD+++RSDPEN+  +VAKV+KWLI+ RW K+  G L VIKL+N+I +R + ++  Q+  R ++ RK+   + + + K+  +     K   IA+ LK   +    GV  I         KI+   RIT   +M  +  ++ +  ++LTVD+N+   +++ ++   E+E+LR IQE +   +   E E+   ++  E KR+K EME  RK  E +  R +   +  +L ++E  E E+     Y Q+L  EQERRD ELALR+A   +  +E+ S PV I N                           K   D++++ Y ELR  IN+SCD++L+EAC+ EFHRR+  Y+ WK+K +++    TT  ++  +   V     K P   +P  EI  +T Q RYF +PF   +    + +G W AHFDG++IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI E +F   W   GG
Sbjct:    1 MLEDTQLVWVRDAAEGYIQGRITEIGAKEFEVTPTDRKYPKRTCHFDDIHSSCDGPQDHDDNCELMLLNEATFLDNLKTRYYKDKIYTYVANILIAVNPYREIKELYAPDTIKKYNGRSLGELPPHVFAIADKAIRDMRVYKLSQSIIVSGESGAGKTESTKYLLKYL--CYSHDSAGPIETKILDANPVLEAFGNAKTTRNNNSSRFGKFIEVHYDAKCQVVGGYISHYLLEKSRICTQSAEERNYHVFYMLLAGAPQQLRDKLSLGKPDDYRYL-SGCTQYFANAKTEQLIPGSQKSKNHQQKGPLKDPIIDDYQHFHNLDKALGRLGLSDTEKLGIYSLVAAVLHLGNIAFEEIPDDVRGGCQVSEASEQSLTITSGLLGVDQTELRTALVSRVMQSKGGGFKGTVIMVPLKIYEASNARDALAKAIYSRLFDRIVGLINQSIPFQASNFYIGVLDIAGFEYFTVNSFEQFCINYCNEKLQKFFNDNILKNEQELYKREGLNVPEITFTDNQDIIELIEAKSNGIFTLLDEESKLPKPSYSHFTAEVHKSWANHYRLGLPRSSRLKAHRTLRDEEGFLVRHFAGAVCYNTEQFIEKNNDALHASLEGLVQECDNPLLQTLFP-----SGSSTSV-------RGKLNFISVGSKFKTQLGELMEKLEQNGTNFIRCIKPNSKMIDRQFEGSLALAQLKCSGTISVLELMEHGYPSRVLFADLYSMYKSVLPPELVSLPARTFCEAMFQSLNLSAKDFKFGITKVFFRPGKFVEFDRIMRSDPENMLAIVAKVKKWLIRSRWVKSALGALCVIKLRNRIIYRNKCVLIAQRIARGFLARKQHRPRYQGIGKINKIRTNTLKTIEIASGLKMGREEIISGVNDIYRQIDDAIKKIKMNPRIT-QREMDSMYTVVMANMNKLTVDLNT---KLKEQQQAEEQERLRKIQEALEAERAAKEAEEQRQREEIENKRLKAEMETRRKAAEAQRLRQEEEDRRAALALQEQLEKEAKDDAKYRQQL--EQERRDHELALRLANESNGQVED-SPPV-IRNGVNDASPMGPNKLIRSENVRAQQQALGKQKYDLSKWKYSELRDAINTSCDIELLEACRQEFHRRLKVYHAWKAKNRKR----TTMDENERAPRSVMEAAFKQPPLVQPIQEI--VTAQHRYFRIPFMRANAPDNTKRGLWYAHFDGQWIARQMELHADKPPILLVAGTDDMQMCELSLEETGLTRKRGAEILEHEFNREWERNGG 1231          
BLAST of Myosin vs. Ensembl Fly
Match: jar (gene:FBgn0011225 transcript:FBtr0301371)

HSP 1 Score: 1013.06 bits (2618), Expect = 0.000e+0
Identity = 583/1260 (46.27%), Postives = 809/1260 (64.21%), Query Frame = 2
Query:   11 LYEMNEVVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEEERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGA-RAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEV-NTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDK----GVKMIAAN-KQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPK--SLIVKEHEETES-----YIQELSKEQERRDKELALRIAEGDSTILEELSKPVEISNN-------------------------QKTNNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNP---EPKNEISQITVQ-RYFSLPFTTVSGK--STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGG 3652
            + E  ++VW  +  EGY++G + +IG+    V   + +    T  +D      +  ++ DDNC LM LN    L+N+K RY+++ IYTYVANILIA+NPY EI +L++ +TI KY G+S+G LPPHV+AIAD+A RDM++ K++QSIIVSGESGAGKTE+TKY+L+YL  CY    AGPIE +I ++NP+LEAFGN+KT RNNNSSR+GKF+E+H+D    V GG++SHYLLEKSRIC QS+ ERNYH+FY + AG  Q+ R+K  L  PD+Y YL +G T+YF        +    KS    + G L D  ++D + F     A+  LG++D E   I+ +VAA+LHLGNI FEE+ +  +GGCQ+S +S+ SL     LLG   TEL  +L +R+  + G G + T + + LK  +A NARDALAKAIYSRLFD IV  IN++IPF+ S  Y+G+LDIAGFEYF  NSFEQFCINYCNEKLQ+FFN+ +L  EQ LY++EGL + +I F DNQD I+L+E K +GI  +LDEESKLPKP+  HFT  + ++  NH+RL LPR S+LKAHR LRD EGFL+RHFAGAVCY+TE+FIEKNNDALH SL+ L++     L+  +FP     SG  TS         GKL+F+SV +KF++QL  LM+ L  + TNFIRCIKPN  M+ + FEG   L+QL+CSG   VL+LM+ GYPSR+ F DLY++YK +LP  L +L  R FC+ +F+++ L   DFKFG+TKVFFRPGK  EFD+++RSDPEN+  +VAKV+KWLI+ RW K+  G L VIKL+N+I +R + ++  Q+  R ++ RK+   + + + K+  +     K   IA+ LK   +    GV  I         KI+   RIT   +M  +  ++ +  ++LTVD+N+   +++ ++   E+E+LR IQE +   +   E E+   ++  E KR+K EME  RK  E +  R +   +  +L ++E  E E+     Y Q+L  EQERRD ELALR+A   +  +E+ S PV I N                           K   D++++ Y ELR  IN+SCD++L+EAC+ EFHRR+  Y+ WK+K +++    TT  ++  +   V     K P   +P  EI  +T Q RYF +PF   +    + +G W AHFDG++IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI E +F   W   GG
Sbjct:    1 MLEDTQLVWVRDAAEGYIQGRITEIGAKEFEVTPTDRKYPKRTCHFDDIHSSCDGPQDHDDNCELMLLNEATFLDNLKTRYYKDKIYTYVANILIAVNPYREIKELYAPDTIKKYNGRSLGELPPHVFAIADKAIRDMRVYKLSQSIIVSGESGAGKTESTKYLLKYL--CYSHDSAGPIETKILDANPVLEAFGNAKTTRNNNSSRFGKFIEVHYDAKCQVVGGYISHYLLEKSRICTQSAEERNYHVFYMLLAGAPQQLRDKLSLGKPDDYRYL-SGCTQYFANAKTEQLIPGSQKSKNHQQKGPLKDPIIDDYQHFHNLDKALGRLGLSDTEKLGIYSLVAAVLHLGNIAFEEIPDDVRGGCQVSEASEQSLTITSGLLGVDQTELRTALVSRVMQSKGGGFKGTVIMVPLKIYEASNARDALAKAIYSRLFDRIVGLINQSIPFQASNFYIGVLDIAGFEYFTVNSFEQFCINYCNEKLQKFFNDNILKNEQELYKREGLNVPEITFTDNQDIIELIEAKSNGIFTLLDEESKLPKPSYSHFTAEVHKSWANHYRLGLPRSSRLKAHRTLRDEEGFLVRHFAGAVCYNTEQFIEKNNDALHASLEGLVQECDNPLLQTLFP-----SGSSTSV-------RGKLNFISVGSKFKTQLGELMEKLEQNGTNFIRCIKPNSKMIDRQFEGSLALAQLKCSGTISVLELMEHGYPSRVLFADLYSMYKSVLPPELVSLPARTFCEAMFQSLNLSAKDFKFGITKVFFRPGKFVEFDRIMRSDPENMLAIVAKVKKWLIRSRWVKSALGALCVIKLRNRIIYRNKCVLIAQRIARGFLARKQHRPRYQGIGKINKIRTNTLKTIEIASGLKMGREEIISGVNDIYRQIDDAIKKIKMNPRIT-QREMDSMYTVVMANMNKLTVDLNT---KLKEQQQAEEQERLRKIQEALEAERAAKEAEEQRQREEIENKRLKAEMETRRKAAEAQRLRQEEEDRRAALALQEQLEKEAKDDAKYRQQL--EQERRDHELALRLANESNGQVED-SPPV-IRNGVNDASPMGPNKLIRSENVRAQQQALGKQKYDLSKWKYSELRDAINTSCDIELLEACRQEFHRRLKVYHAWKAKNRKR----TTMDENERAPRSVMEAAFKQPPLVQPIQEI--VTAQHRYFRIPFMRANAPDNTKRGLWYAHFDGQWIARQMELHADKPPILLVAGTDDMQMCELSLEETGLTRKRGAEILEHEFNREWERNGG 1231          
BLAST of Myosin vs. Ensembl Fly
Match: jar (gene:FBgn0011225 transcript:FBtr0301367)

HSP 1 Score: 1013.06 bits (2618), Expect = 0.000e+0
Identity = 583/1260 (46.27%), Postives = 809/1260 (64.21%), Query Frame = 2
Query:   11 LYEMNEVVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEEERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGA-RAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEV-NTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDK----GVKMIAAN-KQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPK--SLIVKEHEETES-----YIQELSKEQERRDKELALRIAEGDSTILEELSKPVEISNN-------------------------QKTNNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNP---EPKNEISQITVQ-RYFSLPFTTVSGK--STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGG 3652
            + E  ++VW  +  EGY++G + +IG+    V   + +    T  +D      +  ++ DDNC LM LN    L+N+K RY+++ IYTYVANILIA+NPY EI +L++ +TI KY G+S+G LPPHV+AIAD+A RDM++ K++QSIIVSGESGAGKTE+TKY+L+YL  CY    AGPIE +I ++NP+LEAFGN+KT RNNNSSR+GKF+E+H+D    V GG++SHYLLEKSRIC QS+ ERNYH+FY + AG  Q+ R+K  L  PD+Y YL +G T+YF        +    KS    + G L D  ++D + F     A+  LG++D E   I+ +VAA+LHLGNI FEE+ +  +GGCQ+S +S+ SL     LLG   TEL  +L +R+  + G G + T + + LK  +A NARDALAKAIYSRLFD IV  IN++IPF+ S  Y+G+LDIAGFEYF  NSFEQFCINYCNEKLQ+FFN+ +L  EQ LY++EGL + +I F DNQD I+L+E K +GI  +LDEESKLPKP+  HFT  + ++  NH+RL LPR S+LKAHR LRD EGFL+RHFAGAVCY+TE+FIEKNNDALH SL+ L++     L+  +FP     SG  TS         GKL+F+SV +KF++QL  LM+ L  + TNFIRCIKPN  M+ + FEG   L+QL+CSG   VL+LM+ GYPSR+ F DLY++YK +LP  L +L  R FC+ +F+++ L   DFKFG+TKVFFRPGK  EFD+++RSDPEN+  +VAKV+KWLI+ RW K+  G L VIKL+N+I +R + ++  Q+  R ++ RK+   + + + K+  +     K   IA+ LK   +    GV  I         KI+   RIT   +M  +  ++ +  ++LTVD+N+   +++ ++   E+E+LR IQE +   +   E E+   ++  E KR+K EME  RK  E +  R +   +  +L ++E  E E+     Y Q+L  EQERRD ELALR+A   +  +E+ S PV I N                           K   D++++ Y ELR  IN+SCD++L+EAC+ EFHRR+  Y+ WK+K +++    TT  ++  +   V     K P   +P  EI  +T Q RYF +PF   +    + +G W AHFDG++IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI E +F   W   GG
Sbjct:    1 MLEDTQLVWVRDAAEGYIQGRITEIGAKEFEVTPTDRKYPKRTCHFDDIHSSCDGPQDHDDNCELMLLNEATFLDNLKTRYYKDKIYTYVANILIAVNPYREIKELYAPDTIKKYNGRSLGELPPHVFAIADKAIRDMRVYKLSQSIIVSGESGAGKTESTKYLLKYL--CYSHDSAGPIETKILDANPVLEAFGNAKTTRNNNSSRFGKFIEVHYDAKCQVVGGYISHYLLEKSRICTQSAEERNYHVFYMLLAGAPQQLRDKLSLGKPDDYRYL-SGCTQYFANAKTEQLIPGSQKSKNHQQKGPLKDPIIDDYQHFHNLDKALGRLGLSDTEKLGIYSLVAAVLHLGNIAFEEIPDDVRGGCQVSEASEQSLTITSGLLGVDQTELRTALVSRVMQSKGGGFKGTVIMVPLKIYEASNARDALAKAIYSRLFDRIVGLINQSIPFQASNFYIGVLDIAGFEYFTVNSFEQFCINYCNEKLQKFFNDNILKNEQELYKREGLNVPEITFTDNQDIIELIEAKSNGIFTLLDEESKLPKPSYSHFTAEVHKSWANHYRLGLPRSSRLKAHRTLRDEEGFLVRHFAGAVCYNTEQFIEKNNDALHASLEGLVQECDNPLLQTLFP-----SGSSTSV-------RGKLNFISVGSKFKTQLGELMEKLEQNGTNFIRCIKPNSKMIDRQFEGSLALAQLKCSGTISVLELMEHGYPSRVLFADLYSMYKSVLPPELVSLPARTFCEAMFQSLNLSAKDFKFGITKVFFRPGKFVEFDRIMRSDPENMLAIVAKVKKWLIRSRWVKSALGALCVIKLRNRIIYRNKCVLIAQRIARGFLARKQHRPRYQGIGKINKIRTNTLKTIEIASGLKMGREEIISGVNDIYRQIDDAIKKIKMNPRIT-QREMDSMYTVVMANMNKLTVDLNT---KLKEQQQAEEQERLRKIQEALEAERAAKEAEEQRQREEIENKRLKAEMETRRKAAEAQRLRQEEEDRRAALALQEQLEKEAKDDAKYRQQL--EQERRDHELALRLANESNGQVED-SPPV-IRNGVNDASPMGPNKLIRSENVRAQQQALGKQKYDLSKWKYSELRDAINTSCDIELLEACRQEFHRRLKVYHAWKAKNRKR----TTMDENERAPRSVMEAAFKQPPLVQPIQEI--VTAQHRYFRIPFMRANAPDNTKRGLWYAHFDGQWIARQMELHADKPPILLVAGTDDMQMCELSLEETGLTRKRGAEILEHEFNREWERNGG 1231          
BLAST of Myosin vs. Ensembl Zebrafish
Match: myo6b (myosin VIb [Source:ZFIN;Acc:ZDB-GENE-030318-3])

HSP 1 Score: 1122.84 bits (2903), Expect = 0.000e+0
Identity = 609/1246 (48.88%), Postives = 855/1246 (68.62%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKS----DKGVKMIAANKQKF-SKIQSQI--RITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QA-VPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEE-------LSKPVEISNNQKTNN----DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  G ++DIG++ +T++ L+ + KT  A   Q FP E++  ++V+DNCSLM+LN   LLNNI+IRY ++ IYT+VANILIA+NPY +IPKL+S E+I  Y+G+S+GTLPPHVYAIAD+AYRDM++ K++QSIIVSGESGAGKTE TK++L+YLT  YG     I++RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  + V GGFVSHYLLEKSRIC QS  ERNYHIFYR+CAG S+  R    L SPD++ YL  G TRYF  K+   ++  + KS E  K+G L D  L+D+ DF     AMK +G+ D E   +F +VA +LHLGNI+FEE  ++ GGC + + S  +L+ C  LLG    +L  SL  R+      GA+ T +++ LK E A NARDALAKA+YSRLFD +V  +N+  PF  S+N++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY++EGLG+ ++ +VDNQDCIDLVE K  G++DILDEE++LP+P+++HF  A+   + +HFRL +PRKSKL  HR+LRD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F +++ ++   +    +K    GKLSF+SV  KF++QL +L++ LR++ ++FIRC+KPN+ MV+  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YK+ +P+ L  LD RLFCK LFKA+GL E+D+KFG+T+VFFRPGK AEFDQ+++SDP+++  +V +V KWL+  RW+K Q+  L VIKL+NK+ +R    I+IQKT+RMW+ R++   ++  + K++NL   +E+       LK+      K ++ +AA+     +KI++ +  R     +  G+++  +         ++S+QK+ + ++   E E+L+ IQEEM   +++ E+E+ L KQ EE++R+K EME  RK+EEE+ K+        QA +   L +   EET+   ++   EQERRD+ELA+RIA+ ++ ++++       L +  ++  N+        D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T      S ++   Q      P  + EI+    QRYF +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ L+
Sbjct:    7 VWAPHPTDGFQLGMIVDIGADALTIEPLHQRGKTFLAPISQVFPAEDDVNKHVEDNCSLMYLNEATLLNNIRIRYSKDMIYTFVANILIAVNPYFDIPKLYSPESIKSYQGRSLGTLPPHVYAIADKAYRDMRVLKMSQSIIVSGESGAGKTENTKFVLRYLTTSYGT-GQDIDERIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKNAVVGGFVSHYLLEKSRICMQSQEERNYHIFYRLCAGASEDIRNMLHLNSPDSFRYLNRGCTRYFANKDSDKQIMQNRKSPEHGKVGALKDPLLDDLGDFNRMVVAMKKIGLDDTEKLNLFRVVAGVLHLGNIDFEETGSTSGGCILKNQSSQTLEYCADLLGLDQDDLRVSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARDALAKAVYSRLFDHVVKRVNQCFPFDTSSNFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQREGLGVNEVHYVDNQDCIDLVEAKLVGVLDILDEENRLPQPSDQHFAEAVHSKHKDHFRLTVPRKSKLTIHRNLRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLVCESK-----DKFVRDLFENNSNSKDSKQKA---GKLSFISVGNKFKTQLNLLLEKLRSTGSSFIRCVKPNLKMVSHQFEGAQILSQLQCSGMVSVLDLMQGGFPSRAPFHELYNMYKQYMPNKLTRLDPRLFCKALFKALGLNENDYKFGLTRVFFRPGKFAEFDQIMKSDPDHLAELVKRVNKWLVCSRWKKVQWCTLSVIKLRNKMSYRASACIRIQKTVRMWLCRRRHKPRVDGLVKVKNLRKRMERFNEAVNGLKEGKAEMSKQIEELAASTDALMAKIKTTVMSRKEIEQEYEGLVKRSEQL-------LSSMQKKKQEQE---ETERLKHIQEEMEKERKRHEEEEQLRKQEEEDRRMKSEMEQKRKQEEEERKKREEEERVLQAELEMQLALDREEETQ---RQTILEQERRDRELAMRIAQNEAELIQDEAQMDPILRRGAQVQANKVAAGVKKYDLSKWKYAELRDAINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTDTEMRAPKSVTDYAQQNPAPPVPARQQEIAMNRQQRYFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKQPILLVAGKDDMEMCELSLEETGLTRKRGAEILPRQFEEIWERCGGIQYLK 1230          
BLAST of Myosin vs. Ensembl Zebrafish
Match: myo6a (myosin VIa [Source:ZFIN;Acc:ZDB-GENE-040819-2])

HSP 1 Score: 1118.99 bits (2893), Expect = 0.000e+0
Identity = 622/1248 (49.84%), Postives = 842/1248 (67.47%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANKQKF-SKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEME------ATXXXXXXXXXXXQAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSKP-------VEISNNQKTNN----DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQP-VKNPEPK-NEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQRLNNQISS 3691
            VWAP P +G+  G +IDI ++++T++ LN + K   A  DQ FP E++  ++V+DNCSLM+LN   LLNN+++RY ++ IYT+VANILIA+NPY EIPKL+S ETI +Y+G+S+GTLPPHVYAIAD+AYRDMK+ K++QSIIVSGESGAGKTE TK++L+YLT  YG     I++RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  + V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG  +  REK+ L SPD + YL  G TRYF TK+    +  + KS E LK G L D  L+D  DF     AMK +G+ D E   +F +VA +LHLGNI+FEE  ++ GGC +  +   SLQ C  LLG    +L  SL +R+      G + T +++ LK E A +ARDALAKAIYSRLFD +V  IN+  PF  SA+++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDLVE K  GI+DILDEE++LP+P+++HFT  +   + +HFRL +PRKSKL+ HR++RD EGF+IRHFAGAVCY T +F+EKNNDALH SL  L+  S    + ++F     ++   +    +K    GKLSF+SV  KF++QL +L++ L ++ ++F+RC+KPN+ MV   FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YK+ +P+ L  LD RLFCK LFKA+GL E+D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V KWLI  RW+K Q+  L VIKLKNK+ +R Q  +++QKT+RMW+ R+K   +I  + K +NL   +EKL  + + LK   +G + ++ + Q   S I + IR   S  M+  + I    Q+ +T     L    + ++   E E+L+ IQEEM   +++ E+E+   K+ EEE+R K EME         +K+ E+ +R       L ++   E E+  Q +  EQERRD+ELALRIA+ ++ ++ E + P        ++S N    +    +++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K K+N+              Q  P V    P+ +EI     QR+F +PF     +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI   Q L N I S
Sbjct:    7 VWAPHPTDGFQLGRIIDISADSLTIEPLNQRGKNFQAPVDQVFPAEDDVNKHVEDNCSLMYLNEATLLNNVRVRYSKDKIYTFVANILIAVNPYCEIPKLYSPETIKQYQGRSLGTLPPHVYAIADKAYRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTTSYGT-GQDIDERIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKNAVVGGFVSHYLLEKSRICTQGQEERNYHIFYRLCAGAPEDIREKFHLSSPDCFRYLCRGCTRYFSTKDSDKLIPQNRKSPELLKAGPLKDPLLDDHADFNRMSVAMKKIGLDDTEKLNLFRVVAGVLHLGNIDFEEAGSTSGGCVLKKTCGQSLQFCAELLGLDEEDLRVSLTSRVMLTTAGGTKGTVIKVPLKVEQASSARDALAKAIYSRLFDHVVTRINQCFPFDSSAHFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLVESKVVGILDILDEENRLPQPSDQHFTETVHSKHKDHFRLTVPRKSKLQVHRNVRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLACLVSESKDKFIGELF-----ENSNHSKDTKQKA---GKLSFISVGNKFKTQLNILLEKLHSTGSSFVRCVKPNLKMVGHHFEGAQILSQLQCSGMVSVLDLMQGGFPSRAPFHELYNMYKQYMPAKLTRLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNKWLICSRWKKVQWCALSVIKLKNKMLYRAQACVQMQKTVRMWLCRRKHKPRIDGLVKAQNLKKRMEKLNEVVSGLK---EGKQEMSKHMQDLDSSIDAHIRKIKSIVMSR-MDIDHEHQALVTRSQELLSAMQKKKQEEEEMERLKRIQEEMEKERKRREEEEQKRKREEEERRQKAEMELKRKQEEEERKKREEEERKLQEEMELQLEAEREQETSRQAVL-EQERRDRELALRIAQSEAELIPEETPPDAGLRRGPQVSANNAQADVKKYELSKWKYAELRDAINTSCDIELLAACREEFHRRLKVYHAWKSKNK-KRNVQEEQRAPKAITDYAQQNPVVPAAVPRQHEIVMNRQQRFFRIPFIRPGDQYKDPQSKKKGWWYAHFDGPWIARQMELHPDKHPILLVAGKDDMEMCELSLEETGLTRKRGAEILPRQFEEIWERCGGI---QYLRNAIES 1236          
BLAST of Myosin vs. Ensembl Zebrafish
Match: myo6a (myosin VIa [Source:ZFIN;Acc:ZDB-GENE-040819-2])

HSP 1 Score: 1118.99 bits (2893), Expect = 0.000e+0
Identity = 622/1248 (49.84%), Postives = 842/1248 (67.47%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANKQKF-SKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEME------ATXXXXXXXXXXXQAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSKP-------VEISNNQKTNN----DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQP-VKNPEPK-NEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQRLNNQISS 3691
            VWAP P +G+  G +IDI ++++T++ LN + K   A  DQ FP E++  ++V+DNCSLM+LN   LLNN+++RY ++ IYT+VANILIA+NPY EIPKL+S ETI +Y+G+S+GTLPPHVYAIAD+AYRDMK+ K++QSIIVSGESGAGKTE TK++L+YLT  YG     I++RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  + V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG  +  REK+ L SPD + YL  G TRYF TK+    +  + KS E LK G L D  L+D  DF     AMK +G+ D E   +F +VA +LHLGNI+FEE  ++ GGC +  +   SLQ C  LLG    +L  SL +R+      G + T +++ LK E A +ARDALAKAIYSRLFD +V  IN+  PF  SA+++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDLVE K  GI+DILDEE++LP+P+++HFT  +   + +HFRL +PRKSKL+ HR++RD EGF+IRHFAGAVCY T +F+EKNNDALH SL  L+  S    + ++F     ++   +    +K    GKLSF+SV  KF++QL +L++ L ++ ++F+RC+KPN+ MV   FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YK+ +P+ L  LD RLFCK LFKA+GL E+D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V KWLI  RW+K Q+  L VIKLKNK+ +R Q  +++QKT+RMW+ R+K   +I  + K +NL   +EKL  + + LK   +G + ++ + Q   S I + IR   S  M+  + I    Q+ +T     L    + ++   E E+L+ IQEEM   +++ E+E+   K+ EEE+R K EME         +K+ E+ +R       L ++   E E+  Q +  EQERRD+ELALRIA+ ++ ++ E + P        ++S N    +    +++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K K+N+              Q  P V    P+ +EI     QR+F +PF     +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI   Q L N I S
Sbjct:    7 VWAPHPTDGFQLGRIIDISADSLTIEPLNQRGKNFQAPVDQVFPAEDDVNKHVEDNCSLMYLNEATLLNNVRVRYSKDKIYTFVANILIAVNPYCEIPKLYSPETIKQYQGRSLGTLPPHVYAIADKAYRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTTSYGT-GQDIDERIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKNAVVGGFVSHYLLEKSRICTQGQEERNYHIFYRLCAGAPEDIREKFHLSSPDCFRYLCRGCTRYFSTKDSDKLIPQNRKSPELLKAGPLKDPLLDDHADFNRMSVAMKKIGLDDTEKLNLFRVVAGVLHLGNIDFEEAGSTSGGCVLKKTCGQSLQFCAELLGLDEEDLRVSLTSRVMLTTAGGTKGTVIKVPLKVEQASSARDALAKAIYSRLFDHVVTRINQCFPFDSSAHFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLVESKVVGILDILDEENRLPQPSDQHFTETVHSKHKDHFRLTVPRKSKLQVHRNVRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLACLVSESKDKFIGELF-----ENSNHSKDTKQKA---GKLSFISVGNKFKTQLNILLEKLHSTGSSFVRCVKPNLKMVGHHFEGAQILSQLQCSGMVSVLDLMQGGFPSRAPFHELYNMYKQYMPAKLTRLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNKWLICSRWKKVQWCALSVIKLKNKMLYRAQACVQMQKTVRMWLCRRKHKPRIDGLVKAQNLKKRMEKLNEVVSGLK---EGKQEMSKHMQDLDSSIDAHIRKIKSIVMSR-MDIDHEHQALVTRSQELLSAMQKKKQEEEEMERLKRIQEEMEKERKRREEEEQKRKREEEERRQKAEMELKRKQEEEERKKREEEERKLQEEMELQLEAEREQETSRQAVL-EQERRDRELALRIAQSEAELIPEETPPDAGLRRGPQVSANNAQADVKKYELSKWKYAELRDAINTSCDIELLAACREEFHRRLKVYHAWKSKNK-KRNVQEEQRAPKAITDYAQQNPVVPAAVPRQHEIVMNRQQRFFRIPFIRPGDQYKDPQSKKKGWWYAHFDGPWIARQMELHPDKHPILLVAGKDDMEMCELSLEETGLTRKRGAEILPRQFEEIWERCGGI---QYLRNAIES 1236          
BLAST of Myosin vs. Ensembl Zebrafish
Match: myo6b (myosin VIb [Source:ZFIN;Acc:ZDB-GENE-030318-3])

HSP 1 Score: 1117.84 bits (2890), Expect = 0.000e+0
Identity = 610/1258 (48.49%), Postives = 857/1258 (68.12%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKS----DKGVKMIAANKQKF-SKIQSQI--RITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QA-VPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSK--PV-------------EISNNQKTNN--------DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  G ++DIG++ +T++ L+ + KT  A   Q FP E++  ++V+DNCSLM+LN   LLNNI+IRY ++ IYT+VANILIA+NPY +IPKL+S E+I  Y+G+S+GTLPPHVYAIAD+AYRDM++ K++QSIIVSGESGAGKTE TK++L+YLT  YG     I++RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  + V GGFVSHYLLEKSRIC QS  ERNYHIFYR+CAG S+  R    L SPD++ YL  G TRYF  K+   ++  + KS E  K+G L D  L+D+ DF     AMK +G+ D E   +F +VA +LHLGNI+FEE  ++ GGC + + S  +L+ C  LLG    +L  SL  R+      GA+ T +++ LK E A NARDALAKA+YSRLFD +V  +N+  PF  S+N++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY++EGLG+ ++ +VDNQDCIDLVE K  G++DILDEE++LP+P+++HF  A+   + +HFRL +PRKSKL  HR+LRD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F +++ ++   +    +K    GKLSF+SV  KF++QL +L++ LR++ ++FIRC+KPN+ MV+  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YK+ +P+ L  LD RLFCK LFKA+GL E+D+KFG+T+VFFRPGK AEFDQ+++SDP+++  +V +V KWL+  RW+K Q+  L VIKL+NK+ +R    I+IQKT+RMW+ R++   ++  + K++NL   +E+       LK+      K ++ +AA+     +KI++ +  R     +  G+++  +         ++S+QK+ + ++   E E+L+ IQEEM   +++ E+E+ L KQ EE++R+K EME  RK+EEE+ K+        QA +   L +   EET+   ++   EQERRD+ELA+RIA+ ++ ++++ ++  P+             E+    + N         D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T      S ++   Q      P  + EI+    QRYF +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ L+
Sbjct:    7 VWAPHPTDGFQLGMIVDIGADALTIEPLHQRGKTFLAPISQVFPAEDDVNKHVEDNCSLMYLNEATLLNNIRIRYSKDMIYTFVANILIAVNPYFDIPKLYSPESIKSYQGRSLGTLPPHVYAIADKAYRDMRVLKMSQSIIVSGESGAGKTENTKFVLRYLTTSYGT-GQDIDERIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKNAVVGGFVSHYLLEKSRICMQSQEERNYHIFYRLCAGASEDIRNMLHLNSPDSFRYLNRGCTRYFANKDSDKQIMQNRKSPEHGKVGALKDPLLDDLGDFNRMVVAMKKIGLDDTEKLNLFRVVAGVLHLGNIDFEETGSTSGGCILKNQSSQTLEYCADLLGLDQDDLRVSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARDALAKAVYSRLFDHVVKRVNQCFPFDTSSNFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQREGLGVNEVHYVDNQDCIDLVEAKLVGVLDILDEENRLPQPSDQHFAEAVHSKHKDHFRLTVPRKSKLTIHRNLRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLVCESK-----DKFVRDLFENNSNSKDSKQKA---GKLSFISVGNKFKTQLNLLLEKLRSTGSSFIRCVKPNLKMVSHQFEGAQILSQLQCSGMVSVLDLMQGGFPSRAPFHELYNMYKQYMPNKLTRLDPRLFCKALFKALGLNENDYKFGLTRVFFRPGKFAEFDQIMKSDPDHLAELVKRVNKWLVCSRWKKVQWCTLSVIKLRNKMSYRASACIRIQKTVRMWLCRRRHKPRVDGLVKVKNLRKRMERFNEAVNGLKEGKAEMSKQIEELAASTDALMAKIKTTVMSRKEIEQEYEGLVKRSEQL-------LSSMQKKKQEQE---ETERLKHIQEEMEKERKRHEEEEQLRKQEEEDRRMKSEMEQKRKQEEEERKKREEEERVLQAELEMQLALDREEETQ---RQTILEQERRDRELAMRIAQNEAELIQDEAQMDPILRRDATTGVWFFTEMGAQVQANKVAAGVKKYDLSKWKYAELRDAINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTDTEMRAPKSVTDYAQQNPAPPVPARQQEIAMNRQQRYFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKQPILLVAGKDDMEMCELSLEETGLTRKRGAEILPRQFEEIWERCGGIQYLK 1242          
BLAST of Myosin vs. Ensembl Zebrafish
Match: myo6b (myosin VIb [Source:ZFIN;Acc:ZDB-GENE-030318-3])

HSP 1 Score: 1117.45 bits (2889), Expect = 0.000e+0
Identity = 609/1249 (48.76%), Postives = 855/1249 (68.45%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAE---FLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKS----DKGVKMIAANKQKF-SKIQSQI--RITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QA-VPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEE-------LSKPVEISNNQKTNN----DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  G ++DIG++ +T++ L+ + KT  A   Q FP E++  ++V+DNCSLM+LN   LLNNI+IRY ++ IYT+VANILIA+NPY +IPKL+S E+I  Y+G+S+GTLPPHVYAIAD+AYRDM++ K++QSIIVSGESGAGKTE TK++L+YLT  YG     I++RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  + V GGFVSHYLLEKSRIC QS  ERNYHIFYR+CAG S+  R    L SPD++ YL  G TRYF  K+   ++  + KS E     K+G L D  L+D+ DF     AMK +G+ D E   +F +VA +LHLGNI+FEE  ++ GGC + + S  +L+ C  LLG    +L  SL  R+      GA+ T +++ LK E A NARDALAKA+YSRLFD +V  +N+  PF  S+N++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY++EGLG+ ++ +VDNQDCIDLVE K  G++DILDEE++LP+P+++HF  A+   + +HFRL +PRKSKL  HR+LRD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F +++ ++   +    +K    GKLSF+SV  KF++QL +L++ LR++ ++FIRC+KPN+ MV+  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YK+ +P+ L  LD RLFCK LFKA+GL E+D+KFG+T+VFFRPGK AEFDQ+++SDP+++  +V +V KWL+  RW+K Q+  L VIKL+NK+ +R    I+IQKT+RMW+ R++   ++  + K++NL   +E+       LK+      K ++ +AA+     +KI++ +  R     +  G+++  +         ++S+QK+ + ++   E E+L+ IQEEM   +++ E+E+ L KQ EE++R+K EME  RK+EEE+ K+        QA +   L +   EET+   ++   EQERRD+ELA+RIA+ ++ ++++       L +  ++  N+        D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T      S ++   Q      P  + EI+    QRYF +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ L+
Sbjct:    7 VWAPHPTDGFQLGMIVDIGADALTIEPLHQRGKTFLAPISQVFPAEDDVNKHVEDNCSLMYLNEATLLNNIRIRYSKDMIYTFVANILIAVNPYFDIPKLYSPESIKSYQGRSLGTLPPHVYAIADKAYRDMRVLKMSQSIIVSGESGAGKTENTKFVLRYLTTSYGT-GQDIDERIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKNAVVGGFVSHYLLEKSRICMQSQEERNYHIFYRLCAGASEDIRNMLHLNSPDSFRYLNRGCTRYFANKDSDKQIMQNRKSPEDHKHGKVGALKDPLLDDLGDFNRMVVAMKKIGLDDTEKLNLFRVVAGVLHLGNIDFEETGSTSGGCILKNQSSQTLEYCADLLGLDQDDLRVSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARDALAKAVYSRLFDHVVKRVNQCFPFDTSSNFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQREGLGVNEVHYVDNQDCIDLVEAKLVGVLDILDEENRLPQPSDQHFAEAVHSKHKDHFRLTVPRKSKLTIHRNLRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLVCESK-----DKFVRDLFENNSNSKDSKQKA---GKLSFISVGNKFKTQLNLLLEKLRSTGSSFIRCVKPNLKMVSHQFEGAQILSQLQCSGMVSVLDLMQGGFPSRAPFHELYNMYKQYMPNKLTRLDPRLFCKALFKALGLNENDYKFGLTRVFFRPGKFAEFDQIMKSDPDHLAELVKRVNKWLVCSRWKKVQWCTLSVIKLRNKMSYRASACIRIQKTVRMWLCRRRHKPRVDGLVKVKNLRKRMERFNEAVNGLKEGKAEMSKQIEELAASTDALMAKIKTTVMSRKEIEQEYEGLVKRSEQL-------LSSMQKKKQEQE---ETERLKHIQEEMEKERKRHEEEEQLRKQEEEDRRMKSEMEQKRKQEEEERKKREEEERVLQAELEMQLALDREEETQ---RQTILEQERRDRELAMRIAQNEAELIQDEAQMDPILRRGAQVQANKVAAGVKKYDLSKWKYAELRDAINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTDTEMRAPKSVTDYAQQNPAPPVPARQQEIAMNRQQRYFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKQPILLVAGKDDMEMCELSLEETGLTRKRGAEILPRQFEEIWERCGGIQYLK 1233          
BLAST of Myosin vs. Ensembl Xenopus
Match: MYO6 (myosin VI [Source:NCBI gene;Acc:493193])

HSP 1 Score: 1104.74 bits (2856), Expect = 0.000e+0
Identity = 620/1283 (48.32%), Postives = 851/1283 (66.33%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNL-----------NILLEKLTLIAAQLKKSDKGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEE------------------------LSKPVEISNNQKT----NNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEK---------KNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQRLNNQISS 3691
            VWAP P +G+  G ++DIG +++T++ LN + KT  A  +Q FP EE+  ++V+DNCSLM+LN   LL+NI++RY ++ IYTYVANILIA+NPY ++PKL++ E I +Y GKS+GTLPPHVYAIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG+    I++RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  + V GGFVSHYLLEKSRIC Q  +ERNYHIFYR+CAG  +  R+K  L SPD + YL  G TRYF +K+   ++  + KS E+LK G L D  L+D  DF     AMK +G+ D E  ++F +VA +LHLGNI+FEE  ++ GGC +   S  SLQ C +LLG    +L  SL +R+      G + T +++ LK + A NARDALAKAIYS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P ++HFT A+ Q + NHFRL +PRKSKL  HR++RD EGF++RHFAGAVCY T +F+EKNNDALH SL++L+  S        F +E+ +S      + +K    GKLSF+SV  KF++QL +L++ LR++ ++FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YKK +P+ ++ LD RLFCK LFKA+GL E+D+KFG+TKVFFRPGK AEFDQ+++SDP+++  ++ +V  WLI  RW+K Q+  L VIKLKNKI++R    IK+QKT+RMW+ RKK   +I  M K++ L           N L E    ++ Q+K  +  +  + +  +     + QI     N +    Q+++S Q                +K   E E+L  IQEEM   +++ E E+ L ++ E E+R+K E+EA RK+EEE+ K+        QA  +  + ++ EE     Q+   EQERRD+ELA+RIA+ ++ ++ E                        LS+  ++   +       +D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++         K++T        + S  Q   V+ P  + EI     QRYF +PF   + +        +G W AHFDG +IARQ+E+H  K   +LVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI   Q L+N I S
Sbjct:    7 VWAPHPTDGFQLGKIVDIGPDSLTIEPLNQKGKTFLAPINQVFPAEEDTSKHVEDNCSLMYLNEATLLHNIQVRYSKDKIYTYVANILIAVNPYFDVPKLYTSEQIKQYHGKSLGTLPPHVYAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGS-GQDIDERIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKNSVVGGFVSHYLLEKSRICVQGQDERNYHIFYRLCAGAPEDIRQKLFLCSPDTFRYLNRGCTRYFASKDTDKQILQNRKSPEYLKHGALKDPLLDDHGDFNRMCIAMKKIGLDDTEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCTLRKKSSESLQCCAKLLGLDQDDLQVSLTSRVMLTTAGGTKGTVIKVPLKVQQAENARDALAKAIYSHLFDHVVNRVNQCFPFERSSFFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPTDQHFTSAVHQKHKNHFRLTIPRKSKLAVHRNIRDDEGFIVRHFAGAVCYETTQFVEKNNDALHMSLESLICESK-----DKFVRELFESANNHKDLKQK---TGKLSFISVGNKFKTQLNLLLEKLRSTGSSFIRCIKPNLKMTSHQFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPAKMSRLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELIRRVNHWLICSRWKKVQWCALCVIKLKNKIQYRASACIKMQKTIRMWLCRKKHKPRIDGMVKVQTLKKRLDKFNEVVNALKEGKAEMSKQVKDLELSIDALLSKIKNTIMTREQIEREYDNLVKSSGQLLNSLQK--------------RKKEEEEAERLHKIQEEMERERKRREAEEELRRKEENERRLKAEIEAKRKQEEEERKKREEEEKRIQAEVEMQLARDREEESQ--QQAILEQERRDRELAMRIAQSEAELINEDGPDSMYLLTFFCREEMAKEMTDILSRGGQVQATKSAASVKKHDLSKWKYAELRDAINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNADTEQRAPKSVTDYDFAPFMNNSPQQNPVVQLPARQQEIEMNRQQRYFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKPPIMLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGI---QYLSNAIES 1261          
BLAST of Myosin vs. Ensembl Xenopus
Match: MYO6 (myosin VI [Source:NCBI gene;Acc:493193])

HSP 1 Score: 970.304 bits (2507), Expect = 0.000e+0
Identity = 487/865 (56.30%), Postives = 645/865 (74.57%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKS 2620
            VWAP P +G+  G ++DIG +++T++ LN + KT  A  +Q FP EE+  ++V+DNCSLM+LN   LL+NI++RY ++ IYTYVANILIA+NPY ++PKL++ E I +Y GKS+GTLPPHVYAIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG+    I++RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  + V GGFVSHYLLEKSRIC Q  +ERNYHIFYR+CAG  +  R+K  L SPD + YL  G TRYF +K+   ++  + KS E+LK G L D  L+D  DF     AMK +G+ D E  ++F +VA +LHLGNI+FEE  ++ GGC +   S  SLQ C +LLG    +L  SL +R+      G + T +++ LK + A NARDALAKAIYS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P ++HFT A+ Q + NHFRL +PRKSKL  HR++RD EGF++RHFAGAVCY T +F+EKNNDALH SL++L+  S        F +E+ +S      + +K    GKLSF+SV  KF++QL +L++ LR++ ++FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YKK +P+ ++ LD RLFCK LFKA+GL E+D+KFG+TKVFFRPGK AEFDQ+++SDP+++  ++ +V  WLI  RW+K Q+  L VIKLKNKI++R    IK+QKT+RMW+ RKK   +I  M K++ L   L+K   +   LK+ 
Sbjct:    7 VWAPHPTDGFQLGKIVDIGPDSLTIEPLNQKGKTFLAPINQVFPAEEDTSKHVEDNCSLMYLNEATLLHNIQVRYSKDKIYTYVANILIAVNPYFDVPKLYTSEQIKQYHGKSLGTLPPHVYAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGS-GQDIDERIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKNSVVGGFVSHYLLEKSRICVQGQDERNYHIFYRLCAGAPEDIRQKLFLCSPDTFRYLNRGCTRYFASKDTDKQILQNRKSPEYLKHGALKDPLLDDHGDFNRMCIAMKKIGLDDTEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCTLRKKSSESLQCCAKLLGLDQDDLQVSLTSRVMLTTAGGTKGTVIKVPLKVQQAENARDALAKAIYSHLFDHVVNRVNQCFPFERSSFFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPTDQHFTSAVHQKHKNHFRLTIPRKSKLAVHRNIRDDEGFIVRHFAGAVCYETTQFVEKNNDALHMSLESLICESK-----DKFVRELFESANNHKDLKQK---TGKLSFISVGNKFKTQLNLLLEKLRSTGSSFIRCIKPNLKMTSHQFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPAKMSRLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELIRRVNHWLICSRWKKVQWCALCVIKLKNKIQYRASACIKMQKTIRMWLCRKKHKPRIDGMVKVQTLKKRLDKFNEVVNALKEG 862          
BLAST of Myosin vs. Ensembl Xenopus
Match: MYO6 (myosin VI [Source:NCBI gene;Acc:493193])

HSP 1 Score: 970.304 bits (2507), Expect = 0.000e+0
Identity = 487/865 (56.30%), Postives = 645/865 (74.57%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKS 2620
            VWAP P +G+  G ++DIG +++T++ LN + KT  A  +Q FP EE+  ++V+DNCSLM+LN   LL+NI++RY ++ IYTYVANILIA+NPY ++PKL++ E I +Y GKS+GTLPPHVYAIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG+    I++RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  + V GGFVSHYLLEKSRIC Q  +ERNYHIFYR+CAG  +  R+K  L SPD + YL  G TRYF +K+   ++  + KS E+LK G L D  L+D  DF     AMK +G+ D E  ++F +VA +LHLGNI+FEE  ++ GGC +   S  SLQ C +LLG    +L  SL +R+      G + T +++ LK + A NARDALAKAIYS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P ++HFT A+ Q + NHFRL +PRKSKL  HR++RD EGF++RHFAGAVCY T +F+EKNNDALH SL++L+  S        F +E+ +S      + +K    GKLSF+SV  KF++QL +L++ LR++ ++FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YKK +P+ ++ LD RLFCK LFKA+GL E+D+KFG+TKVFFRPGK AEFDQ+++SDP+++  ++ +V  WLI  RW+K Q+  L VIKLKNKI++R    IK+QKT+RMW+ RKK   +I  M K++ L   L+K   +   LK+ 
Sbjct:    7 VWAPHPTDGFQLGKIVDIGPDSLTIEPLNQKGKTFLAPINQVFPAEEDTSKHVEDNCSLMYLNEATLLHNIQVRYSKDKIYTYVANILIAVNPYFDVPKLYTSEQIKQYHGKSLGTLPPHVYAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGS-GQDIDERIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKNSVVGGFVSHYLLEKSRICVQGQDERNYHIFYRLCAGAPEDIRQKLFLCSPDTFRYLNRGCTRYFASKDTDKQILQNRKSPEYLKHGALKDPLLDDHGDFNRMCIAMKKIGLDDTEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCTLRKKSSESLQCCAKLLGLDQDDLQVSLTSRVMLTTAGGTKGTVIKVPLKVQQAENARDALAKAIYSHLFDHVVNRVNQCFPFERSSFFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPTDQHFTSAVHQKHKNHFRLTIPRKSKLAVHRNIRDDEGFIVRHFAGAVCYETTQFVEKNNDALHMSLESLICESK-----DKFVRELFESANNHKDLKQK---TGKLSFISVGNKFKTQLNLLLEKLRSTGSSFIRCIKPNLKMTSHQFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPAKMSRLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELIRRVNHWLICSRWKKVQWCALCVIKLKNKIQYRASACIKMQKTIRMWLCRKKHKPRIDGMVKVQTLKKRLDKFNEVVNALKEG 862          
BLAST of Myosin vs. Ensembl Xenopus
Match: MYO6 (myosin VI [Source:NCBI gene;Acc:493193])

HSP 1 Score: 969.918 bits (2506), Expect = 0.000e+0
Identity = 487/865 (56.30%), Postives = 645/865 (74.57%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKS 2620
            VWAP P +G+  G ++DIG +++T++ LN + KT  A  +Q FP EE+  ++V+DNCSLM+LN   LL+NI++RY ++ IYTYVANILIA+NPY ++PKL++ E I +Y GKS+GTLPPHVYAIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG+    I++RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  + V GGFVSHYLLEKSRIC Q  +ERNYHIFYR+CAG  +  R+K  L SPD + YL  G TRYF +K+   ++  + KS E+LK G L D  L+D  DF     AMK +G+ D E  ++F +VA +LHLGNI+FEE  ++ GGC +   S  SLQ C +LLG    +L  SL +R+      G + T +++ LK + A NARDALAKAIYS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P ++HFT A+ Q + NHFRL +PRKSKL  HR++RD EGF++RHFAGAVCY T +F+EKNNDALH SL++L+  S        F +E+ +S      + +K    GKLSF+SV  KF++QL +L++ LR++ ++FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YKK +P+ ++ LD RLFCK LFKA+GL E+D+KFG+TKVFFRPGK AEFDQ+++SDP+++  ++ +V  WLI  RW+K Q+  L VIKLKNKI++R    IK+QKT+RMW+ RKK   +I  M K++ L   L+K   +   LK+ 
Sbjct:    7 VWAPHPTDGFQLGKIVDIGPDSLTIEPLNQKGKTFLAPINQVFPAEEDTSKHVEDNCSLMYLNEATLLHNIQVRYSKDKIYTYVANILIAVNPYFDVPKLYTSEQIKQYHGKSLGTLPPHVYAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGS-GQDIDERIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKNSVVGGFVSHYLLEKSRICVQGQDERNYHIFYRLCAGAPEDIRQKLFLCSPDTFRYLNRGCTRYFASKDTDKQILQNRKSPEYLKHGALKDPLLDDHGDFNRMCIAMKKIGLDDTEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCTLRKKSSESLQCCAKLLGLDQDDLQVSLTSRVMLTTAGGTKGTVIKVPLKVQQAENARDALAKAIYSHLFDHVVNRVNQCFPFERSSFFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPTDQHFTSAVHQKHKNHFRLTIPRKSKLAVHRNIRDDEGFIVRHFAGAVCYETTQFVEKNNDALHMSLESLICESK-----DKFVRELFESANNHKDLKQK---TGKLSFISVGNKFKTQLNLLLEKLRSTGSSFIRCIKPNLKMTSHQFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPAKMSRLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELIRRVNHWLICSRWKKVQWCALCVIKLKNKIQYRASACIKMQKTIRMWLCRKKHKPRIDGMVKVQTLKKRLDKFNEVVNALKEG 862          

HSP 2 Score: 176.407 bits (446), Expect = 5.279e-44
Identity = 97/242 (40.08%), Postives = 136/242 (56.20%), Query Frame = 2
Query: 3035 EQERRDKELALRIAEGDSTILEE----------LSKPVEISNNQKTN-------NDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQRLNNQISS 3691
            EQERRD+ELA+RIA+ ++ ++ E          L    E    Q T        +D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T      S ++   Q   V+ P  + EI     QRYF +PF   + +        +G W AHFDG +IARQ+E+H  K   +LVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI   Q L+N I S
Sbjct:  973 EQERRDRELAMRIAQSEAELINEDGPDSALRSGLPHSSEGGQVQATKSAASVKKHDLSKWKYAELRDAINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNADTEQRAPKSVTDYAQQNPVVQLPARQQEIEMNRQQRYFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKPPIMLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGI---QYLSNAIES 1211          
BLAST of Myosin vs. Ensembl Xenopus
Match: MYO6 (myosin VI [Source:NCBI gene;Acc:493193])

HSP 1 Score: 969.533 bits (2505), Expect = 0.000e+0
Identity = 487/865 (56.30%), Postives = 645/865 (74.57%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKS 2620
            VWAP P +G+  G ++DIG +++T++ LN + KT  A  +Q FP EE+  ++V+DNCSLM+LN   LL+NI++RY ++ IYTYVANILIA+NPY ++PKL++ E I +Y GKS+GTLPPHVYAIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG+    I++RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  + V GGFVSHYLLEKSRIC Q  +ERNYHIFYR+CAG  +  R+K  L SPD + YL  G TRYF +K+   ++  + KS E+LK G L D  L+D  DF     AMK +G+ D E  ++F +VA +LHLGNI+FEE  ++ GGC +   S  SLQ C +LLG    +L  SL +R+      G + T +++ LK + A NARDALAKAIYS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P ++HFT A+ Q + NHFRL +PRKSKL  HR++RD EGF++RHFAGAVCY T +F+EKNNDALH SL++L+  S        F +E+ +S      + +K    GKLSF+SV  KF++QL +L++ LR++ ++FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YKK +P+ ++ LD RLFCK LFKA+GL E+D+KFG+TKVFFRPGK AEFDQ+++SDP+++  ++ +V  WLI  RW+K Q+  L VIKLKNKI++R    IK+QKT+RMW+ RKK   +I  M K++ L   L+K   +   LK+ 
Sbjct:    7 VWAPHPTDGFQLGKIVDIGPDSLTIEPLNQKGKTFLAPINQVFPAEEDTSKHVEDNCSLMYLNEATLLHNIQVRYSKDKIYTYVANILIAVNPYFDVPKLYTSEQIKQYHGKSLGTLPPHVYAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGS-GQDIDERIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKNSVVGGFVSHYLLEKSRICVQGQDERNYHIFYRLCAGAPEDIRQKLFLCSPDTFRYLNRGCTRYFASKDTDKQILQNRKSPEYLKHGALKDPLLDDHGDFNRMCIAMKKIGLDDTEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCTLRKKSSESLQCCAKLLGLDQDDLQVSLTSRVMLTTAGGTKGTVIKVPLKVQQAENARDALAKAIYSHLFDHVVNRVNQCFPFERSSFFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPTDQHFTSAVHQKHKNHFRLTIPRKSKLAVHRNIRDDEGFIVRHFAGAVCYETTQFVEKNNDALHMSLESLICESK-----DKFVRELFESANNHKDLKQK---TGKLSFISVGNKFKTQLNLLLEKLRSTGSSFIRCIKPNLKMTSHQFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPAKMSRLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELIRRVNHWLICSRWKKVQWCALCVIKLKNKIQYRASACIKMQKTIRMWLCRKKHKPRIDGMVKVQTLKKRLDKFNEVVNALKEG 862          

HSP 2 Score: 174.096 bits (440), Expect = 2.792e-43
Identity = 94/240 (39.17%), Postives = 138/240 (57.50%), Query Frame = 2
Query: 3035 EQERRDKELALRIAEGDSTILEE------LSKPVEISNNQKT----NNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNP-----EPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQRLNNQISS 3691
            EQERRD+ELA+RIA+ ++ ++ E      L +  ++   +       +D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T      S ++    L+  +NP       + EI     QRYF +PF   + +        +G W AHFDG +IARQ+E+H  K   +LVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI   Q L+N I S
Sbjct:  973 EQERRDRELAMRIAQSEAELINEDGPDSALRRGGQVQATKSAASVKKHDLSKWKYAELRDAINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNADTEQRAPKSVTDYGKPLKSQQNPVVQLPARQQEIEMNRQQRYFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKPPIMLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGI---QYLSNAIES 1209          
BLAST of Myosin vs. Ensembl Mouse
Match: Myo6 (myosin VI [Source:MGI Symbol;Acc:MGI:104785])

HSP 1 Score: 1124 bits (2906), Expect = 0.000e+0
Identity = 617/1242 (49.68%), Postives = 847/1242 (68.20%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANKQ-KFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVD---INSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEE-------LSKPVEISNNQKT----NNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  GN++DIG +++T++ LN + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+N+K+RY ++ IYTYVANILIA+NPY +IPK++S +TI  Y+GKS+GT+PPHV+AIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG     I+ RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  S V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG S+  REK  L SPDN+ YL  G TR+F  K    ++  + KS E++K G+L D  L+D  DF     AMK +G+ D+E  ++F +VA +LHLGNI+FEE  ++ GGC + + S  SL+ C  LLG    +L  SL  R+      G + T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P+++HFT  + Q + +HFRL +PRKSKL  HR+LRD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F + + +S    +   K+    GKLSF+SV  KF++QL +L+D LR++  +FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YKK +P  LA LD RLFCK LFKA+GL E D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V  WL+  RW+K Q+  L VIKLKNKIK+R +  IK+QKT+RMW+ +++   +I  + K+  L   L+K   + + LK     V     N +     + ++I+ T    M    QI   + + +      +++LQK+ + E+   E E+LR IQEEM   +++ E+++   ++ EEE+R+KLEMEA RK+EEE+ K+        QA  ++ + ++ EE     Q+    QE RD+ELALRIA+ +S ++ +       L +   +   +       +D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T      S ++   Q    + P  + EI     QR+F +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    7 VWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNVKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSDTIKSYQGKSLGTMPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGT-GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRFFANKETDKQILQNRKSPEYVKAGSLKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSAPSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEVKLVGILDILDEENRLPQPSDQHFTSVVHQKHKDHFRLTIPRKSKLAVHRNLRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESR-----DKFIRALFESSTNNNKDTKQ--KAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPEKLARLDPRLFCKALFKALGLNEVDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNLWLVCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSALKDGKPEVNRQIKNLEISIDALMAKIKST----MMTREQIQKEYDALVKSSEDLLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEDEERRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQREEESQ--QQAVLAQECRDRELALRIAQNESELISDEAQGDMALRRGPAVQATKAAAGTKKHDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYAQQNPAAQLPARQQEIDMKRQQRFFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1231          
BLAST of Myosin vs. Ensembl Mouse
Match: Myo6 (myosin VI [Source:MGI Symbol;Acc:MGI:104785])

HSP 1 Score: 1121.69 bits (2900), Expect = 0.000e+0
Identity = 618/1255 (49.24%), Postives = 848/1255 (67.57%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANKQ-KFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVD---INSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEE--------------------LSKPVEISNNQKT----NNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  GN++DIG +++T++ LN + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+N+K+RY ++ IYTYVANILIA+NPY +IPK++S +TI  Y+GKS+GT+PPHV+AIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG     I+ RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  S V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG S+  REK  L SPDN+ YL  G TR+F  K    ++  + KS E++K G+L D  L+D  DF     AMK +G+ D+E  ++F +VA +LHLGNI+FEE  ++ GGC + + S  SL+ C  LLG    +L  SL  R+      G + T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P+++HFT  + Q + +HFRL +PRKSKL  HR+LRD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F + + +S    +   K+    GKLSF+SV  KF++QL +L+D LR++  +FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YKK +P  LA LD RLFCK LFKA+GL E D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V  WL+  RW+K Q+  L VIKLKNKIK+R +  IK+QKT+RMW+ +++   +I  + K+  L   L+K   + + LK     V     N +     + ++I+ T    M    QI   + + +      +++LQK+ + E+   E E+LR IQEEM   +++ E+++   ++ EEE+R+KLEMEA RK+EEE+ K+        QA  ++ + ++ EE     Q+    QE RD+ELALRIA+ +S ++ +                    LS+   +   +       +D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T      S ++   Q    + P  + EI     QR+F +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    7 VWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNVKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSDTIKSYQGKSLGTMPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGT-GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRFFANKETDKQILQNRKSPEYVKAGSLKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSAPSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEVKLVGILDILDEENRLPQPSDQHFTSVVHQKHKDHFRLTIPRKSKLAVHRNLRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESR-----DKFIRALFESSTNNNKDTKQ--KAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPEKLARLDPRLFCKALFKALGLNEVDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNLWLVCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSALKDGKPEVNRQIKNLEISIDALMAKIKST----MMTREQIQKEYDALVKSSEDLLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEDEERRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQREEESQ--QQAVLAQECRDRELALRIAQNESELISDEAQGDMALRREQMAKEMSEILSRGPAVQATKAAAGTKKHDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYAQQNPAAQLPARQQEIDMKRQQRFFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1244          
BLAST of Myosin vs. Ensembl Mouse
Match: Myo6 (myosin VI [Source:MGI Symbol;Acc:MGI:104785])

HSP 1 Score: 1117.84 bits (2890), Expect = 0.000e+0
Identity = 618/1251 (49.40%), Postives = 849/1251 (67.87%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANKQ-KFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVD---INSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEE-------LSKPVEISNNQKT----NNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEK---------KNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  GN++DIG +++T++ LN + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+N+K+RY ++ IYTYVANILIA+NPY +IPK++S +TI  Y+GKS+GT+PPHV+AIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG     I+ RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  S V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG S+  REK  L SPDN+ YL  G TR+F  K    ++  + KS E++K G+L D  L+D  DF     AMK +G+ D+E  ++F +VA +LHLGNI+FEE  ++ GGC + + S  SL+ C  LLG    +L  SL  R+      G + T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P+++HFT  + Q + +HFRL +PRKSKL  HR+LRD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F + + +S    +   K+    GKLSF+SV  KF++QL +L+D LR++  +FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YKK +P  LA LD RLFCK LFKA+GL E D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V  WL+  RW+K Q+  L VIKLKNKIK+R +  IK+QKT+RMW+ +++   +I  + K+  L   L+K   + + LK     V     N +     + ++I+ T    M    QI   + + +      +++LQK+ + E+   E E+LR IQEEM   +++ E+++   ++ EEE+R+KLEMEA RK+EEE+ K+        QA  ++ + ++ EE     Q+    QE RD+ELALRIA+ +S ++ +       L +   +   +       +D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++         K++T        + S  Q    + P  + EI     QR+F +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    7 VWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNVKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSDTIKSYQGKSLGTMPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGT-GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRFFANKETDKQILQNRKSPEYVKAGSLKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSAPSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEVKLVGILDILDEENRLPQPSDQHFTSVVHQKHKDHFRLTIPRKSKLAVHRNLRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESR-----DKFIRALFESSTNNNKDTKQ--KAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPEKLARLDPRLFCKALFKALGLNEVDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNLWLVCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSALKDGKPEVNRQIKNLEISIDALMAKIKST----MMTREQIQKEYDALVKSSEDLLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEDEERRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQREEESQ--QQAVLAQECRDRELALRIAQNESELISDEAQGDMALRRGPAVQATKAAAGTKKHDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYDFAPFLNNSPQQNPAAQLPARQQEIDMKRQQRFFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1240          
BLAST of Myosin vs. Ensembl Mouse
Match: Myo6 (myosin VI [Source:MGI Symbol;Acc:MGI:104785])

HSP 1 Score: 1113.6 bits (2879), Expect = 0.000e+0
Identity = 622/1273 (48.86%), Postives = 848/1273 (66.61%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANKQ-KFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVD---INSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTI----------LEELSKPVEISNNQKTN-----------------------NDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEK---------KNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  GN++DIG +++T++ LN + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+N+K+RY ++ IYTYVANILIA+NPY +IPK++S +TI  Y+GKS+GT+PPHV+AIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG     I+ RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  S V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG S+  REK  L SPDN+ YL  G TR+F  K    ++  + KS E++K G+L D  L+D  DF     AMK +G+ D+E  ++F +VA +LHLGNI+FEE  ++ GGC + + S  SL+ C  LLG    +L  SL  R+      G + T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P+++HFT  + Q + +HFRL +PRKSKL  HR+LRD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F + + +S    +   K+    GKLSF+SV  KF++QL +L+D LR++  +FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YKK +P  LA LD RLFCK LFKA+GL E D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V  WL+  RW+K Q+  L VIKLKNKIK+R +  IK+QKT+RMW+ +++   +I  + K+  L   L+K   + + LK     V     N +     + ++I+ T    M    QI   + + +      +++LQK+ + E+   E E+LR IQEEM   +++ E+++   ++ EEE+R+KLEMEA RK+EEE+ K+        QA  ++ + ++ EE     Q+    QE RD+ELALRIA+ +S +          L  LS     S  Q                          +D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++         K++T        + S  Q    + P  + EI     QR+F +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    7 VWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNVKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSDTIKSYQGKSLGTMPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGT-GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRFFANKETDKQILQNRKSPEYVKAGSLKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSAPSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEVKLVGILDILDEENRLPQPSDQHFTSVVHQKHKDHFRLTIPRKSKLAVHRNLRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESR-----DKFIRALFESSTNNNKDTKQK--AGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPEKLARLDPRLFCKALFKALGLNEVDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNLWLVCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSALKDGKPEVNRQIKNLEISIDALMAKIKST----MMTREQIQKEYDALVKSSEDLLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEDEERRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQREEESQ--QQAVLAQECRDRELALRIAQNESELISDEAQGDMALRSLSSCPATSKEQMAKEMSEILSRGPAVQATKAAAGTKKHDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYDFAPFLNNSPQQNPAAQLPARQQEIDMKRQQRFFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1262          
BLAST of Myosin vs. Ensembl Mouse
Match: Myo6 (myosin VI [Source:MGI Symbol;Acc:MGI:104785])

HSP 1 Score: 1111.29 bits (2873), Expect = 0.000e+0
Identity = 619/1274 (48.59%), Postives = 850/1274 (66.72%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANKQ-KFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVD---INSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEE------------------------------LSKPVEISNNQKT----NNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEK---------KNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  GN++DIG +++T++ LN + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+N+K+RY ++ IYTYVANILIA+NPY +IPK++S +TI  Y+GKS+GT+PPHV+AIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG     I+ RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  S V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG S+  REK  L SPDN+ YL  G TR+F  K    ++  + KS E++K G+L D  L+D  DF     AMK +G+ D+E  ++F +VA +LHLGNI+FEE  ++ GGC + + S  SL+ C  LLG    +L  SL  R+      G + T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P+++HFT  + Q + +HFRL +PRKSKL  HR+LRD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F + + +S    +   K+    GKLSF+SV  KF++QL +L+D LR++  +FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YKK +P  LA LD RLFCK LFKA+GL E D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V  WL+  RW+K Q+  L VIKLKNKIK+R +  IK+QKT+RMW+ +++   +I  + K+  L   L+K   + + LK     V     N +     + ++I+ T    M    QI   + + +      +++LQK+ + E+   E E+LR IQEEM   +++ E+++   ++ EEE+R+KLEMEA RK+EEE+ K+        QA  ++ + ++ EE     Q+    QE RD+ELALRIA+ +S ++ +                              LS+   +   +       +D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++         K++T        + S  Q    + P  + EI     QR+F +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    7 VWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNVKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSDTIKSYQGKSLGTMPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGT-GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRFFANKETDKQILQNRKSPEYVKAGSLKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSAPSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEVKLVGILDILDEENRLPQPSDQHFTSVVHQKHKDHFRLTIPRKSKLAVHRNLRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESR-----DKFIRALFESSTNNNKDTKQK--AGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPEKLARLDPRLFCKALFKALGLNEVDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNLWLVCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSALKDGKPEVNRQIKNLEISIDALMAKIKST----MMTREQIQKEYDALVKSSEDLLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEDEERRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQREEESQ--QQAVLAQECRDRELALRIAQNESELISDEAQGDMALRRTNGTRPQMTPEQMAKEMSEILSRGPAVQATKAAAGTKKHDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYDFAPFLNNSPQQNPAAQLPARQQEIDMKRQQRFFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1263          
BLAST of Myosin vs. UniProt/SwissProt
Match: sp|Q29122|MYO6_PIG (Unconventional myosin-VI OS=Sus scrofa OX=9823 GN=MYO6 PE=1 SV=1)

HSP 1 Score: 1132.86 bits (2929), Expect = 0.000e+0
Identity = 622/1249 (49.80%), Postives = 847/1249 (67.81%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEV-NTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQII----------DSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSK--------PVEISNNQKTNN---DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  GN++DIG +++T++ LN + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+NIK+RY ++ IYTYVANILIA+NPY +IPK++S ETI  Y+GKS+GT+PPHV+AIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG     I+ RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  S V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG S+  RE+  L SPDN+ YL  G TRYF  K    ++  + KS E+LK G+L D  L+D  DF     AMK +G+ D+E  ++F +VA +LHLGNI+FEE  +TS G    + S+Q+      +LLG    +L  SL  R+      GA+ T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E +  GI+DILDEE++LP+P+++HFT A  Q + +HFRL +PRKSKL  HR++   EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F +E+ +S    +   K+    GKLSF+SV  KF++QL +L+D LR++  +FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F ++YN+YKK LP  LA LD RLFCK LFKA+GL E D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V  WLI  RW+K Q+  L VIKLKNKIK+R +  IK+QKT+RMW+ +++   +I  + K+  L   L+K   + + LK            KQ+ SK    + I+    MA +   +          D+      V +++LQK+ + E+   E E+LR IQEEM   +++ E+++   ++ EEE+R+KLEMEA RK+EEE+ K+        QA  ++ + ++ EE     Q+   EQERRD+ELALRIA+ ++ ++ + ++        P   +          D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T      S ++   Q   V+ P  + EI     QR+F +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    7 VWAPHPTDGFQVGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSETIKSYQGKSLGTMPPHVFAIADKAFRDMKVLKLSQSIIVSGESGAGKTENTKFVLRYLTESYGT-GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSTQALEYCAEKLLGLDQDDLRVSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEARLVGILDILDEENRLPQPSDQHFTSAGHQKHKDHFRLSIPRKSKLAIHRNIAYDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESR-----DKFIRELFESSTNNNKDTKQ--KAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHEVYNMYKKSLPDKLARLDPRLFCKALFKALGLNEIDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLICSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSALKDG----------KQEMSKQVKDLEISIDALMAKIKSTMMTREQIQKEYDALVKSSAVLLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEDEQRRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQREEESQ--QQAVLEQERRDRELALRIAQSEAELISDEAQADPGLRRGPAVQATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYAQQNPAVQLPARQQEIEMNRQQRFFRIPFIRSADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1232          
BLAST of Myosin vs. UniProt/SwissProt
Match: sp|E1BPK6|MYO6_BOVIN (Unconventional myosin-VI OS=Bos taurus OX=9913 GN=MYO6 PE=1 SV=4)

HSP 1 Score: 1119.76 bits (2895), Expect = 0.000e+0
Identity = 624/1281 (48.71%), Postives = 855/1281 (66.74%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGV-KMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRI-----------AEGDSTILEELS-KPV--EISNNQKT------------------------------NNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEK---------KNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P EG+  GN++DIG +++T++ L  + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+NIK+RY ++ IYTYVANILIA+NPY +IPK++S ++I  Y+GKS+GT+PPHV+AIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG+    I+ RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  S V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG S+  RE+  L SPDN+ YL  G TRYF  K    ++  + K+ E LK G+L D  L+D  DF     AMK +G+ D+E  ++F +VA +LHLGNI+FEE  ++ GGC + + S  SL+ C  LLG    +L  SL  R+      G + T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P+++HFT A+ Q + +HFRL +PRKSKL  HR++RD EGF++RHFAGAVCY T +F+EKNNDALH SL++L+  S        F +E+ +S    +   K+    GKLSF+SV  KF++QL +L+D LR++  +FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YKK +P  LA LD RLFCK LFKA+GL E D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V  WLI  RW+K Q+  L VIKLKNKIK+R +  IK+QKT+RMW+ +++   +I  + K+  L   L+K   + + LK     + K +   +     + ++I+ T   +   + +  D+      V +++LQK+ + E+   E E+LR IQEEM   +++ E+++   ++ EEE+R+KLEMEA RK+EEE+ K+        QA  ++ + ++ EE     Q+   EQERRD+ELALRI           A+ D   L  L   PV  +I+  ++T                               +D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++         K++T        + S  Q    + P  + EI     QR+F +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    7 VWAPHPTEGFQMGNIVDIGPDSLTIEPLGQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSDSIKSYQGKSLGTMPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGS-GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKTPEHLKAGSLKDPLLDDHGDFVRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSTQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLMGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLSIPRKSKLAVHRNIRDDEGFIVRHFAGAVCYETTQFVEKNNDALHMSLESLICESR-----DKFIRELFESSTNNNKDTKQ--KAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHDFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNEVDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAQLVKRVNHWLICSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSALKDGKAEMNKQVKDLEISIDALMAKIKSTMMTR-EQIQKEYDALVKSSEVLLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEDEQRRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQREEESQ--QQAVLEQERRDRELALRIARSEAELIIDEAQADPAALRSLDFHPVTSKINGTRRTMTPEQMAKEMSEILSRGPAVQATKAAAGTKKHDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYDFAPFLNNSPQQNPAAQLPARQQEIEMNRQQRFFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1273          
BLAST of Myosin vs. UniProt/SwissProt
Match: sp|Q9I8D1|MYO6_CHICK (Unconventional myosin-VI OS=Gallus gallus OX=9031 GN=MYO6 PE=1 SV=1)

HSP 1 Score: 1119.38 bits (2894), Expect = 0.000e+0
Identity = 620/1262 (49.13%), Postives = 847/1262 (67.12%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSD-KGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSK-----------PVEISNNQKTN-----------------------NDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  G ++DIG++ +T++ LN + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+NIK+RY ++ IYTYVANILIA+NPY +IPK +S + I KY+G+S+GTLPPHV+AIAD+AYRDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG     I+ RI E+NPLLEAFGN+KT+RNNNSSR+GKFVEIHF+  + V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG  +  REK  L SPD++ YL  G TRYF TK    ++  + KS E+LK G+L D  L+D  DF     AMK +G+ D E  ++F +VA +LHLGNI+FEE  ++ GGC + + SQ +L+ C  LLG    +L  SL  R+      GA+ T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++++VDNQDCIDL+E K  G++DILDEE++LP+P+++HFT  + Q + +HFRL +PRKSKL  HR++RD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S    + Q+F          T+         GKLSF+SV  KF++QL +L++ L ++ ++FIRCI PN+ M +  FEGG ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YKK LP  LA LD RLFCK LFKA+GL E D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V  WLI  RW+K Q+  L VIKLKNKIK+R    IKIQKT+RMW+ ++K   +I  + K+R L   L+K   + + LK+   +  K I   +       ++I+ T   +   +++  D+        +++LQK+ + E+   E E+LR IQEEM   +++ E+E+   ++ EEE+R+K E+EA RK+EEE+ K+        QA  ++ + +E EE   +   L  EQERRD+ELA+RIA+  + +  E +K            ++++  Q                          +D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T      S ++   Q    + P  + EI     QRYF +PF     +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    7 VWAPHPTDGFQMGMIVDIGTDYLTIEPLNQKGKTFQAAINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKFYSSDAIKKYQGRSLGTLPPHVFAIADKAYRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGT-GQDIDDRIVEANPLLEAFGNAKTIRNNNSSRFGKFVEIHFNEKNSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGAPEDIREKLYLSSPDSFRYLNRGCTRYFATKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFNRMCTAMKKIGLDDAEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCTLKAQSQPALECCAALLGLDEEDLRVSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSFFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVRYVDNQDCIDLIEAKLIGVLDILDEENRLPQPSDQHFTSVVHQKHKDHFRLSIPRKSKLAVHRNVRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESKDKFVRQLFESN-------TNNNKDPKQKAGKLSFISVGNKFKTQLNLLLEKLHSTGSSFIRCIFPNLKMTSHHFEGGQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYLPEKLARLDPRLFCKALFKALGLNEIDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLICSRWKKVQWCSLSVIKLKNKIKYRASACIKIQKTIRMWLCKRKHKPRIDGLIKVRTLKKRLDKFNEVVSALKEGKAETSKQIKELEYSIDASMTKIKTTMMTR-EQIMKEYDALVRSSEQLLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEEEKRRRKEEEERRLKSEIEAKRKQEEEERKKREEEEKRIQAEIEAQLAREREEETQHQAIL--EQERRDRELAMRIAQTGAELSTEETKLDVGLCRANGTKLQMTAEQMAKEMSEMLSRGPAVQATKAAAGAKKHDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNAETEQRAPKSVTDYAQQNPTAQLPMRQQEIEINRQQRYFRIPFIRPMDQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKAPILLVAGKDDMDMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1254          
BLAST of Myosin vs. UniProt/SwissProt
Match: sp|Q9UM54|MYO6_HUMAN (Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6 PE=1 SV=4)

HSP 1 Score: 1117.45 bits (2889), Expect = 0.000e+0
Identity = 627/1285 (48.79%), Postives = 854/1285 (66.46%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGV-KMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVD---INSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSKP----------VEISNNQKTNN---------------------------------DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPK-NEISQITV----------QRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP P +G+  GN++DIG +++T++ LN + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+NIK+RY ++ IYTYVANILIA+NPY +IPK++S E I  Y+GKS+GT PPHV+AIAD+A+RDMK+ K++QSIIVSGESGAGKTE TK++L+YLTE YG     I+ RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  S V GGFVSHYLLEKSRIC Q   ERNYHIFYR+CAG S+  REK  L SPDN+ YL  G TRYF  K    ++  + KS E+LK G++ D  L+D  DF     AMK +G+ D+E  ++F +VA +LHLGNI+FEE  ++ GGC + + S  SL+ C  LLG    +L  SL  R+      G + T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P+++HFT A+ Q + +HFRL +PRKSKL  HR++RD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F +E+ +S    +   K+    GKLSF+SV  KF++QL +L+D LR++  +FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ GYPSR  F +LYN+YKK +P  LA LD RLFCK LFKA+GL E+D+KFG+TKVFFRPGK AEFDQ+++SDP+++  +V +V  WL   RW+K Q+  L VIKLKNKIK+R +  IK+QKT+RMW+ +++   +I  + K+  L   L+K   + + LK     + K I   +     + ++I+ T    M    QI   + + +      +++LQK+ + E+   E E+LR IQEEM   +++ E+++   ++ EEE+R+KLEMEA RK+EEE+ K+        QA  ++ + ++ EE     Q+   EQERRD+ELALRIA+ ++ ++ + ++             +S N  T                                   D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T T  +   S +     P  N  P+ N  +QI            QR+F +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    7 VWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTESYGT-GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRYFANKETDKQILQNRKSPEYLKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNIDFEEAGSTSGGCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESR-----DKFIRELFESSTNNNKDTKQK--AGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDLMQGGYPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELVKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGLVKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKST----MMTQEQIQKEYDALVKSSEELLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKRIQAEVEAQLARQKEEESQ--QQAVLEQERRDRELALRIAQSEAELISDEAQADLALRRSLDSYPVSKNDGTRPKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRN--TETEQRAPKSVTDYDFAPFLNNSPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQYKDPQSKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1272          
BLAST of Myosin vs. UniProt/SwissProt
Match: sp|Q64331|MYO6_MOUSE (Unconventional myosin-VI OS=Mus musculus OX=10090 GN=Myo6 PE=1 SV=1)

HSP 1 Score: 1019.61 bits (2635), Expect = 0.000e+0
Identity = 590/1263 (46.71%), Postives = 823/1263 (65.16%), Query Frame = 2
Query:   17 EMNEVVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKS--LGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFA-GAVCYHTEEF-IEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINS-------LQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXX-------QAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEE-------LSKPVEISNNQKTN----NDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEK---------KNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            E  + VWAP P +G+  GN++DIG +++T++ LN + KT  A  +Q FP EE+ +++V+DNCSLM+LN   LL+N+K+RY ++ IYTYVANILIA+NPY +IPK++S +TI  Y+GKS+GT+PPHV+ IAD+A+RDMK+ K++QSIIVSGESGAGKTE TK+  +            I+ RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  S V GGFVSHYLLEKSRIC Q   ERN+HIFYR+CAG S+  REK  L SPDN+ YL  G TR+F  K    ++  + KS E++K G+L  S +     F    ++ +    G+  K+N ++F +VA +LHLGNI+ EE  ++ GGC + + S  SL+ C  LLG    +L  SL  R+      G + T +++ LK E A NARDALAK +YS LFD +V  +N+  PF+ S+ ++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCI+L+E K  GI+DILDEE++LP+P+++HFT  + Q + +HFRL +PRKSKL  HR+LRD EGF+IR    G V     ++   KNNDALH SL++L+  S        F + + +S    S   K+    GKLSF+SV  KF++QL +L+D LR++  +FIRCIKPN+ M +  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YKK +P  L  LD RLFCK LFKA+GL E D+KFG+T+VFFRPGK AEFDQ+++SDP+++  +V +V  WL+  RW+K Q+  L VIKLKNKIK+R +  IK+QK +RMW+ +++   +I  + K+  L   L+K   + + LK     V     N+Q    ++  I    + K    +   +  Q E    + S       LQK+ + E+   E E+LR IQEEM   +++ E+++   ++ EEE+R+KLEME  RK+EEE+ K+        Q+  ++ + ++ EE     Q+    QE RD+ELALRIA+ +S ++ +       L +   +   +  +    +D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++         K++T        + S  Q    + P  + EI     QR+F +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ LQ
Sbjct:    2 EDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFGALINQVFPAEEDSKKDVEDNCSLMYLNEATLLHNVKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSDTIKSYQGKSLGTMPPHVFGIADKAFRDMKVLKMSQSIIVSGESGAGKTENTKFGSKIPDRILWT-GQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNHHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTRFFANKETDKQILQNRKSPEYVKAGSLEGSSIRRPWRFYQDVHSHEKNWFGMM-KKNFDLFRVVAGVLHLGNIDLEEAGSTSGGCNLKNKSAPSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIELIEVKLVGILDILDEENRLPQPSDQHFTSVVHQKHKDHFRLTIPRKSKLAVHRNLRDDEGFIIRQLCRGRVLRRQPQYGGGKNNDALHMSLESLICESR-----DKFIRALFESSTNNSKDTKQ--KAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMASHHFEGAQILSQLQCSGMVSVLDLMQGGFPSRASFHELYNMYKKYMPEKLPRLDPRLFCKPLFKALGLNEVDYKFGLTQVFFRPGKFAEFDQIMKSDPDHLAELVKRVNLWLVCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKPIRMWLCKRRHNPRIDGLVKVGTLKKRLDKFNEVVSALKDGKPEV-----NRQ-IKNLEISIDALMA-KFTSTMMTREQIQKEYDALVKSSEDLLSALQKKKQQEE---EAERLRRIQEEMEKERKRREEDEERRRKEEEERRMKLEMEPKRKQEEEERKKREDDEKRIQSEVEAQLARQREEESQ--QQAVLAQECRDRELALRIAQNESELISDEAQGDMALRRGPAVQATKAASGTKKHDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYDFAPFLNNSPQQNPAAQLPARQQEIDMKRQQRFFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEEIWERCGGIQYLQ 1243          
BLAST of Myosin vs. TrEMBL
Match: A0A267EZ74 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003284g2 PE=3 SV=1)

HSP 1 Score: 1212.98 bits (3137), Expect = 0.000e+0
Identity = 654/1278 (51.17%), Postives = 866/1278 (67.76%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQKTI-TAEYDQTFPVEE-EERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSG--VMTSPILKKG------HGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKS-DKGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPK--SLIVKEHEETESYI---QELSKEQERRDKELALRIAEGDSTILEE--------------LSKPVEISNNQKTNNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITT-------------TSTKDSFSESQVQLQPVKNPEPK-----NEISQITVQRYFSLPFT--------TVSGKSTQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQRLNNQISSNY 3697
            VWAP P EGY  G + D+GS  + V+ L+S K + T  Y++ FP EE + ++V+DNC+LM+LN   LLNNI++RY +N IYTYVANILIA+NPY E+PKL++K+TI  Y+GKS+GT+PPHV+AI D+AYRDMK  K +Q+IIVSGESG+GKTET K+I +YLTE YGA AGPIEQRI ESNPLLE FGN+KTVRNNNSSR+GKFVEIHFDN S+V GG++SHYLLEKSRIC QS  ERNYHIFYR+CAG     R+K  L +PD + YL  G T+YFCTK   +++  + KS ++L+IG L D QL+DVKDF     AM  +G+ D E  +I+ +VA +LHLGN+ FEE   +QG   ++ +S+ SL    +LLG  P  L ESL  RIT AA  GAQ   +RIAL+ ++A +ARDALAKA+YSRLFD IV  +N+A+PF  S +Y+G+LDIAGFEYF++NS+EQF INYCNEKLQQFFNERVL EEQ LY+KEGL + KI+FVDNQDCIDL+E KGSGI  +LDE+SKLPKP+ E FT+ ++  N NHFRL  PRKSKLK+HR+LRD EGFLIRHFAGAVCYHT++FIEKNNDALH SL+ +++ SS  L+  +F       G  V     ++K        G GKL+F+SV +KF++QL  LMD LR++ T FIRCIKPNV MV   FEG  ILSQLQCSGM  VLDLMQQGYPSR KF +LY +YK  LP  L+ LD RLFCKLLF A+GL E+DFKFG++KVFFRPGK AEFDQL+RSDPEN+  +VAKV+ WL++YRWRKAQ+   EV+KL+ KI WRR+ ++K+QKT+RMWI  KK+  +I+ + K+++L   L  +  I  QLK   D   K +     +   +  QI+       A +  I     ++       L+K +E +K+  E+E+LR IQEEM   + K   E+   +QAEEEKR K E+E  R++EE + K+ +   +  + ++++  E E+     Q   +EQER D+ELALR+A  D+  +E+              L K  ++ N   +  D++++ Y ELR  IN+SCDL+L+ AC+ EF RR+  Y+ WK K K++   +              +    S  E+ V ++     + +      E      QRYF +PF         T + + + G W AHFDG +IARQ+E+   + + LLVAGVDD+ MC L L  TGL  +KGAE+T T+F+  W   GG  +L++    +SS +
Sbjct:   28 VWAPHPKEGYKLGKITDLGSENVVVETLSSPKEVLTVPYNRLFPSEEYDNKDVEDNCALMYLNEATLLNNIRLRYMKNAIYTYVANILIAVNPYFEVPKLYAKDTIKAYQGKSLGTMPPHVFAIGDKAYRDMKAFKASQAIIVSGESGSGKTETAKHIFKYLTENYGAHAGPIEQRIVESNPLLEGFGNAKTVRNNNSSRFGKFVEIHFDNRSLVTGGYISHYLLEKSRICVQSEGERNYHIFYRLCAGADAALRQKLGLVAPDQFRYLNQGNTQYFCTKASEAQIPKEVKSKQYLQIGALKDIQLDDVKDFRNVDKAMTDMGLADSEKQDIYSVVAGVLHLGNVNFEESGQAQGVVSVTPASRPSLDKAAQLLGVDPARLEESLITRITQAARGGAQGGIVRIALRLDEAASARDALAKAVYSRLFDYIVLRVNQALPFSGSQSYIGVLDIAGFEYFQRNSYEQFSINYCNEKLQQFFNERVLKEEQQLYQKEGLNVKKIEFVDNQDCIDLIEAKGSGIFYLLDEQSKLPKPSPETFTLEVYAKNKNHFRLAYPRKSKLKSHRELRDDEGFLIRHFAGAVCYHTDQFIEKNNDALHASLEAIVKQSSSGLVRSLFDDAAGGVGATVAADGSVRKAGGGGSKIGTGKLAFISVGSKFKAQLAQLMDKLRSTGTCFIRCIKPNVRMVDHLFEGADILSQLQCSGMASVLDLMQQGYPSRTKFDELYQLYKGRLPPQLSRLDPRLFCKLLFHALGLNENDFKFGISKVFFRPGKFAEFDQLLRSDPENIAALVAKVKSWLVRYRWRKAQYCTWEVVKLRRKIAWRREMLVKVQKTMRMWICVKKYRPRIRGLAKVQSLRNRLSSMNDIVGQLKADKDAAKKSVDTLIAEVDGVVKQIKSAQRMSYAEIDAIYSKLSAKFDASFAELKKRLEQQKVREEQERLRRIQEEMERERAKKADEERQRQQAEEEKRAKAELEERRRREEAERKKQEEADRKAAAVLQKQMEEEAEANRKQSQDQEQERLDRELALRLASEDANQVEDLQGAGGGLTRGANVLQKRAQMGN---SKYDLSKWKYAELRDTINTSCDLELLAACREEFQRRLKVYHEWKQKNKQRGAASGAAGAGGAGGKSEGSRAPQSVLENAVTVEGAVAAQRQLAGRIGEPGDPKSQRYFRIPFARPNELNRGTEADQHSGGLWWAHFDGRWIARQMEVQPGQPAVLLVAGVDDMSMCELGLEETGLPQKKGAEVTATEFDREWEKHGGAAVLKQHRAAVSSMF 1302          
BLAST of Myosin vs. TrEMBL
Match: A0A267EY54 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003284g4 PE=3 SV=1)

HSP 1 Score: 1211.44 bits (3133), Expect = 0.000e+0
Identity = 654/1276 (51.25%), Postives = 862/1276 (67.55%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQKTI-TAEYDQTFPVEE-EERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFP--------KEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKS-DKGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPK---SLIVKEHEE--TESYIQELSKEQERRDKELALRIAEGDSTILEE--------------LSKPVEISNNQKTNNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITT-------------TSTKDSFSESQVQLQPVKNPEPK-----NEISQITVQRYFSLPFT--------TVSGKSTQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQRLNNQISS 3691
            VWAP P EGY  G + D+GS  + V+ L+S K + T  Y++ FP EE + ++V+DNC+LM+LN   LLNNI++RY +N IYTYVANILIA+NPY E+PKL++K+TI  Y+GKS+GT+PPHV+AI D+AYRDMK  K +Q+IIVSGESG+GKTET K+I +YLTE YGA AGPIEQRI ESNPLLE FGN+KTVRNNNSSR+GKFVEIHFDN S+V GG++SHYLLEKSRIC QS  ERNYHIFYR+CAG     R+K  L +PD + YL  G T+YFCTK   +++  + KS ++L+IG L D QL+DVKDF     AM  +G+ D E  +I+ +VA +LHLGN+ FEE   +QG   ++ +S+ SL    +LLG  P  L ESL  RIT AA  GAQ   +RIAL+ ++A +ARDALAKA+YSRLFD IV  +N+A+PF  S +Y+G+LDIAGFEYF++NS+EQF INYCNEKLQQFFNERVL EEQ LY+KEGL + KI+FVDNQDCIDL+E KGSGI  +LDE+SKLPKP+ E FT+ ++  N NHFRL  PRKSKLK+HR+LRD EGFLIRHFAGAVCYHT++FIEKNNDALH SL+ +++ SS  L+  +F                V  +       G GKL+F+SV +KF++QL  LMD LR++ T FIRCIKPNV MV   FEG  ILSQLQCSGM  VLDLMQQGYPSR KF +LY +YK  LP  L+ LD RLFCKLLF A+GL E+DFKFG++KVFFRPGK AEFDQL+RSDPEN+  +VAKV+ WL++YRWRKAQ+   EV+KL+ KI WRR+ ++K+QKT+RMWI  KK+  +I+ + K+++L   L  +  I  QLK   D   K +     +   +  QI+       A +  I     ++       L+K +E +K+  E+E+LR IQEEM   + K   E+   +QAEEEKR K E+E  R++EE + K+ +   +   +L+ K+ EE    +  Q   +EQER D+ELALR+A  D+  +E+              L K  ++ N   +  D++++ Y ELR  IN+SCDL+L+ AC+ EF RR+  Y+ WK K K++   +              +    S  E+ V ++     + +      E      QRYF +PF         T + + + G W AHFDG +IARQ+E+   + + LLVAGVDD+ MC L L  TGL  +KGAE+T T+F+  W   GG  +L++    +SS
Sbjct:   28 VWAPHPKEGYKLGKITDLGSENVVVETLSSPKEVLTVPYNRLFPSEEYDNKDVEDNCALMYLNEATLLNNIRLRYMKNAIYTYVANILIAVNPYFEVPKLYAKDTIKAYQGKSLGTMPPHVFAIGDKAYRDMKAFKASQAIIVSGESGSGKTETAKHIFKYLTENYGAHAGPIEQRIVESNPLLEGFGNAKTVRNNNSSRFGKFVEIHFDNRSLVTGGYISHYLLEKSRICVQSEGERNYHIFYRLCAGADAALRQKLGLVAPDQFRYLNQGNTQYFCTKASEAQIPKEVKSKQYLQIGALTDIQLDDVKDFRNVDKAMTDMGLADSEKQDIYSVVAGVLHLGNVNFEESGQAQGVVSVTPASRPSLDKAAQLLGVDPARLEESLITRITQAARGGAQGGIVRIALRLDEAASARDALAKAVYSRLFDYIVLRVNQALPFSGSQSYIGVLDIAGFEYFQRNSYEQFSINYCNEKLQQFFNERVLKEEQQLYQKEGLNVKKIEFVDNQDCIDLIEAKGSGIFYLLDEQSKLPKPSPETFTLEVYAKNKNHFRLAYPRKSKLKSHRELRDDEGFLIRHFAGAVCYHTDQFIEKNNDALHASLEAIVKQSSSGLVRSLFDDAAGAVGATVAADGSVRKAGGGGSKIGTGKLAFISVGSKFKAQLAQLMDKLRSTGTCFIRCIKPNVRMVDHLFEGADILSQLQCSGMASVLDLMQQGYPSRTKFDELYQLYKGRLPPQLSRLDPRLFCKLLFHALGLNENDFKFGISKVFFRPGKFAEFDQLLRSDPENIAALVAKVKSWLVRYRWRKAQYCTWEVVKLRRKIAWRREMLVKVQKTMRMWICVKKYRPRIRGLAKVQSLRNRLSSMNDIVGQLKADKDAAKKSVDTLIAEVDGVVKQIKSAQRMSYAEIDAIYSKLSAKFDASFAELKKRLEQQKVREEQERLRRIQEEMERERAKKADEERQRQQAEEEKRAKAELEERRRREEAERKKQEEADRKAAALLQKQMEEEAEANRKQSQDQEQERLDRELALRLASEDANQVEDLQGAGGGLTRGANVLQKRAQMGN---SKYDLSKWKYAELRDTINTSCDLELLAACREEFQRRLKVYHEWKQKNKQRGAASGAAGAGGAGGKSEGSRAPQSVLENAVTVEGAVAAQRQLAGRIGEPGDPKSQRYFRIPFARPNELNRGTEADQHSGGLWWAHFDGRWIARQMEVQPGQPAVLLVAGVDDMSMCELGLEETGLPQKKGAEVTATEFDREWEKHGGAAVLKQHRAAVSS 1300          
BLAST of Myosin vs. TrEMBL
Match: A0A433TKJ2 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_010207 PE=3 SV=1)

HSP 1 Score: 1203.73 bits (3113), Expect = 0.000e+0
Identity = 653/1252 (52.16%), Postives = 868/1252 (69.33%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEE-EERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEE-VNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSD----KGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPKSLIVKEHEETESYIQELSKE---------QERRDKELALRIAEGDSTILEELSKPVEISNNQKTNN----------DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGKSTQ----GTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQRLNNQISSNY 3697
            VW P P +G+  G ++DIGS+TI+++  ++   TI + YD+TFP EE + +  DDNC+LM+LN   LL+NIKIRY +N IYTY ANILIAINPY E+P L+S  TI KY+GKS+GTLPPHVYAIAD+A+RDMK+ K++QS+IVSGESGAGKTE+TK+IL+YLTE +G  AGPIEQRI ESNPLLEAFGN+KTVRNNNSSR+GKFVEIHFD  + V GGF+SHYLLEKSRIC Q   ERNYHIFYR+CAG  +  R+K  L  PD + YLK G T+YFC K     LS   KS +++K+G+LND  L+DV DF     AMK LG  D+E   I+G+VAAILHLGN+ F++  + ++GGC ++ S++ SL     LLG    EL +SL +R+  A   G + TA+++ LK  +A NARDALAKA+YSR+FD IV  +N+AIPF  SANY+G+LDIAGFEYF+ NSFEQFCINYCNEKLQQFFN+R+L EEQ LYEKEGL + KI + DNQDCI+L+E K SGI D+LDEESKLP P  +HFT  +   N NHFRL +PRKSKLK+HRD+RD EGFLIRHFAGAVCYHT +FI+KNNDALH SL+ L++ S   L+ ++F       G  +S         GKL+F+SV +KFR QL +LM+ LR++ TNFIRCIKPN  MV   FEG +ILSQLQC+GM  VLDLMQQGYPSR +FI+LYN+YKK LP  L+ LD RLFCK LFKA+GL + DFKFG+TKVFFRPGK AEFDQ+++SDPEN+  +V KV+KWL++ RW+KAQ+  L VIKLKNKI +R ++ + +Q  +RMW   + F  K ++++K+R +      +  +  QLKK      K VK +   +  F K   +IR T   +   +++  ++  + + V +  L+K +E +K   E+E+LR IQE+M I +++ E E+   K+ EE++R+K E+E  R+KEEE+ K+ +A  +    K  E  +  + E +KE         QE RD+ELALR+A  D   +E+++ P  +  ++              D+T++ Y ELR  IN+SCDL+L++AC+ EFHRR+  Y+ WK+K K++          S  E   +  PV  P   +  +    QRYF +PF   + +  Q    G W AHFDG++IARQ+EI+  K S LL+AGVDD+ MC L L+ TGL  +KGAE+ E +FEE W   GG E+L++   ++SS Y
Sbjct:    7 VWVPHPTDGFKLGRIVDIGSDTISIEPFDAPGTTINSLYDRTFPAEEYDNKECDDNCALMYLNEATLLHNIKIRYMKNMIYTYTANILIAINPYYEVPDLYSSNTIKKYQGKSLGTLPPHVYAIADKAFRDMKVTKMSQSVIVSGESGAGKTESTKHILKYLTESWGTHAGPIEQRILESNPLLEAFGNAKTVRNNNSSRFGKFVEIHFDKKNSVCGGFISHYLLEKSRICTQGKEERNYHIFYRLCAGAPEDIRQKLKLAPPDQFLYLKRGNTQYFCGKKTQKNLSDARKSQQYMKLGSLNDPVLDDVNDFGVCDAAMKHLGFGDQERLGIYGLVAAILHLGNVAFDDNADDAKGGCCVNKSAEESLGMAATLLGVDKEELRDSLISRVMQATRGGMKGTAIKVPLKCSEASNARDALAKAVYSRMFDYIVDMVNKAIPFGSSANYIGVLDIAGFEYFQVNSFEQFCINYCNEKLQQFFNDRILKEEQALYEKEGLNVKKIDWTDNQDCIELIEGKSSGIFDLLDEESKLPTPKYDHFTGEVHSRNKNHFRLSVPRKSKLKSHRDVRDTEGFLIRHFAGAVCYHTTQFIDKNNDALHASLEFLIQDSKNPLIVKLF------QGAESS--------AGKLNFISVGSKFRKQLGMLMEKLRSTGTNFIRCIKPNTKMVDHLFEGSNILSQLQCAGMVSVLDLMQQGYPSRTQFIELYNMYKKYLPPELSRLDPRLFCKSLFKALGLDDKDFKFGLTKVFFRPGKFAEFDQIMKSDPENLAELVKKVKKWLLQSRWKKAQWCALSVIKLKNKIAYRAEKFVLLQSHIRMWRCARTFKPKYETLQKVRAIQAQRSLVDQLVGQLKKDKDAVIKAVKELETGQDSFVK---KIRTTNMTREE-MLRQTNTLATNMDVLLQDLKKRLEQQKSAEEQERLRKIQEQMEIERKRREDEEKKRKEEEEQRRLKTELERKRQKEEEQRKKQEAEDR----KAAEALQKQLNEQAKENAKRQAALDQEHRDRELALRLAMEDQNQVEDITLPPPLPRSEAVMAARQAASLKKFDLTKWKYAELRDAINTSCDLELLDACREEFHRRLKVYHAWKTKNKKRTEKGDQRAPHSV-EQNAEAPPV--PSRGDNPTGPVEQRYFRIPFARPADEYRQETKHGMWYAHFDGQWIARQMEIYPDKESILLLAGVDDMQMCELSLNETGLKEKKGAEVLENEFEEEWNKNGGTELLKKNAQKVSSKY 1233          
BLAST of Myosin vs. TrEMBL
Match: A0A023PNK0 (Myosin OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 1197.96 bits (3098), Expect = 0.000e+0
Identity = 640/1239 (51.65%), Postives = 876/1239 (70.70%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNS-QKTITAEYDQTFPVEE-EERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEE-VNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMF-------PKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQL-KKSDKGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPK-----SLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSKPVEI--SNNQKTNNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGKSTQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQRLNNQISSN 3694
            VW   P +GY  G ++D+G+++ TV+  N+ ++TITA +D+ FP EE + ++VDDNC+LM+LN   LLNN++IRY ++ IYTYVANIL+AINPY E+P L+SK+TI  Y GKS+GT+ PH++AIAD+A+RDMK+ K +QSIIVSGESGAGKTE TK+IL+YLTE +G+ AGPI+QRI ESNPLLEAFGN+KTVRNNNSSR+GKF+EIHFD   +V GG++SHYLLEKSRICKQ  +ERNYHIFYRMCAG  +K RE+  L SPD++NYL+ G T+YF +     KL+ + KS +FLK G+L D QL+DV DF    +AM  +G+ + E   ++ +VA +LHLGNIEFEE    S+GG +++  S+ SL    +LLG    EL E+L +R+  AA  G + T +++ LK  +A NARDALAK++YS+LFD IV  +N ++PF  S NY+G+LDIAGFEYF++NSFEQFCINYCNEKLQQFFNER+L +EQ LYEKEGL + +I +VDNQDCIDL+E KG GI DILDEE+KL KPN EHFT  + +   NHFR+ LPRKSKLK HR+LRD EGFLIRHFAGAVCY T  FIEKNNDALH SL+TL+  S  TL+  ++       PK+  KS             +GKL F+SV +KFR QL +L+  LR++ T+FIRCIKPN+ MV   FEG  IL+QLQCSGMT VL+LMQQG+PSR +F +LYN+YK+ +P  +A LD RLFCK LFKA+GL E+DFKFGMTKVFFRPGK AEFDQ+++SDPEN+  ++ KV +WLI  RW+KAQ+  L VIKLKNKI++R+  II+IQ ++  W   KK+  +I+++ ++ +++  LE++      L K  D   K I + +++ + +  +I+   +     + +++D     ++  +  L K VE +K   E E+LR IQEEM   +++ E+E+   K+ EE K+ + EMEA RKKEEE  K+ +   K        VKE E+ E  + +   EQER D+ELALR+ + DS+ +E++S+P  +  ++  K+ +D++++TY ELR  IN+SC+++L+EAC+ EFHRR+  Y++WK K K K+            ES +        + K + S    QR+F +PF     ++ +G W AHFDG++IARQ+E+H  K   LLVAGVDD+ MC L L  TGL  ++GAEI E  FEE W  LGG E+L+++ ++++S+
Sbjct:    7 VWVVHPTDGYTLGKIVDLGADSFTVEPFNTPRQTITASFDRVFPAEEYDNKDVDDNCALMYLNEATLLNNLRIRYKKDAIYTYVANILLAINPYKELPNLYSKQTIASYTGKSLGTMAPHIFAIADKAFRDMKMLKESQSIIVSGESGAGKTEGTKHILKYLTEVWGSHAGPIQQRIVESNPLLEAFGNAKTVRNNNSSRFGKFIEIHFDAKYLVTGGYISHYLLEKSRICKQGRDERNYHIFYRMCAGAPEKLREQLRLGSPDSFNYLRYGCTQYFGSNATAGKLNANQKSQQFLKHGSLVDIQLDDVNDFNRMDSAMSKMGLPEDEKMAVYTVVAGVLHLGNIEFEEETEGSKGGSKVTKQSEGSLVIAAKLLGMDKDELHEALVSRVMQAARGGIKGTVIKVPLKVGEASNARDALAKSVYSKLFDYIVKRVNDSLPFTTSKNYIGVLDIAGFEYFQENSFEQFCINYCNEKLQQFFNERILKDEQNLYEKEGLNVKRIDYVDNQDCIDLIEYKGVGIFDILDEENKLTKPNPEHFTSEVHKKTKNHFRIDLPRKSKLKLHRELRDDEGFLIRHFAGAVCYRTALFIEKNNDALHLSLETLVMESKNTLVMTIYQNNNDSGPKDSKKS-------------MGKLGFISVGSKFRDQLTILLQKLRSTGTSFIRCIKPNLKMVDSLFEGTQILTQLQCSGMTFVLELMQQGFPSRTQFSELYNMYKQYMPPAIARLDPRLFCKALFKALGLNENDFKFGMTKVFFRPGKFAEFDQIMKSDPENLAALIKKVMRWLICARWKKAQWCALSVIKLKNKIEYRKGLIIRIQASMNGWYTAKKYRPRIRAIAQVGSMSSNLEEMKKTVNNLKKDKDSASKKIGSAEKEMNNVVQKIKSADNLSQKDLDKMLDELTKTMSKTLQELNKMVEKQKTAEEAERLRKIQEEMEKERKRKEEEERKKKEEEELKKQRAEMEARRKKEEEARKKQEEADKKNAAAQAKVKEKEDAEQKVLQQQYEQERMDRELALRLVQEDSSQVEDMSRPAPLRAASGGKSKHDLSKWTYAELRDTINTSCEVELLEACREEFHRRLKVYHDWKCKNK-KRIANKQEDNQRAPESIIDASAAPVSKAKADKSNERAQRFFRIPFVRPDDRNRRGWWYAHFDGKWIARQMEVHPDKQPVLLVAGVDDVKMCELSLEETGLARKRGAEILEKDFEEEWSKLGGNELLEQVKHRVTSD 1231          
BLAST of Myosin vs. TrEMBL
Match: K1Q1S3 (Myosin-VI OS=Crassostrea gigas OX=29159 GN=CGI_10013678 PE=3 SV=1)

HSP 1 Score: 1197.19 bits (3096), Expect = 0.000e+0
Identity = 666/1259 (52.90%), Postives = 885/1259 (70.29%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEE-EERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEE-VNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKK----SDKGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQ-IIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEA-------TXXXXXXXXXXXQAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEE-LSKPVEISNNQKTNN--------DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKN-----ITTTSTKDSFSESQVQLQPVKN-PEPKNEISQITVQRYFSLPFTTVSGK-------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQRLNNQISSNY 3697
            VW P   +G+  G ++DIGS++I ++  ++   TI A YD+TFP EE + ++V+DNC+LMFLN   LLNN++IRY +N IYTY ANILIAINPY EIP L++  TI KYKGKS+GTLPPHVYAIAD+A+RDMK+NK++QSIIVSGESGAGKTE+TKYIL+YLTE +GA    +EQRI ESNPLLEAFGN+KTVRNNNSSR+GKF+EIHFDN + VAGGF+SHYLLEKSR+  QS +ERNYHIFYR+CAG  ++ R++  L SPD ++YL  G T+YFCT+    KL  D KS  +LK G+L+D  L+DV+DF    +AM  LGI++++   I+ +VA++LHLGNI FEE  + ++GGC++S S+++SL +   LLG    EL ESL +RI   A  G++ TA+++ LK  +A +ARDAL+K+IYSRLFD IVA +N+AIPF  + +Y+G+LDIAGFEYF+ NSFEQFCINYCNEKLQQFFNER+L EEQ+LYE+EGL + KI + DNQDCI+L+E K +GI D+LDEESKLP P  EHFTM +   N +HFRL LPRKSKLK HRD+RD EGFLIRHFAGAVCYHT  FIEKNNDALH SL+ L++ SS  ++  MF       G+  S         GKL+F+SV +KFRSQL  LM+ L+++ TNFIRCIKPN+ MV   FEGG ILSQL+CSGM  VL+LMQQG+PSR +F DLYN+YKK +P+++A LD RLFCK LFKA+GL E++FKFG+TKVFFRPGK AEFDQ+++SDPEN+  +V KV++WL+  RW+KAQ+G L VIKLKNKI WRR QII +QKT+RMW   ++F  K + + +++     L ++  I +QLKK    + K  K+I    Q F       +I  +N  A  +Q  ++   S++      L+K++E EK  +E+E+LR IQEEM   K++ E+E+   KQ EE++++K EMEA        RKK EE+ K+ +A+  + + KE E+     + L  EQERRD+ELALR+A  D   +E+ +  P++ S   +           D++++ Y ELR  IN+SCD++L++AC+ EFHRR+  Y++WK K K+K +         S   + SES  +L P +  P   N+      QR+F +PF   S +          G W AHFDG+YIARQ+E++  K   LLVAGV DL MC L L  TGL  +KGAEI    FE  W   GG E+L+   N++SS +
Sbjct:    7 VWVPHATDGFKLGRIVDIGSDSIAIEPFDAPGTTINAIYDRTFPAEEYDNKDVEDNCALMFLNEATLLNNLRIRYMKNQIYTYTANILIAINPYYEIPDLYTSNTIKKYKGKSLGTLPPHVYAIADKAFRDMKVNKMSQSIIVSGESGAGKTESTKYILKYLTESWGAHINQLEQRILESNPLLEAFGNAKTVRNNNSSRFGKFIEIHFDNKNSVAGGFISHYLLEKSRVIVQSRDERNYHIFYRLCAGAPEELRKQLKLASPDQFHYLNRGCTQYFCTRENDKKLGQDRKSQMYLKQGSLHDPVLDDVRDFQVCDSAMAHLGISNEDRHSIYTLVASVLHLGNITFEENTDDTKGGCKVSPSTETSLDTASSLLGLPKEELRESLVSRIMQTARGGSKGTAIKVPLKAGEASSARDALSKSIYSRLFDYIVACVNKAIPFSSTVSYIGLLDIAGFEYFQVNSFEQFCINYCNEKLQQFFNERILKEEQVLYEREGLNVKKITWTDNQDCIELIEMKANGIFDLLDEESKLPTPKPEHFTMEVHNRNKSHFRLSLPRKSKLKMHRDVRDDEGFLIRHFAGAVCYHTTLFIEKNNDALHASLEFLIQDSSNKMLKTMF------EGIQVSS--------GKLNFISVGSKFRSQLQTLMEKLKSTGTNFIRCIKPNLKMVDHLFEGGQILSQLECSGMGSVLELMQQGFPSRTQFSDLYNMYKKYMPADIARLDPRLFCKALFKALGLNENEFKFGLTKVFFRPGKFAEFDQIMKSDPENLAMLVKKVKRWLLCSRWKKAQWGALSVIKLKNKILWRRGQIITLQKTVRMWRDVRRFKPKYEMIVQVKQSQGQLSRMEEIISQLKKEKETATKQAKLIEKALQDFIH-----KIRTTNMSADEMQRTMNHLLSQMDQTFQDLRKKLEQEKTKAEQERLRKIQEEMEREKKRKEEEERRKKQEEEDRKLKAEMEAKRKKEEEERKKREEEEKKQKALISAQLEKEKEDNRRRQEIL--EQERRDRELALRLASEDQNEVEDVVVPPLQRSEEVRATRAAALQKKYDLSKWKYAELRDAINTSCDIELLDACREEFHRRLKVYHSWKQKNKKKSDERGEERAPESVLTNASES--RLAPKQGAPTTDNQ------QRFFRIPFARPSDEFRDDPTHKKHGQWYAHFDGQYIARQMELYPDKNPLLLVAGVHDLQMCELSLDETGLTRKKGAEILGKDFEAEWNKYGGRELLKSCGNRMSSTF 1236          
BLAST of Myosin vs. Ensembl Cavefish
Match: myo6a (myosin VIa [Source:ZFIN;Acc:ZDB-GENE-040819-2])

HSP 1 Score: 1134.01 bits (2932), Expect = 0.000e+0
Identity = 611/1243 (49.16%), Postives = 849/1243 (68.30%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVD-------------INSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEE------LSKPVEISNNQKTNN----DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            VWAP PI+G+  G ++DIG++++T++ L  + K   A  +Q FP E++  ++V+DNCSLM+LN   LLNN+++RY ++ IYTYVANILIA+NPY +IPKL+S +TI +Y+G+S+GTLPPHVYAIAD+AYRDMK+ K++QSIIVSGESGAGKTE TK++L+YLT  YG     I++RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  + V GGFVSHYLLEKSRIC+QS  ERNYHIFYR+CAG S+  RE++ L SPD++ YL  G TRYF TK+   ++  + KS E +K G L D  L+D  DF     AMK +G+ D E   +F +VA +LHLGNI+FEE  ++ GGC +   S  +L+ C  LLG    +L  SL  R+      G + T +++ LK E A NARDALAKA+YS LFD +V  +N+  PF  SAN++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++K+VDNQDCIDLVE K  GI+DILDEE++LP+P+++HFT  +   + NHFRL +PRKSKL  HR++RD EGF++RHFAGAVCY T +F+EKNNDALH SL++L+  S        F +E+ ++ + +  + +K    GKLSF+SV  KF++QL +L++ LR++ ++FIRC+KPN+ MV+  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YK+ +P  L  LD RLFCK LFKA+GL E D+KFG+T+VFFRPGK AEFDQ+++SDP+++  +V +V KWLI  RW+K Q+  L V+KLKNKI +R    IK+QKT+RMW+ ++K   +I  + K+R+L   + K   + + LK++          KQ+ SK   QI+   ++  A + +I  +  + + +D             + ++QK+ + E+   E+E+L  IQEEM   +++ E+++   KQ EEE+R+K EME  RK+EEE+ K+ +   + L V         I  +      RD+ELALRIA+ ++ ++ E      L +  ++   +   N    +++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T      S ++   Q  P   P  ++EI     QRYF +PF     +        +G W AHFDG +IARQ+E+H +K   +LVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ L+
Sbjct:    7 VWAPHPIDGFQLGTIVDIGADSLTIEPLKERGKPFLAPVNQVFPAEDDVNKHVEDNCSLMYLNEATLLNNVRVRYSKDKIYTYVANILIAVNPYYDIPKLYSSDTIKQYQGRSLGTLPPHVYAIADKAYRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTTSYGT-GQDIDERIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNTKNAVVGGFVSHYLLEKSRICRQSQEERNYHIFYRLCAGASEDIREQFHLTSPDSFRYLNRGCTRYFATKDTDKQILQNRKSPEHMKAGPLKDPLLDDQGDFNRMVVAMKKIGLDDAEKLNLFRVVAGVLHLGNIDFEEAGSTSGGCILKKQSNPALEHCAELLGLDEEDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNARDALAKAVYSCLFDHVVTRVNQCFPFDSSANFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVKYVDNQDCIDLVESKLVGILDILDEENRLPQPSDQHFTETVHNKHKNHFRLTVPRKSKLAVHRNVRDDEGFIVRHFAGAVCYETGQFVEKNNDALHMSLESLVSESK-----DRFIRELFENSINSKDVKQKA---GKLSFISVGNKFKTQLNILLEKLRSTGSSFIRCVKPNLKMVSHQFEGAQILSQLQCSGMVSVLDLMQGGFPSRAPFHELYNMYKQYMPPKLTRLDPRLFCKALFKALGLNEHDYKFGLTRVFFRPGKFAEFDQIMKSDPDHLAELVKRVNKWLIHSRWKKVQWCALSVLKLKNKILYRTSACIKMQKTVRMWLCKRKHKPRIDGLVKVRSLKKRMGKFNEVVSGLKEA----------KQEMSK---QIQDLDASIDALMFKIKSTIMTRIEIDHEHQALVTRSEQLLTTMQKQKQQEE---ERERLCRIQEEMEKERKRREEDEKRRKQEEEERRLKAEMELKRKQEEEERKKREEEERRLQV---------ISSV------RDRELALRIAQSEAELIPEELPGDALRRGPQVQATKAAANTKKYELSKWKYAELRDAINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDFAQQNAPPPIPTRQHEILMNRQQRYFRIPFIRPGDQYKDPQNKKKGWWYAHFDGPWIARQMELHPEKQPIILVAGKDDMEMCELSLEETGLTRKRGAEILPRQFEEIWERCGGIQYLR 1209          
BLAST of Myosin vs. Ensembl Cavefish
Match: myo6b (myosin VIb [Source:ZFIN;Acc:ZDB-GENE-030318-3])

HSP 1 Score: 1116.68 bits (2887), Expect = 0.000e+0
Identity = 602/1243 (48.43%), Postives = 842/1243 (67.74%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGV-KMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRI---KLEMEATXXXXXXXXXXXQAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEE-------LSKPVEISNNQKTNN----DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQRLNNQISS 3691
            VWAP P +G+  G ++DIG++T+T++ LN + KT  A  +Q FP E++  ++V+DNCSLM+LN   LLNN+++RY ++ IYT+VANILIA+NPY +IPKL++ ETI  Y+G+S+GTLPPHVYAIAD+AYRDMK+ K++QSIIVSGESGAGKTE TK++L+YLT  YG     I++RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF++ + V GGFVSHYLLEKSRIC Q ++ERNYHIFYR+CAG S+  R    L SPD++ YL  G T+YF +K+   ++  + KS+E +K G L D  L+D+ DF     AMK +G+ D E   +F +VA +LHLGNI+FEE  ++ GGC + + S  +LQ C  LLG    +L  SL  R+      GA+ T +++ LK E A NARDALAKA+YS LFD +V  +N+  PF+ S+N++G+LDIAGFEYFE NS+EQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDL+E K  GI+DILDEE++LP+P+++HF  A+   + +HFRL +PRKSKL  HR++RD EGF+IRHFAGAVCY T +F+EKNNDALH SL++L+  S        F +++ ++   +    +K    GKLSF+SV  KF++QL +L++ LR++ ++FIRC+KPN+ MV+  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+YK+ +P  L  LD RLFCK LFKA+GL + D+KFG+T+VFFRPGK AEFDQ++RSDPE++  +V +V +WL+  RW+K Q+  L VIKLKNK+ +R    IKIQKT+RMW+ +++   ++  + K+RNL   +EK     + LK+  + + K I         + ++I++T  ++     +I   ++  +      L    + ++   E E+LR IQEEM   +++ E+E  L KQ EE++RI   K ++ A              +   L ++  EET+   ++   EQERRD+ELALRIA+ ++ ++++       L +  ++  ++        D++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WKSK K++   T      S ++   Q      P    EI+    QRYF +PF   + +        +G W AHFDG +IARQ+E+H  K   LLVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI   Q L N I S
Sbjct:    7 VWAPHPSDGFQLGMIVDIGADTLTIEPLNHRGKTFLAPINQVFPAEDDVNKHVEDNCSLMYLNEATLLNNVRVRYSKDQIYTFVANILIAVNPYYDIPKLYAPETIKSYQGRSLGTLPPHVYAIADKAYRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTTSYGT-GQDIDERIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNDKNAVVGGFVSHYLLEKSRICMQGADERNYHIFYRLCAGASEDIRNMLHLNSPDSFRYLNRGCTKYFASKDSDKQIMQNRKSSEHMKAGALKDPLLDDLGDFNRMCVAMKKIGLDDTEKLNLFRVVAGVLHLGNIDFEETGSTSGGCVLKNQSSETLQYCAELLGLDQEDLRVSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARDALAKAVYSCLFDHVVTRVNQCFPFETSSNFIGVLDIAGFEYFEHNSYEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSDQHFAEAVHSKHKDHFRLTIPRKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLVCESK-----DRFVRDLFENNSNSKDSKQKA---GKLSFISVGNKFKTQLNLLLEKLRSTGSSFIRCVKPNLKMVSHQFEGAQILSQLQCSGMVSVLDLMQGGFPSRAPFHELYNMYKQYMPDKLTRLDPRLFCKALFKALGLNDKDYKFGLTRVFFRPGKFAEFDQIMRSDPEHLAELVKRVNQWLVCSRWKKVQWCGLSVIKLKNKMMYRASACIKIQKTVRMWLCKRRHKPRVDGLVKVRNLKKRMEKFNEAVSGLKEGKQEMSKQIQELAASIDALLAKIKMTVMSRK----EIEQEYEGLVKKSEQLLSSMQKKKQEEEEMERLRRIQEEMEKERKRHEEEDKLRKQEEEDRRINSKKFKISAE-------------LDIQLALEREEETQ---RQTVVEQERRDRELALRIAQSEAELIQDDAQLDPSLRRGAQVQASKAAAGMKKYDLSKWKYAELRDAINTSCDIELLAACREEFHRRLKVYHAWKSKNKKRNTETEQRAPKSVTDYAQQNPAPPVPARHQEIAMNRQQRYFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKQPILLVAGKDDMEMCELSLEETGLTRKRGAEILPRQFEEIWERCGGI---QYLRNAIES 1217          
BLAST of Myosin vs. Ensembl Cavefish
Match: myh9a (myosin, heavy chain 9a, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030131-5870])

HSP 1 Score: 449.514 bits (1155), Expect = 2.017e-133
Identity = 286/825 (34.67%), Postives = 435/825 (52.73%), Query Frame = 2
Query:   29 VVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQKTITAEYDQTFPVEEEERN-VDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGAR-----AGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFE-EVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRI-TNAAGQGAQYTALRIALKR---------EDARNARDALAKAIYSRLFDEIVAFINRAIPF--KESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKF-VDNQDCIDLVEKKGS--GIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGV-MTSPILKKGHGIGKLS---FVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLAN--LDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKA 2419
            +VW P    G+  G++ +   +   V+L +S K I    D    +   + N V+D   L  LN  ++L+N+K RY+   IYTY     + INPY  +P ++++E +  YKGK    +PPH+YAI D AYR M  ++ +QSI+ +GESGAGKTE TK ++QYL     +       G +E+++ ++NP+LEAFGN+KTV+N+NSSR+GKF+ I+FD N  + G  +  YLLEKSR  +Q+  ER +H+FY + +G   K R +  L+    Y +L NG                       + I    D  L     FT T +A K + I + E T +  +++++L LGN+ F+ E N+ Q                           A+ +C+ +  N         + RI + R         E A  A +ALAKA Y R+F  +VA IN+A+    ++ A+++GILDIAGFE FE NSFEQ CINY NEKLQQ FN  +   EQ  Y++EG+  + I F +D Q CIDL+E+     GI+ +LDEE   PK  ++ F   + Q   NH + Q P+K        L+D   F I H+AG V Y  +E++ KN D L+D++ TLL  SS   +  ++       G+   + +    HG  K     F +V   ++ QL  LM  LRN+N NF+RCI PN    A   E   +L QL+C+G+   + + +QG+P+RI F +    Y+ + P+ +    +D +  C L+ KA+ L  + ++ G +KVFFR G +A  ++        +  ++ K + W   Y  RKA
Sbjct:   29 LVWVPSEKLGFEAGSIKEEKGDECLVELSDSGKKIKVNKDDIQKMNPPKFNKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLP-IYTEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVALSSKNKKDPGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHMFYYLLSGAGDKLRSELCLEDYSKYRFLSNGK----------------------VTIPGQQDRDL-----FTETLDAFKIMSIPEDEQTGLLKVISSVLQLGNMSFKKERNSDQAS-------------------LPDDTAAQKVCHLLGMNVTDFTRAVLSPRIKVGRDFVQKAQTQEQAEFATEALAKATYERMFRWLVARINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIDLIERPAGPPGILALLDEECWFPKATDKSFVEKVVQEQGNHPKFQKPKK--------LKDDADFCIMHYAGKVDYKADEWLMKNMDPLNDNVTTLLNQSSDKFVSDLWKDVDRIVGLDKVAGMADSAHGAFKTRKGMFRTVGQLYKEQLSNLMTTLRNTNPNFVRCIIPNHEKKAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYELLTPNAIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEE---ERDIKITDVILKFQAWCRGYVARKA 795          
BLAST of Myosin vs. Ensembl Cavefish
Match: myo5c (myosin VC [Source:ZFIN;Acc:ZDB-GENE-131127-196])

HSP 1 Score: 424.476 bits (1090), Expect = 4.547e-125
Identity = 284/798 (35.59%), Postives = 429/798 (53.76%), Query Frame = 2
Query:   11 LYEMNEVVWAPEPIEGYVKGNVI-DIGSNTITVKLLNSQKTITAEYDQTFPVE-----EEERNVD------DNCSLMFXXXXXXXXXIKIRYFQNNI-YTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGP-IEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRA--IPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKE----VLKSGVMTS-PILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILP-SNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQL 2338
            LY     VW P+  + +    ++ D      T+ L     T+       +PVE        RN D      D  +L +L+ P +L+N+++R+  + I YTY   IL+A+NPY ++P ++    I  Y G+++G L PH++A+A++AY+ M  N  NQSIIVSGESGAGKT + +Y ++Y      + +   +E ++  SNP+ EA GN+KT RN+NSSR+GK+ EI FD    + G  +  YLLEKSR+  QS NERNYH+FY+MCA   Q E +   L S D +NY   G                          G+     ++D  D   T      LG+ +   +++F ++A ILHLGN+  + V +        SSS S L   C LLG +  E++  LC+R    A +    T ++   K E A NARDALAK +Y+ LFD ++  IN+A  +P K+ + ++G+LDI GFE F+ NSFEQFCINY NEKLQQ FN  V   EQ  Y KE +  T I F DNQ  IDL+E K  GI+D+LDEE   P+  ++++   L+    +    + PR S           E F+I+HFA  V Y    F+EKN D L++ L  ++  S   L+   F +E    V K  V  + P +K  +   K    +V  KFRS L +LM+ L  +  +++RCIKPN   +   ++   ++ QL+  G+   + +  Q YPSR  +I+ Y+ Y  ++  + L   D++  C+ + + +    + +KFG TK+FFR G++A  ++L
Sbjct:    6 LYTKYNRVWIPDSEQVWKSAEILKDFSPGDPTLHLQLEDGTVL-----QYPVEGPGQLPHLRNPDILVGENDLTALSYLHEPAVLHNLRVRFVDSRIIYTYCGIILVAVNPYKQLP-IYGDGVIHAYSGQNMGDLDPHIFAVAEEAYKQMARNNQNQSIIVSGESGAGKTVSARYAMRYFAMVSKSSSNKRVEDKVLASNPITEAIGNAKTTRNDNSSRFGKYTEISFDRRYQIIGANMRTYLLEKSRVVFQSENERNYHVFYQMCACADQPEFKSLRLLSADKFNYTCMG--------------------------GDTEIQGVDDCADMAETRRTFSLLGLKEDFQSDVFKMLAGILHLGNVVIKAVGS---DQSSISSSDSHLVVFCDLLGVRGEEMSRWLCHRRIVLASE----TVVKPQPK-ERAINARDALAKHLYAYLFDCVILRINQALRVPGKQHS-FIGVLDIYGFETFDVNSFEQFCINYANEKLQQQFNLHVFKLEQEEYMKEDIPWTLIDFYDNQPVIDLIEAK-MGILDLLDEECLFPQGTDKNWLQKLYNYLGSKPHFEKPRLSN----------EAFVIQHFADKVQYQCRGFLEKNRDTLYEELVDVMRASKFPLLTDFFTEEENNAVTKVKVKAARPGVKPAN---KQLRSTVGDKFRSSLYLLMETLNATTPHYVRCIKPNEEKLPFEYDSKRVVQQLRACGVLETVHISAQSYPSRWTYIEFYSRYSILMSQAELRAGDKKQICRTVLQRLIHDSNQYKFGRTKIFFRAGQVAYLEKL 748          
BLAST of Myosin vs. Ensembl Cavefish
Match: myo5aa (myosin VAa [Source:ZFIN;Acc:ZDB-GENE-041027-2])

HSP 1 Score: 422.935 bits (1086), Expect = 1.390e-123
Identity = 261/773 (33.76%), Postives = 430/773 (55.63%), Query Frame = 2
Query:  185 DDNCSLMFXXXXXXXXXIKIRYFQNN-IYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYG-ARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFK-ESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRL-QLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHG----------IGKLS---FVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRK----WLIKYRWRKAQFGVLEV 2440
            +D  +L +L+ P +L+N+K+R+  +  IYTY   +L+AINPY  +P ++  + I  Y G+++G + PH++A+A++AY+ M  ++ NQSIIVSGESGAGKT + KY ++Y     G A    +E+++  SNP++EA GN+KT RN+NSSR+GK++EI FD    + G  +  YLLEKSR+  Q+  ERNYHIFY++CA     E +   L   ++++Y K G       +N +                      ++D K+ +TT NA   LGI +     +F ++AAILHLGN+E ++ +        ++   +       +      +++  LC+R    A +    T ++  + +  A NARDALAK IY++LF+ IV  +N+A+    +  +++G+LDI GFE FE NSFEQFCINY NEKLQQ FN  V   EQ  Y KE +  T I F DNQ CI+L+E K  GI+D+LDEE K+PK +++ +   L+ T+     L + PR S           + F+I+HFA  V Y  + F+EKN D +++    +L+ S   L+ ++F  E   +    +P    G             GK S     +V  +FR+ L +LM+ L  +  +++RCIKPN    A +F+    + QL+  G+   + +   G+PSR  + + ++ Y+ ++       D+++ CK + + +      ++FG TK+FFR G++A  ++L R+D   ++    +++K    WL + ++ + +   + +
Sbjct:   79 NDLTALSYLHEPAVLHNLKVRFIDSKLIYTYCGIVLVAINPYETLP-IYGTDIINAYSGQNMGDMDPHIFAVAEEAYKQMARDERNQSIIVSGESGAGKTVSAKYAMRYFATVSGSASEANVEEKVLASNPIMEAIGNAKTTRNDNSSRFGKYIEIGFDKKYHIIGANMRTYLLEKSRVVFQADEERNYHIFYQLCASAHLPEFKALKLGGANDFHYTKQG-------RNPVI-------------------DGVDDAKEMSTTRNAFILLGINESYQMGLFQVLAAILHLGNVEVKDRDADSSIIPPNNRHLTVFCELMGVTY---QDMSHWLCHRKLKTATE----TYIK-PIPKLQAINARDALAKHIYAKLFNWIVDHVNKALHSTVKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEQIPWTLIDFYDNQPCINLIEAK-MGILDLLDEECKMPKGSDDSWAQKLYNTHLKTCTLFEKPRMSN----------KAFIIQHFADKVEYQCDGFLEKNKDTVNEEQIHVLKASKFDLLVELFQDEEKATSPTGAPPTTGGRTRLSVKPDKGKPGKSSKEHKKTVGLQFRNSLQLLMETLNATTPHYVRCIKPNDYKHAFTFDPKRAVQQLRACGVLETIRISAAGFPSRWTYQEFFSRYRVLMKQKDVLADKKMTCKNVLEKLVQDPDKYQFGKTKIFFRAGQVAYLEKL-RAD--KLRAACIRIQKTIRCWLARKKFLRMKRAAITI 802          
BLAST of Myosin vs. Ensembl Sea Lamprey
Match: myh10 (myosin, heavy chain 10, non-muscle [Source:ZFIN;Acc:ZDB-GENE-030616-162])

HSP 1 Score: 433.335 bits (1113), Expect = 6.018e-133
Identity = 276/811 (34.03%), Postives = 430/811 (53.02%), Query Frame = 2
Query:   14 YEMNEVVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQKTITAEYDQTFPVEEEE-RNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTEC---------YGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFE-EVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQ------------GAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPF--KESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKF-VDNQDCIDLVEKKGS--GIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLK-------SGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLAN--LDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQ 2335
            +    +VW P    G+   ++ +   + + V+L  +QK +T   D    +   +   V+D   L  LN  ++L+N+K RY+   IYTY     + +NPY  +P ++S+E I  Y+GK    +PPH+YA+ D AYR M  ++ +QSI+ +GESGAGKTE TK ++QYL            +GA  G +E+++ ++NP+LEAFGN+KTV+N+NSSR+GKF+ I+FD    + G  +  YLLEKSR  +Q+ +ER +HIFY++ +G  +  +    L+  +NY +L NG                           N+      D  +F  T ++M  +G T +E   +  +V+++LH GNI F+ E NT Q                           A+ LC+ +  A               G  Y  ++ A  +E A  A +ALAKA Y RLF  +V  +N+A+    ++ A+++GILDIAGFE FE NSFEQ CINY NEKLQQ FN  +   EQ  Y++EG+    I F +D Q CI+L+EK     GI+ +LDEE   PK  ++ F   L Q    H + Q P++        L+D   F + H+AG V Y  +E++ KN D L+D++ TLL  SS   + +++ K+V +       SG MT       +   K  F +V   ++ QL  LM  LRN+N NF+RCI PN    A   E   +L QL+C+G+   + + +QG+P+RI F +    Y+ + P+ +    +D +  C+ + K + L  + ++ G +K+FFR G +A  ++
Sbjct:   36 WSARRLVWVPSEKHGFEAASIKEERGDEVLVELAENQKKVTVNKDDVQKMNPPKFAKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVVNPYKNLP-IYSEEIIEMYRGKKRHEVPPHIYAVTDTAYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRKDHGA-PGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDERTFHIFYQLLSGAGEHLKTDLLLEGYNNYRFLSNG---------------------------NVVIPGQQDKDNFQETTSSMNIMGFTHEEQISLLRVVSSVLHYGNIVFKKERNTDQAS-------------------MPDNTAAQKLCHLLGIAVTDFTRAILTPRIKVGRDY--VQKAQTKEQADFAIEALAKATYERLFRWLVQRLNKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIEKPAGPPGILALLDEECWFPKATDKSFCEKLVQEQGTHPKFQKPKQ--------LKDKADFSVIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDKFVAELW-KDVDRIVGLDTVSG-MTDTAFGSTYKTRKGMFRTVGQLYKEQLTKLMATLRNTNPNFVRCIIPNHEKKAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIIFQEFRQRYEILTPNAIPKGFMDGKQACERMIKGLELDPNLYRIGQSKIFFRAGVLAHLEE 786          
BLAST of Myosin vs. Ensembl Sea Lamprey
Match: myo10l1 (myosin X, like 1 [Source:ZFIN;Acc:ZDB-GENE-080425-1])

HSP 1 Score: 427.557 bits (1098), Expect = 1.922e-125
Identity = 266/769 (34.59%), Postives = 418/769 (54.36%), Query Frame = 2
Query:  143 YDQTFPVEEEE-RNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECY-----GARAGP----IEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMV-AKVRKWLIKYRWRK 2416
            +D+  P+       V+D  +L  L+   +++N+ +R+  N IYTY+ +IL A+NPY  I  L+ K  + +Y    +G LPPH+YAIA++ YR +     +Q +++SGESGAGKTE+TK IL +L+E        A++GP    +E  I ES+P++EAFGN+KTV NNNSSR+GKF+++HF     + GG +  YLLEK+R+ +Q+  ERN+H+FY + AG + +++E   L  P++Y YL                             G ++D   +DVK F     AM+ +    +E  E+  +++ +L LGNIEF              S++  +     LLG    +L+E L  R     G+      +   L  E A ++R+++A A+YS+ F  I+  IN  I   ++   +GILDI GFE FE N FEQF INY NEKLQ++FN+ + + EQ+ Y +EG+    I ++DN +C+DL+EKK  G++ +++EES+ PK  +  FTM L + +  H   Q   K ++  H+       F I+H+AG V Y    F+EKN D   D L  +L  S +  +  +F +    SG      LK G    K    +V+++F+  L  LM +L  SN  F+RCIKPN+  +A+ FE   +L+QL+ SGM   + + + GYP R  F D Y+ YK +L +     D +  C  L +    K + ++ G TKVF R       ++L  ++      ++ A V  +L + R+R+
Sbjct:   46 HDKVSPMHSSSIEGVEDMSALADLHEGAIMHNLHLRFHDNKIYTYIGSILAAVNPYRLIDGLYDKAAVGRYAQNLLGELPPHIYAIANECYRCLWKRLDSQCVLISGESGAGKTESTKLILNFLSETSQGAGKAAQSGPTNTNVETAILESSPIMEAFGNAKTVYNNNSSRFGKFIQLHFSQQGFIQGGRILDYLLEKNRVVRQNPGERNFHVFYALLAGTTAEQKESLCLSEPNSYKYLAQS--------------------------GCISDDACDDVKSFEKVMTAMQVMAFVKEEVREVLKLLSGVLQLGNIEF------VTAGGAQISNKDVVSVVSELLGLDSLQLSEVLTQRSMILRGE-----EISTPLTIEQAEDSRNSMAMALYSQCFSWIIQKINGRIKGNDNFKSIGILDIFGFENFEVNRFEQFNINYANEKLQEYFNKHIFSLEQLEYNREGIIWEDINWMDNGECLDLIEKK-LGMLALINEESRFPKGTD--FTM-LEKLHGQHATNQFYTKPRVADHQ-------FGIKHYAGEVLYDVRGFLEKNRDTFRDDLLNVLRESGIDFIYDLFER---VSGGGGEETLKAG---AKQRRPTVSSQFKDSLHSLMASLSTSNPFFVRCIKPNMKKLAQRFEHVVVLNQLRYSGMLETVRIRRAGYPVRRPFQDFYSRYKVLLGNREVPDDPKGKCIALLRVYDAKNAAWQLGRTKVFLRDTLEQNLEKLRDTELHKSATLIRAHVLAYLARKRFRR 760          
BLAST of Myosin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000498.1 (pep scaffold:Pmarinus_7.0:GL479744:368:24152:-1 gene:ENSPMAG00000000443.1 transcript:ENSPMAT00000000498.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 396.741 bits (1018), Expect = 1.727e-123
Identity = 249/687 (36.24%), Postives = 385/687 (56.04%), Query Frame = 2
Query:  185 DDNCSLMFXXXXXXXXXIKIRYFQ-NNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYG-ARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAI-PFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQL-PRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMF---PKEVLKSGVMTSPILKKGHGIGKLSFVSVATK---------FRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKIL 2197
            +D  +L +L+ P +L+N+K+R+ + N+IYTY   +L+AINPY ++P ++ ++ I  Y G+++G + PH++A+A++AY+ M  ++ NQSIIVSGESGAGKT + KY ++Y     G A    IE+++  SNP++EA GN+KT RN+NSSR+GK++EI F+   ++ G  +  YLLEKSR+  Q+  ERNYH+FY++CA     E +   L+  + + Y   G                          GN     ++D +D   T  A   LGI       IF I+A ILHLGN+E +  +  +      +     L   C LLG +  ++A  LC+R  +   +    T ++  + R  A+NARDALAK +Y++LF  IV  IN+A+    +  +++G+LDI GFE FE NSFEQFCINY NEKLQQ FN  V   EQ  Y +E +  T I F DNQ CIDL+E K  G++D+LDEE K+PK +++ +   L++ +    +  L PR S +           F+I HFA  V Y  + F+EKN D +++    +L+ S  +L+   F   P  +  +G    P  ++    G     S  TK         FR+ L +LM+ L  +  +++RCIKPN   +A +F+    + QL+  G+   + L   GYPSR  + + +N Y+ ++
Sbjct:    5 NDLTALSYLHEPAVLHNLKVRFAESNHIYTYCGIVLVAINPYEQLP-IYGEDIIFAYSGQNMGDMDPHIFAVAEEAYKQMARDEKNQSIIVSGESGAGKTVSAKYAMRYFATVGGSASEANIEEKVLASNPIMEAIGNAKTTRNDNSSRFGKYIEIGFNRQYLIVGANMRTYLLEKSRVVFQAEEERNYHVFYQLCASAELPEFKDLHLEPAEAFVYTAQG--------------------------GNAVIEDVDDGEDLERTRRAFTLLGIGASYQMGIFKIIAGILHLGNVEVQSQD-REQETCFVNKEDKHLNIFCELLGLERDQMAHWLCHRKISTGAE----TYVK-PMGRAQAQNARDALAKHVYAQLFSWIVHRINKALRSSTKQHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFNLHVFKLEQEEYMREEIPWTLIDFYDNQPCIDLIEAK-LGVLDLLDEECKMPKGSDQSWAQKLYEKHLGRGKHFLKPRMSNV----------AFIICHFADKVEYQCDGFLEKNRDTVYEEQINILKASQSSLLTLAFVSRPPCLHPTGT-PPPRRRRNSTEGNRHRSSARTKARSHVATFQFRNSLHLLMETLNATTPHYVRCIKPNDDKMAFTFDPKRAVQQLRACGVLETIRLSAAGYPSRWTYQEFFNRYRVLM 646          
BLAST of Myosin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005411.1 (pep scaffold:Pmarinus_7.0:GL476612:1285:44967:1 gene:ENSPMAG00000004885.1 transcript:ENSPMAT00000005411.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 389.808 bits (1000), Expect = 1.340e-116
Identity = 262/793 (33.04%), Postives = 417/793 (52.59%), Query Frame = 2
Query:   14 YEMNEVVWAPEPIEGYVKGNVID-IGSNTITVKLLNSQKTITAEYD---QTFPVEEEERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKI--NKVNQSIIVSGESGAGKTETTKYILQYLTECYG-------ARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDL-KSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCN---RITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANY-VGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKF-VDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKI-LPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFD 2332
            +++ +  W  +  EG+++  + D  G NT++VK   + +    + D   +  P + E+  ++D  +L FLN  ++LNN+K RY +  IYTY     + INPY  +P ++       Y+GK    +PPH+++I+D AY DM I  +K NQS++++GESGAGKTE TK ++QY     G       ++ G +E +I ++NP+LEAFGN+KT RNNNSSR+GKF+ IHF  +  ++G  +  YLLEKSR+  Q   ER YHIFY++ +G      E+  L  +P  Y  +  G T                       + N++D++     +   T  A   LG T +E   ++ +   I+H GN++F +        Q              L G   +EL + +     ++ N   Q  Q       L ++   ++  ALAKAIY R+F  +VA +N+ +   +   Y +G+LDIAGFE FE NSFEQ CIN+ NEKLQQFFN  +   EQ  Y+KEG+    I F +D   CIDL+EK   GI  IL+E+   PK  +  F  A++    NH     P + K KA +       F + H+AG V Y+T+ ++EKN D L++++ +L + SS+ L+  +F +E            K+  G    +F +V+  +R QL  LM  L +++ +F+RCI PN    +   +   IL QL C+G+   + + ++G+P+R  + +    Y  I L +     D +   + + K+  L E +++ G TKVFFR G + + +
Sbjct:   29 FDIKKNCWVKDEKEGFLQALIQDDHGDNTVSVKFTVNNEIAKVKKDIVQEMNPPKFEQ--IEDMANLTFLNEASVLNNLKERYVKMRIYTYSGLFCVTINPYKWLP-IYGSRVAKMYRGKKRNEVPPHLFSISDNAYSDMLITADKANQSMLITGESGAGKTENTKKVIQYFANIGGGTKQIDQSKQGSLEDQIIQANPVLEAFGNAKTTRNNNSSRFGKFIRIHFAVSGKLSGADIETYLLEKSRVISQQPAERGYHIFYQLLSGKVPNLLEEIGLVNNPKEYASISQGVT----------------------SVENMDDAE-----EMMLTDEAFDVLGFTPEEKMSLYKLTGGIMHFGNMKFRQ---KPREEQAEVDGTEVADRVASLAGIDSSELQKGITRPKVKVGNEYVQKNQNMDQVYHLPQK-CMSSIGALAKAIYDRMFKWLVARVNKTLDTTKPRQYFIGVLDIAGFEIFEFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGINWVFIDFGLDLAACIDLLEKP-MGIFSILEEQCVFPKATDATFKAAMYD---NHLGKSAPFQ-KPKAGKKAGQEATFELVHYAGTVGYNTQGWLEKNKDPLNETVVSLFQNSSMPLLSVLFKEEEAADASSAGAKQKQKKGS---AFQTVSVFYREQLNKLMATLHSTSPHFVRCIVPNEFKKSGVVDAHLILHQLACNGVLEGIRICRKGFPNRTLYPEFVQRYSIINLLAGKTETDPKAITEKVLKSTNLVEDEYRIGFTKVFFRAGVLGKLE 779          
BLAST of Myosin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001434.1 (pep scaffold:Pmarinus_7.0:GL493165:42961:106906:1 gene:ENSPMAG00000001264.1 transcript:ENSPMAT00000001434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 384.415 bits (986), Expect = 1.922e-114
Identity = 246/720 (34.17%), Postives = 370/720 (51.39%), Query Frame = 2
Query:  182 VDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINE----SNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKK--GSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDC-EGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRI---KFIDLYNIY-KKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFR 2308
            VDD   L  ++   +++N+K RY  + I+TY+  +LI++NP+ ++P    KE  L Y+G +    PPH+YA+AD  YR+M I++ NQ +I+SGESGAGKT   KYI+ Y+++  G   G   Q + +    SNPLLEAFGN+KTVRNNNSSR+GK+ EI F       GG +S++LLEKSR+  Q+  ERN+HI+Y++       ++E   + +PD Y YL           N+      D                ++D KDF  T  AM+ +GI  +    +  IVA ILHLGN+ F E             +  +          +   L E L +R  ++   G   T + + L  E A   RDALAKA+Y+R+FD +V  INRAI        VG+LDI GFE F+KN FEQFCIN+ NEKLQQ F E  L  EQ  Y +EG+  T I + +N+   DL+E K    GI+ +LD+         E     L Q            ++++ +H       +GF++ H+AG V Y  E F E+N D L   L  L+++S  + +  +FP+ +           KKG         +VA+K + Q   L++ L     ++IRCIKPN +   + +E   +  Q +  G+   + + + GY  R    KF+  Y I  ++  P    + ++R   + L + V +    ++ G TKVF +
Sbjct:   19 VDDMVLLPKISEDAIVDNLKKRYMDDFIFTYIGPVLISVNPFKQMPYFTDKEIEL-YQGAAQYENPPHIYALADNMYRNMLIDQENQCVIISGESGAGKTVAAKYIMSYVSKVSGG--GSKVQHVKDIILLSNPLLEAFGNAKTVRNNNSSRFGKYFEIQFSRGGEPDGGKISNFLLEKSRVVSQNPQERNFHIYYQLTEAAVGDQKESLGITTPDYYYYL-----------NQSGAYKVDD---------------IDDRKDFQETMKAMRVIGIPAEHQQMVLQIVAGILHLGNLSFREAGNYAAVENDDFLAFPAFLLG-----IEQARLKEKLTSRQMDSKWGGKSET-IEVTLNVEQANYTRDALAKALYARVFDYLVEAINRAIQKDHEEYNVGVLDIYGFEIFQKNGFEQFCINFVNEKLQQIFIELTLKAEQEEYVQEGIKWTPIDYFNNKIVCDLIENKVNPPGIMSVLDDVCATMHAKGEGADATLLQK----------LRAQIGSHEHFNSWNQGFIVHHYAGKVSYDVEGFCERNRDVLFTDLIELMQSSEHSFIQALFPENIQSE--------KKGRP------TTVASKIKKQANDLVNTLMKCTPHYIRCIKPNETKRPRDWEESRVKHQAEYLGLRENIRVRRAGYAYRRIFKKFLQRYAILTRETWPE--WHGEERKGVEYLLRTVNMDPDQYQMGRTKVFVK 677          
BLAST of Myosin vs. Ensembl Yeast
Match: MYO2 (Type V myosin motor involved in actin-based transport of cargos; required for the polarized delivery of secretory vesicles, the vacuole, late Golgi elements, peroxisomes, and the mitotic spindle; MYO2 has a paralog, MYO4, that arose from the whole genome duplication [Source:SGD;Acc:S000005853])

HSP 1 Score: 421.009 bits (1081), Expect = 7.903e-125
Identity = 293/875 (33.49%), Postives = 452/875 (51.66%), Query Frame = 2
Query:   14 YEMNEVVWAPEPIEGYVKGNVI----DIGSNTITVKLLNSQ------KTITAEYDQTFPVEEEERN------VDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPI---------EQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPT-ELAESLCNRITNAAGQGAQYTALRIALKRED----------ARNARDALAKAIYSRLFDEIVAFINRAI--PF--KESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQT---NPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKK-------GHGIGKLSFV----SVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANL----------DQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIK 2446
            +E+    W P    G++   VI    + G   + ++L + +      K +  + DQ+ P+    RN       +D  SL +LN P +L+ IK RY Q NIYTY   +LIA NP+  + +L++++ I  Y GK  G L PH++AIA++AYR MK +K NQ+I+VSGESGAGKT + KYI++Y        +  +         EQ+I  +NP++EAFGN+KT RN+NSSR+GK++EI FD ++ + G  +  YLLE+SR+  Q   ERNYHIFY++ AG+  + +E+  L    +Y Y+  G                          G+   + ++D K++  T +A+  +GIT +   +IF I+AA+LH+GNIE ++                           +P  +LA   C  +   A   A++   +  + R +          A  A+D++AK IYS LFD +V  IN  +  P    + ++++G+LDI GFE+FEKNSFEQFCINY NEKLQQ FN+ V   EQ  Y KE +  + I+F DNQ CIDL+E K  GI+ +LDEES+LP  ++E +T  L+QT   +P +     PR  + K          F++ H+A  V Y  E FIEKN D + D    +L+ S+   +  +   E L+         KK           G +  V    ++ + F+  LI LM+ + ++N ++IRCIKPN    A  F+   +LSQL+  G+   + +   G+PSR  F +    Y  ++P    +L          D     K++  A    +S ++ G TK+FF+ G +A  ++L  +   N   M+ K  K   KY +RK    + + IK
Sbjct:    3 FEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSLPLL---RNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSATVQHQVEMSETEQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLTDASDYFYMNQG--------------------------GDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSAD-----------------EPNLKLA---CELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFNDNQPCIDLIENK-LGILSLLDEESRLPAGSDESWTQKLYQTLDKSPTNKVFSKPRFGQTK----------FIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLINIL--EGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLRSNKMHNSIVMIQK--KIRAKY-YRKQYLQISQAIK 812          
BLAST of Myosin vs. Ensembl Yeast
Match: MYO4 (Type V myosin motor involved in actin-based transport of cargos; required for mRNA transport, including ASH1 mRNA, and facilitating the growth and movement of ER tubules into the growing bud along with She3p; MYO4 has a paralog, MYO2, that arose from the whole genome duplication [Source:SGD;Acc:S000000027])

HSP 1 Score: 392.889 bits (1008), Expect = 1.911e-115
Identity = 282/821 (34.35%), Postives = 427/821 (52.01%), Query Frame = 2
Query:   14 YEMNEVVWAPEPIEGYVKGNVI--DIGSNTITVKL-LNSQKTITAEY-----DQTFPVEEEERN------VDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGA--RAGP-----IEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKE------SANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMAL---FQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSP----ILKKGHGIGKLSF--VSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDL---------YNIYKKILPS-NLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQL 2338
            +E+    W P   +G++ G V   D    T  ++L L   +T++ E      D   P     RN       DD  +L +LN P +L+ IK RY    IYTY   +LIA NP+ ++  L+S+E I  Y  K    L PH++AIA++AYR M   K NQ+++VSGESGAGKT + KYI++Y      +  R G      IE +I  +NP++EAFGN+KT RN+NSSR+GK+++I FD N+ + G  +  YLLEKSR+  Q   ERNYHIFY++  G+ +  +++  L SP +Y+Y   G                          G  N + +++ +++  T +A+  +GI  +    IF I+A +LH+GNIE +            SS + +LQ  C LLG  P   A+ +  +      +      +   L    A  ARD++AK IYS LFD +V  IN+ +   E        +++GILDI GFE+FEKNSFEQFCINY NEKLQQ FN+ V   EQ  Y KE +  + I+F DNQ CIDL+E K  GI+ +LDEES+LP  ++E +   L   F   P++     PR  + K          F++ H+A  V Y  E FIEKN D++      + + ++  +  Q+     L+S    +P      KK     +LS    ++ + F+  L  LM  + ++N ++IRCIKPN       F+   +LSQL+  G+   + +   G+PSR  F +          Y+++  IL + +L       FC+ +  A     + ++ G TK+FF+ G +A  ++L
Sbjct:    3 FEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPTLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSSPKDYHYTNQG--------------------------GQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMK----MTRNDASLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSE-----KIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFSDNQPCIDLIENK-LGILSLLDEESRLPSGSDESWASKLYSAFNKPPSNEVFSKPRFGQTK----------FIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNPIFKQILDNRELRSD--DAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKL 775          
BLAST of Myosin vs. Ensembl Yeast
Match: MYO1 (Type II myosin heavy chain; required for wild-type cytokinesis and cell separation; localizes to the actomyosin ring; binds to myosin light chains Mlc1p and Mlc2p through its IQ1 and IQ2 motifs respectively [Source:SGD;Acc:S000001065])

HSP 1 Score: 388.652 bits (997), Expect = 1.331e-112
Identity = 286/848 (33.73%), Postives = 435/848 (51.30%), Query Frame = 2
Query:   23 NEVVWAPEPIEGYVKGNVI--DIGSNTIT--------VKLLNSQKT---ITAEYDQTFPVEEEERNVDDNCS-LMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGK------------SIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYL---TECYGARAGPI---------EQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPD--NYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARD----------------ALAKAIYSRLFDEIVAFINRAIPFKESA-NYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKF-VDNQDCIDLVEKKG--SGIIDILDEESKLPKPNNEHFTMALFQT---NPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKS---GV---MTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANL--------DQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQ 2335
            N +VW P+  E +VKG ++  DI  N  T        V  L+S +    +       FPV     +  +N S L  LN P++L N++ RY  + IYTY    L+AINPY  +  L+S++ I  Y  K            S   LPPH++AIA++AY ++     +QSI+V+GESGAGKTE TK ILQYL   T    +   P+         E +I +SNP+LE+FGN++TVRNNNSSR+GKF++I F+ + ++ G  +  YLLEKSRI  Q+S ERNYHIFY++ +G+   E +   LKS +  +Y  L N                                  +NDV++F    +A+  +G +  +   IF +VA IL +GNIEF                   +        FK      ++C+ +      G      + A+ R  ++  ++                AL++ +Y RLF  IV  IN+ +    +  NY+G+LDIAGFE FE NSFEQ CINY NEKLQQFFN  +   EQ  Y KE +    I +  D Q  IDL+E KG  +G++ +LDEE+ LPK  +E F   L  T   N + F     ++S+LK         GF+++H+AG V Y  E ++ KN D L+D+L +LL +S   ++ ++F  E  KS   GV   +++  +KK       +F + +++ R Q I L++ L +++ +F+RCI PN     K+F    IL QL+C+G+   + L ++GYP+RI F + +  Y+ + P N              +  C+ L  ++ L    +K G TK+FF+ G +A+ ++
Sbjct:   10 NMIVWIPDEKEVFVKGELMSTDINKNKFTGQEEQIGIVHPLDSTEVSNLVQVRISDVFPVNPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNL-NLYSEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKTENTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNLRLKSRNVKDYKILSNSNQDIIPG--------------------------INDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLIGNIEF-------------------VSDRAEQASFKND--VSAICSNL------GVDEKDFQTAILRPRSKAGKEWVSQSKNSQQAKFILNALSRNLYERLFGYIVDMINKNLDHGSATLNYIGLLDIAGFEIFENNSFEQLCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLLDEEAVLPKSTDESFYSKLISTWDQNSSKF-----KRSRLK--------NGFILKHYAGDVEYTVEGWLSKNKDPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKSARTS--TFKTTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLAREGYPNRIAFQEFFQRYRILYPENSTTTTFSSKLKASTKQNCEFLLTSLQLDTKVYKIGNTKLFFKAGVLADLEK 788          
BLAST of Myosin vs. Ensembl Yeast
Match: MYO5 (One of two type I myosin motors; contains proline-rich tail homology 2 (TH2) and SH3 domains; MYO5 deletion has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO5 has a paralog, MYO3, that arose from the whole genome duplication [Source:SGD;Acc:S000004715])

HSP 1 Score: 347.051 bits (889), Expect = 1.060e-100
Identity = 230/714 (32.21%), Postives = 361/714 (50.56%), Query Frame = 2
Query:  236 IKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYL---TECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEF---EEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAI-PFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVE-KKGSGIIDILDEESKLPKPNNEHFTMA------LFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRI---KFIDLYNI------YKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFR 2308
            +K R+    IYTY+ ++LI++NP+ ++  +++   + +YKGK+   +PPHV+AIA+  Y +MK    NQ +I+SGESGAGKTE  K I+QY+   +  +    G I+  +  +NPLLE+FG +KT+RNNNSSR+GK++EI F+N      G +++YLLEK R+  Q  NERN+HIFY+   G S   R+ + ++ P+ Y Y    T    C   E                       ++D++D+  T  AM+ +G+  +E  +IF ++AAIL +GN+ F   EE N       ++      LQ   +L       L +SL  RI        + +   + L    A   RDALAKAIY+ LFD IV+ +N+++  F  +   +GILDI GFE FE NSFEQ CINY NEKLQQ F +  L  EQ  YE+E +  T IK+ DN+   DL+E ++  GI   +++       ++     A      LF TNP               H DLR  + F+I+H+AG V Y  +   +KN D L   L  L+ T++ T +  +FP  V +      P              +   K       L++ L  +  ++IR IKPN +     ++   +L Q++  G+   + + + G+  R    KF++ + +      Y          LD     K + +   + + +++ G+T VF +
Sbjct:   56 LKKRFLNATIYTYIGHVLISVNPFRDL-GIYTDAVMNEYKGKNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASSTHTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVY----TAAAGCISAET----------------------IDDLQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIENEEGNAQVRDTSVTDFVAYLLQIDSQL-------LIKSLVERIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVSRVNKSLQAFPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQETYEREKIQWTPIKYFDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRLNLFTTNP---------------HFDLRSNK-FVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLATIFPDTVDRESKRRPP--------------TAGDKIIKSANDLVETLSKAQPSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSPHCSYAGDYTWQGDTLDA---VKYILQDSSIPQQEYQLGVTSVFIK 702          
BLAST of Myosin vs. Ensembl Yeast
Match: MYO3 (One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO3 has a paralog, MYO5, that arose from the whole genome duplication [Source:SGD;Acc:S000001612])

HSP 1 Score: 345.51 bits (885), Expect = 7.311e-100
Identity = 230/711 (32.35%), Postives = 357/711 (50.21%), Query Frame = 2
Query:  236 IKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARA---GPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEF---EEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAI-PFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKG-SGIIDILDEESKLPKPNNEHFTMA------LFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILP------SNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFR 2308
            +K R+    IYTY+ ++LI++NP+ ++  +++   +  YKGK+   +PPHV+AIA+  Y ++K    NQ +I+SGESGAGKTE  K I+QY+     + +   G I+  +  +NPLLE+FG +KT+RNNNSSR+GK++EI F++      G +++YLLEK R+  Q  NERN+HIFY+   G S   ++ + ++ P+ Y Y    T    CT  +                       ++DVKD+  T  AM+++G+  +E  +IF ++AAIL +GNI F   EE N   G   ++      LQ    L       L + L  RI   +    + +   + L    A   RDALAKAIY+ LFD IV  +N ++  F  +   +GILDI GFE FE NSFEQ CINY NEKLQQ F +  L  EQ  YE+E +  T IK+ DN+   DL+E K   GI+  +++       ++     A      LF +NP +F L+                  F+I+H+AG V Y      +KN D L   L  L+ T++ T +  +FP +V K      P              +   K       L++ L  +  ++IR IKPN +     ++   +L Q++  G+   + + + G+  R  F      +  + P          + D     KL+ +   + E +F+ G+T VF +
Sbjct:   56 LKKRFKNGIIYTYIGHVLISVNPFRDL-GIYTNAVLESYKGKNRLEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIAAASNSHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLLEKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIY----TAAAGCTTADT----------------------IDDVKDYEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIENEEGNAQVGDTSVTDFVAYLLQVDASL-------LVKCLVERIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIVDRVNVSLQAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQETYEREKIKWTPIKYFDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQRLNLFNSNP-YFELR---------------ANKFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLSTIFPDDVDKDSKRRPP--------------TAGDKIIKSANELVETLSKAEPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPDCSYAGDYTWDGDTLEAVKLILRDAMIPEKEFQLGVTSVFIK 702          
BLAST of Myosin vs. Ensembl Nematostella
Match: EDO36037 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJR5])

HSP 1 Score: 1029.62 bits (2661), Expect = 0.000e+0
Identity = 586/1259 (46.54%), Postives = 818/1259 (64.97%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEEE-RNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGA-RAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKG---HGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKS-DKGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELT-------VDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQA-------VPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEEL--SKPVEISNNQKTNN---------DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSF-----SESQVQLQP---VKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQR 3670
            +W P+   GY+ G+++DIGS+ ITV+L   + K +TA YD+TFP E++  ++V+DNC+LMFLN   LLNN+++RY ++ IYTYVANIL+A+NPY E+ +L++KETI+KY GKS+GTLPPHV+AIAD+AYRDM+  K +QSI+VSGESGAGKTE+TKYIL+YLTE +G+   G IEQRI E+NPLLE+FGN+KT+RN NSSR+GK+VE+HF+   IV GGF+SHYLLE+SRIC QS  ERNYH+FYR+CAG  ++ ++   L    ++NYL  G+                           L+D  L+D  DF     +M ++G + +E + I+ +VAA+LHLGNI FE+++ + GGCQ+SS     +    +LLG  P EL ++L  R+ +A G       +R+ LK E A  ARDALAK+IY++LFD IVA +N+  PF  S  Y+G+LDIAGFEY+E NSFEQFCINYCNEKLQQFFN+R+L + +I+  +  +   ++    NQ    L+E K +GI+DILDEESKLPKP + HFT  +   + NHFRL LPRKS L  HR+LRD EGFLIRHFAGAVCYHT+EFI+KNNDALH+ L  L+  S  + +  +FP        +   +   G    G  KL+FVSV +KFR+QL  LMD L ++  +FIRCIKPN  M A  FEGGSILSQL+C+GM  VL LMQ G+PSR +F +LY +YK  LPS LA LD R+FC+ LF A+G+ + D+KFG +K+FFRPGK AEFD ++++DPEN+K +V+KV  WLI+ RWR+A +G L VIKL NKIK+R Q II+IQKT++M+I   +   + + + K+R L + ++ L  +A+ LKK  DK  K I   +   +  QS I+   S  M    ++ID    +L         D+N  QK+   +KI  E+E+LR IQE+M + +++ E+E+   KQ EEE++ K E E  ++ EEE+ +R +        + K  + +E ++ ++ I     +QERRD+ELA+R+A     I+ +   S+ ++ S N   +N         D+T++ Y ELR  IN+SCD++L+EAC+ EFHRR+  Y++WK   K +        + +      +E+   + P    + PE    +     QR+F +PF     K        QG W AHFDG+++ARQ+E H  K   LLV+G DDL MC L L  TGL  R+GAEI + +FE LW   GG   + R
Sbjct:    7 LWVPDNEHGYLLGSIVDIGSDEITVQLDGFKGKHVTAPYDRTFPAEKDSNKDVEDNCALMFLNEGTLLNNLRVRYKKDKIYTYVANILLAVNPYHEVKELYTKETIMKYHGKSLGTLPPHVFAIADKAYRDMRAYKQSQSIVVSGESGAGKTESTKYILRYLTESWGSGDQGRIEQRIVEANPLLESFGNAKTMRNINSSRFGKYVEVHFNEKVIVVGGFISHYLLEQSRICMQSKGERNYHVFYRLCAGAPKQIKDMLRLTRAQDFNYLNQGS---------------------------LSDPNLDDTSDFKRMDASMDNVGFSKEEKSNIYRVVAAVLHLGNIIFEDIDDTHGGCQVSSKCSDEVNITAKLLGVSPEELQQALTTRLMSAGG-----ADVRVPLKLEQAYAARDALAKSIYTKLFDHIVAQVNQCFPFTSSFTYIGVLDIAGFEYYELNSFEQFCINYCNEKLQQFFNDRILKQYRIIPAQPSINQDRVTPAINQSGSHLIEAKKTGILDILDEESKLPKPTSAHFTSDIHLKHKNHFRLALPRKSPLMYHRNLRDDEGFLIRHFAGAVCYHTQEFIDKNNDALHNDLAELISESKDSFVKSLFPSASGNGDRIIGGVTMAGSGRQGSKKLAFVSVGSKFRTQLQQLMDKLDSTGASFIRCIKPNGKMSANLFEGGSILSQLECAGMVSVLALMQDGWPSRTQFTELYQMYKNFLPSKLARLDPRMFCRALFHALGMSDKDYKFGSSKIFFRPGKFAEFDAVMQTDPENLKKLVSKVTTWLIRTRWRRAIYGTLSVIKLANKIKFRTQAIIRIQKTVKMFIAVTRHKPRYQGIMKIRRLEVQVDNLAQLASSLKKDKDKVSKQIQDLR---NATQSAIKKIKSTMMKR--KMIDEVYCDLVKRVNHHLADLNERQKQ---QKIAEEQERLRKIQEQMELERKRREEEERKRKQEEEERKRKEEEEQKKRDEEERKRREKEEKDRQFQLEKQRLAEEEQKRQAMI-----DQERRDRELAMRLANDPDAIINDQPESQTLQRSVNTLGSNLPAKPEKKYDLTKWKYAELRDTINTSCDIELLEACREEFHRRLKVYHHWKKANKSRDPSQDAGDQRAPQDIMQAENAPPIPPRAHTQEPEVPPALPPRRQQRFFRVPFVRPKDKYRESEYRKQGWWFAHFDGQWVARQMEFHPGKDPLLLVSGEDDLDMCELSLDETGLTRRQGAEIAQQEFEVLWHQFGGTPRVYR 1220          
BLAST of Myosin vs. Ensembl Nematostella
Match: EDO41819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A8])

HSP 1 Score: 430.639 bits (1106), Expect = 2.847e-130
Identity = 279/782 (35.68%), Postives = 421/782 (53.84%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVI-DIGSNTITVKLLNSQKTITAEYDQTFP-VEEEERNVDDN--CSLMFXXXXXXXXXIKIRYFQNN-IYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARA-GPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAI-PFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTN---PNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLS--FVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQ-RLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQL 2338
            VW P P   ++ G +  DI    + + L + ++ I        P +   E  V +N   +L +L+ P +L+N+ +R+ Q+N IYTY   +L+AINPY E+P L+  + +  Y+G+S+G + PH++A+A+ A++ M  ++ NQS+IVSGESGAGKT + KY ++Y +   GA     IE+++  +NP++EA GN+KT+RN+NSSR+GK++EI FD N  + G  +  YLLEKSR+  Q++ ERNYH+FY+MCA     E + + L  PDN++YL  G                            + DS ++D   F     A+  +GI D E   +F I++AILHLGN+E  +             +   L+    LLG    +L + LCNR     G+      L   L   +A   R+A++K IYS+LF  +V  IN  +    +  +++G+LDI GFE FE NSFEQFCINY NEKLQQ F + V   EQ  Y +E +  + I F DNQ CIDL+E K  GI+D+LDEE K+PK ++  +   L++ +     HF    PR S L           F+I HFA  V Y    F+EKN D ++D    LL  S   ++ +MF +    S        + G   GK    F SV ++F   L  LM+ L ++  +++RCIKPN +     F     + QL+  G+   + +   GYPSR  + + +  Y  +LPS   N  + R   KL+ +     E  F+ G TK+FFR G++A  ++L
Sbjct:    3 VWIPHPDLVWIGGELTKDIEDKILEILLEDGREIIIDTRKSRLPPLRNPEILVGENDLTTLSYLHEPAVLHNLNVRFIQSNAIYTYCGIVLVAINPYEELP-LYGPDIVAAYRGRSMGDMDPHIFAVAEDAFQSMIRDERNQSVIVSGESGAGKTVSAKYAMRYFSAVGGASTETQIEKKVIATNPIMEAIGNAKTIRNDNSSRFGKYLEISFDRNHHIIGAHMRTYLLEKSRVVFQAAEERNYHVFYQMCAACELPEMKDFRLAHPDNFSYLNQGD-------------------------APVVDS-IDDADCFEELREALSMVGINDDEQLMLFRILSAILHLGNVEILQAGD---DECTVEENDFHLEMTAVLLGIDKNQLRKWLCNRKIVTVGE-----VLIKPLSITEANYGREAISKRIYSQLFKWVVNTINCTLTSTSKPHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFTQHVFKLEQDEYVREEIQWSFINFYDNQPCIDLIEAK-LGILDLLDEECKMPKGSDSQWAQKLYKQHLQKSKHF--SKPRMSNL----------AFVIHHFADHVEYFVSGFVEKNRDTVNDEHLALLRASEDEMVGEMFTENDAHSAPRKRAASRAGKQGGKGGKMFKSVGSQFSVSLSKLMETLNSTTPHYVRCIKPNDTKAPFEFHPKRSIQQLRACGVLETIRISAAGYPSRWTYREFFARYIMLLPSKKINRKKPRETIKLILETFIKDEDMFQMGKTKIFFRAGQVAYLEKL 736          
BLAST of Myosin vs. Ensembl Nematostella
Match: EDO45563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSH2])

HSP 1 Score: 398.282 bits (1022), Expect = 2.801e-122
Identity = 245/700 (35.00%), Postives = 368/700 (52.57%), Query Frame = 2
Query:  242 IRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKY-KGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFE---EVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESA-------NYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFR 2308
            IRY  N IYTYV ++L+A+NPY   P ++    I +Y K  +   LPPH+YA  + ++  MK  K NQ +++SGESGAGKTE+TK+ILQYLT   G R   IE++I ++NP+LEAFGN+KT+RN+NSSR+GK++++HF+++ ++ G  + HYLLE+SRI  Q  NERNYHIFYRM AGMS +E++   L    +Y YL  G                            L    ++D  ++     AM +L  T++E   IF  +AA+LHLGNI FE   E N          +  ++           P E  E    R +  A     Y+ + +    E A + RDA  K +YS++F  IV  IN +I +K            +G+LDI GFE F+ NSFEQ CINY NE LQQFF  ++   EQ  Y++EG+    + FVDNQ+ +D++ +K    I ++DEES+ P+  +E F   L   + ++     P KS++++         F + HFAG V Y T  F++KN +     L  L+ +S       MF KE      M +   K+   +G         +FR  L VLM  L +  + F+RC+KPN       F+      QL+ SGM   + + + GY  R  F +    Y  ++  +L ++  R    L+  ++ L + ++K G  ++F +
Sbjct:   86 IRYRANKIYTYVGSVLVAVNPYCSFP-IYGTAYISRYQKAVNATDLPPHIYATGEMSFAMMKREKHNQCVVISGESGAGKTESTKFILQYLTAVSG-RHSTIEEQILDANPILEAFGNAKTIRNDNSSRFGKYIDVHFNDSWVIEGAKIDHYLLEQSRIVAQMPNERNYHIFYRMLAGMSPQEKKSLHLTHAQDYYYLSQGNC--------------------------LTCEGMDDAYEYDVIRKAMTALWFTEEETQFIFRSIAAVLHLGNISFEAKMEDNIEACDVMNPETVAAAADLLQV-----PKEHMEEAFTRKSTFAEGEMIYSPVSV----ERATDIRDAFVKGLYSKVFIWIVNKINSSI-YKPRGKDDTSGRQSIGVLDIFGFEKFDMNSFEQLCINYANENLQQFFVAQIFKNEQEEYDREGIEWNFVTFVDNQEVLDMLAEKPMNFIALIDEESRFPQGTDESFLDKLNYNHKDNKHFVRP-KSRVQSQ--------FGVVHFAGTVYYDTTGFLDKNRNTFSADLVDLISSSKCNFFLNMFFKE----RSMGTETRKRSPTLG--------VQFRRSLDVLMKTLASCRSFFVRCVKPNNYKKPMEFDRELCWQQLRYSGMLETVRIRKSGYAMRHTFEEFVTRYHMLVRDSLRDMSSRDASHLIATSL-LGQENWKLGTKRIFLK 725          
BLAST of Myosin vs. Ensembl Nematostella
Match: EDO49515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF6])

HSP 1 Score: 384.03 bits (985), Expect = 2.071e-114
Identity = 253/726 (34.85%), Postives = 390/726 (53.72%), Query Frame = 2
Query:  245 RYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGA--RAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDL-KSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESA--NYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEG-FLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANL--DQRLFCKLLFKAVGLKESDFKFGMTKVFFR-PGKMAEFDQLIRSDPENVKGMVAKV-RKW 2392
            RY    IYTY+ N++++INPY + P L+++E I +Y+ ++I  LPPH+YAIAD AYR M+ +  +Q II++GESG+GKTE +K I+QY+    G       +++++ +SNP+LEAFGN+KT+RN+NSSR+GK+++I FD      GG ++ YLLEKSR+  Q+  ERN+HIFY +  G S    +   L +  D Y+YL           N+   +S  +K               +D +DF+    AM+ +G T+ E + ++ +++AIL+LGN E EE  TS G   ++  ++  L++ C +L      L  SL  R      +   +T L +A     A  ARDALAKA+Y RLF  IV  +N +I  ++      +G+LDI GFE F  NSFEQF INYCNEKLQQ F E  L  EQ  Y +EG+  T I++ +N    +L+EK  SGI+ +LDEE   P   ++   +        H      RK K K   D     G F ++H+AG V Y  + F++KNND L   L   + + +  L  ++FP+          P              + AT+F+  +  LM NL++ N N+IRCIKPN    A  F+   I  Q++  G+   + + + G+  R ++      YK + P    N     R     L K + +K +++ +G TK+F R P  +   ++  +   E++  ++ K+ R W
Sbjct:   44 RYNAKAIYTYIGNVVVSINPYRKFP-LYTREVIAEYRSRNIYELPPHIYAIADDAYRSMRDHNKDQCIIITGESGSGKTEASKVIMQYVAAVCGKGREVDRVKEQLLQSNPILEAFGNAKTLRNDNSSRFGKYMDIEFDFKGDPVGGVITKYLLEKSRLVYQNKGERNFHIFYHLLRGASDNLLDDLRLTRDFDGYHYL-----------NQSECVSVPTK---------------DDKEDFSVVEKAMEVVGFTEDEISAVYKLLSAILNLGNTELEEFTTSDGTEAVTVLNEQVLKNTCEMLQCDVELLLNSLRERTVETKTERV-HTPLNVA----QASYARDALAKAVYQRLFAWIVDRVNDSIQVRKRGKRKVIGVLDIYGFEIFVDNSFEQFIINYCNEKLQQIFIELTLKSEQEEYVREGIEWTTIEYFNNAVICELIEKNHSGILALLDEECLRPGEVSDLTFLEKLDKQWIHHEHYESRKDK-KYLSDKTLPHGYFRLKHYAGKVTYDVDGFLDKNNDLLFRGLSQCMYSCNHPLTKKLFPEGCPTKSSKRRP-------------KTTATQFKESVAELMKNLKSKNPNYIRCIKPNERKAAGVFDERLIKHQVRYLGLMENIRVRRAGFAFRQEYPVALQRYKMLCPRTWPNWLGAPRDGIVELLKHLNVKPTEYAYGRTKIFIRNPRTLFALEEKRKDGMEDLAVIIQKIFRGW 723          
BLAST of Myosin vs. Ensembl Nematostella
Match: EDO31924 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWK4])

HSP 1 Score: 362.073 bits (928), Expect = 4.994e-111
Identity = 222/647 (34.31%), Postives = 346/647 (53.48%), Query Frame = 2
Query:  236 IKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQM----FPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKF 2164
            +K+++ +N++ TY+  IL+++NPY ++   ++ E + KY  ++IG LPPH++AI   AY +++    +Q I++SGESGAGKTE+TK ++QYL      +     ++I E+ PLLE+FGN+KTV+N+NSSR+GK++EI FD+   + G  +S YLLE+SRI  Q   ERNYHIFY M AG+ Q+++++  LKS + ++YL  G          I K                      D+  F+   +AM+ L I++ E   IF  +AA+LHLG+  F +   +          +   +    LLG     L ++L ++ T A G+  Q  + R     E A +ARDA+AK +YSR+F  +V  +N  +   +  + + ILDI GFE F  NSFEQ CINY NE LQ FFN+ +   EQ  Y  EG+   ++K+ DNQ C+DL+ K   GI+ +L +ES  PK  +  F     Q +         + SK      +   E F + HFAG V Y    F++KN D L   L  LL  ++  +M ++     P+E  K+ +   P          +   +V  KF   LI L+  ++  N  F+RCI+PN       F    +L Q++  G+   + + + G+P RI +
Sbjct:   26 VKVQH-ENSMRTYIGKILLSVNPYKQLDS-YTPELVEKYADQAIGRLPPHIFAIGSAAYAEIQKGGAHQVIVISGESGAGKTESTKQLVQYLATANPTKGSLTTEQIVEATPLLESFGNAKTVKNDNSSRFGKYLEIFFDSEGSICGARISEYLLERSRIVGQVRKERNYHIFYEMLAGLPQEKKQQLQLKSAEEHHYLNKG-------HGLIQKRC--------------------DLAAFSKVISAMEILEISESERDGIFTTLAAVLHLGDAGFYK-GLASAHDVAVLRDEHEAEITAHLLGLDAQHLIKALMHKQTEARGE--QIFSPR---NTEQAIDARDAIAKELYSRVFTWLVNRVNGMVFHGKQRSSIAILDIFGFEDFRINSFEQLCINYANESLQFFFNQFIFKMEQDEYTIEGIPWHEVKYTDNQACLDLMAKPPHGILHLLSDESNFPKATDLSFLEKCHQYH---------KASKAYVKPKMHVPE-FAVSHFAGTVTYKVHGFLDKNRDGLKQDLTDLLCKTNSEVMMEIGSLKMPRENRKNSLKAPP--------NSIQKSTVCAKFNDSLIRLVVAMKRCNPFFVRCIRPNPDKAPDEFVEKLVLDQIRYCGILETVKIRKTGFPIRIVY 619          
BLAST of Myosin vs. Ensembl Medaka
Match: myo6b (unconventional myosin-VI [Source:NCBI gene;Acc:101175525])

HSP 1 Score: 1126.69 bits (2913), Expect = 0.000e+0
Identity = 616/1265 (48.70%), Postives = 851/1265 (67.27%), Query Frame = 2
Query:   32 VWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSE----------KEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPKSL-------IVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEE-------LSKPVEISNNQKTNN----DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEP-----KNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQRL--NNQISSNY 3697
            VWAP P EG+  G ++DIG++T+T++ LN + KT  A     FP E++  ++VDDNCSLM+LN   LLNN+++RY ++ IYTYVANILIA+NPY +IPKL+  ETI  Y+GKS+GTLPPHV+AIAD+AYRDMK+ K++QSIIVSGESGAGKTE TK++L+YLT  YG+    I++RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF++ + V GGFVSHYLLEKSRIC QSS+ERNYHIFYR+CAG S++ ++   L SPD++ YL  G TRYF +K+   ++    KS E LK+G L D  ++D  DF     AMK +G+ D E  ++F +V+ +LHLGNI+FEE  +S GGC + + S  +L+ C  LLG    +L  SL  R+      GA+ T +++ LK E A NARDALAKA+YSRLFD +V  +N+  PF+ S+N++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY+KEGLG+ ++ +VDNQDCIDLVE K  GI+DILDEE++LP+P+++HF +A+   +  HFRL +PRKSKL  HR+LRD EGF+IRHFAGAVCY T  F+EKNNDALH SL++L+  S    + Q+F          +S +       GKLSF+SV  KF++QL +L++ LR++ ++FIRC+KPN+ MV+  FEG  ILSQLQC+GM  VLDLMQ G+PSR  F +LYN+YK  +P  L  L+ RLFCK LFKA+GL ++DFKFG+TKVFFRPGK AEFDQ+++SDP+++  ++ KV KWL+  RW+K Q+  L VIKL+NK+++R    IKIQK++RMW+ +KK   +I  + K+RNL   +E+L  +   LK+           KQ+ +K   Q+    +   A +++I  S  +   +D    +    +E++ S            E+L+ I+EEM   ++  EKE+   KQ E+++R+K EME  RK+EEE  K+ +   K +       +  E EE   +   L  EQERRD+ELA+RIA+ ++ ++ E       L +  ++   +        D++++ Y ELR VIN+SCD++L+ AC+ EFHRR+  Y+ WK+K K++ +       D  +   V     +NP P       E++    QRYF +PF   + +        +G W AHFDG +IARQ+E+H  K   +LVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ L++   N Q    Y
Sbjct:    7 VWAPHPAEGFQLGTMVDIGADTLTIEPLNQRGKTFLAPMSHVFPAEDDVNKHVDDNCSLMYLNEATLLNNVRVRYNKDYIYTYVANILIAVNPYYDIPKLYGPETIKSYQGKSLGTLPPHVFAIADKAYRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTTTYGS-GQDIDERIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNDKNAVVGGFVSHYLLEKSRICMQSSDERNYHIFYRLCAGASEELKKTLHLDSPDSFRYLNRGCTRYFASKDTDKQIMQSRKSPEHLKLGALKDPLVDDQGDFNRMCVAMKKIGLDDTEKLDLFRVVSGVLHLGNIDFEETGSSSGGCILKNHSDQTLEYCADLLGLDKDDLRVSLTTRVMLTTAGGAKGTVIKVPLKVEQANNARDALAKAVYSRLFDHVVKRVNQCFPFQASSNFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQKEGLGVNEVHYVDNQDCIDLVEAKTVGILDILDEENRLPQPSDQHFALAIHSKHKEHFRLTVPRKSKLTVHRNLRDDEGFIIRHFAGAVCYETTRFVEKNNDALHMSLESLVCESKDKFVRQLFEN--------SSTLKDSKQKAGKLSFISVGNKFKTQLNLLLEKLRSTGSSFIRCVKPNLKMVSHHFEGALILSQLQCAGMVSVLDLMQGGFPSRAPFHELYNMYKAYMPEKLTRLNPRLFCKALFKALGLNDNDFKFGLTKVFFRPGKFAEFDQIMKSDPDHLAELLKKVNKWLLCSRWKKVQWCCLSVIKLRNKMRYRAVACIKIQKSVRMWLCKKKHKPRINGLVKVRNLKKHMERLNEVVTGLKEG----------KQEMTK---QVHELGTAIDALLVKIKTSIMTWKEIDTEYQKLVKHSEQLLSSIKKKKQEEEEIERLKHIEEEMDKERKTREKEEQRRKQEEDDRRLKAEMELKRKQEEEDRKKRKEEEKVIQAELEIQLAVEREEQAQHAAML--EQERRDRELAMRIAQSEAELITEEGQSDAGLRRGPQVQATKAAAGVKKYDLSKWKYAELRDVINTSCDIELLAACREEFHRRLKVYHAWKTKNKKRDD----DGSDQRAPKSVTDYAEQNPAPPATAQHQEVAMNRQQRYFRIPFIRPADQYKDPQNKKKGWWYAHFDGPWIARQMELHPDKQPIVLVAGKDDMEMCELSLEETGLTRKRGAEILPRQFEEIWERCGGIQYLKKAIENKQARPTY 1243          
BLAST of Myosin vs. Ensembl Medaka
Match: myo6a (myosin VI [Source:NCBI gene;Acc:101164769])

HSP 1 Score: 970.689 bits (2508), Expect = 0.000e+0
Identity = 493/896 (55.02%), Postives = 655/896 (73.10%), Query Frame = 2
Query:   17 EMNEVVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQ-KTITAEYDQTFPVEEE-ERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKK-----SDKGVKMIAANKQKFSKIQSQI 2683
            E  + VWAP P +G+  G ++DIGS+++T++ L  + KT  A  +Q FP E+E +++V+DNCSLM+LN   LLNNI++RY ++ IYT+VANILIAINPY +IPKL+S ETI +Y+G+S+GTLPPHVYAIAD+AYRDMK+ K++QSIIVSGESGAGKTE TK++L+YLT  YG     I++RI E+NPLLEAFGN+KTVRNNNSSR+GKFVEIHF+  + V GGFVSHYLLEKSRIC+Q   ERNYHIFYR+CAG S+  R+K+ L SPD + YL  G TRYF +K+    +  + KS+E  K G L D  L+D  DF     AMK +G+ D E  ++F +VA +LHLGNI+FEE  ++ GGC I + S  +L+ C  LLG +  +L  SL  R       G + TA+++ LK E A NARDALAKA+YS LFD +V  +N+  PF  S N++G+LDIAGFEYFE NSFEQFCINYCNEKLQQFFNER+L EEQ LY++EGLG+ ++ +VDNQDCIDLVE K  GI+DILDEE++LP+P+++HFT  +   + +HFRL +PRKSKL  HR++RD EGF+IRHFAGAVCY T +F+EKNNDALH SL+ L+  S    + Q+F     ++   +  +       GKL F+SV  KF++QL +L++ LR++ ++F+RCIKPN+ MV+  FEG  ILSQLQCSGM  VLDLMQ G+PSR  F +LYN+Y+K +P  L  LD RLFCK LFKA+GL E+DFKFG+T+VFFRPGK AEFDQ+++SDP+++  +V KV KWLI  RW+K Q+  L VIKLKNKI +R    I IQKT+RMW+ ++K   +I  + K+R++   + +   + A LK+     S + +++ AA     +KI+S I
Sbjct:    2 EDGKPVWAPHPTDGFQLGTIVDIGSDSLTIEPLKQKGKTFLAPINQVFPAEDEVDKHVEDNCSLMYLNEATLLNNIRVRYSKDKIYTFVANILIAINPYYDIPKLYSPETIKQYRGRSLGTLPPHVYAIADKAYRDMKVLKMSQSIIVSGESGAGKTENTKFVLRYLTTSYGT-GQDIDERIVEANPLLEAFGNAKTVRNNNSSRFGKFVEIHFNEKNAVVGGFVSHYLLEKSRICRQGPEERNYHIFYRLCAGASEDIRQKFHLSSPDTFRYLNRGCTRYFASKDTNDHILQNRKSSEHTKCGPLKDPLLDDHGDFNRMCVAMKKIGLDDTEKLDLFKVVAGVLHLGNIDFEEAGSTSGGCTIKNQSSKTLECCAELLGLEEEDLRVSLTTRAMVTTAGGVKGTAIKVPLKVEQANNARDALAKAVYSHLFDHVVTRVNQCFPFASSTNFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILKEEQELYQREGLGVNEVHYVDNQDCIDLVEAKVVGILDILDEENRLPQPSDQHFTETVHNKHKDHFRLTIPRKSKLTVHRNVRDDEGFIIRHFAGAVCYETTKFVEKNNDALHMSLECLISESKDRFIRQLF-----ENSNNSKDVKNVKQKAGKLGFISVGNKFKTQLNILLEKLRSTGSSFVRCIKPNLKMVSHQFEGAQILSQLQCSGMVSVLDLMQGGFPSRAPFHELYNMYQKYMPPKLTRLDPRLFCKALFKALGLDENDFKFGLTRVFFRPGKFAEFDQIMKSDPDHLAELVKKVNKWLIHSRWKKVQWCALSVIKLKNKILYRATACITIQKTVRMWLCKRKHKPRIDGLVKVRSVKNRMSRFNEVVAGLKEGKQEMSKQIMELDAAIDSLIAKIKSTI 891          

HSP 2 Score: 152.91 bits (385), Expect = 6.181e-37
Identity = 77/219 (35.16%), Postives = 124/219 (56.62%), Query Frame = 2
Query: 3062 ALRIAEGDSTILEE-------LSKPVEISNNQKTNN----DVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKDSFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGK------STQGTWLAHFDGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITETKFEELWRNLGGIEILQ 3667
            ALRIA+ ++ ++ E       L +  ++   +        +++++ Y ELR  IN+SCD++L+ AC+ EFHRR+  Y+ WK+K K++   +      S ++   Q      P  ++E++    QR+F +PF     +        +G W AHFDG +IARQ+E+H +K   +LVAG DD+ MC L L  TGL  ++GAEI   +FEE+W   GGI+ L+
Sbjct:  963 ALRIAQSEAELIPEETPNDFGLRRGPQVQATKAAAGTKKYELSKWKYAELRDAINTSCDIELLAACREEFHRRLKVYHAWKAKNKKRNTESDQRAPKSVTDYAQQNSAPPIPARQHEVAMNRQQRFFRIPFIRPGDQYKDPHSKKKGWWYAHFDGPWIARQMELHPEKQPIILVAGKDDMEMCELSLEETGLSRKRGAEILPRQFEEIWERCGGIQYLR 1181          
BLAST of Myosin vs. Ensembl Medaka
Match: myh9b (myosin heavy chain 9 [Source:NCBI gene;Acc:101164562])

HSP 1 Score: 429.483 bits (1103), Expect = 1.465e-125
Identity = 283/791 (35.78%), Postives = 432/791 (54.61%), Query Frame = 2
Query:   29 VVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQKTITAEYDQTFPVEEEE-RNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGAR-----AGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAES-LCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPF--KESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKF-VDNQDCIDLVEKKGS--GIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLK-------SGVMTSP-ILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLAN--LDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQ 2335
            +VW P    G+  G+V +   +   V+L +S K +    D    +   +   V+D   L  LN  ++L+N+K RY+   IYTY     + INPY  +P ++S+E +  YKGK    +PPH+YAI D AYR M  ++ +QSI+ +GESGAGKTE TK ++QYL     +       G +E+++ ++NP+LEAFGN+KT++N+NSSR+GKF+ I+FD N  + G  +  YLLEKSR  +Q+  ER +HIFY +  G   K R++  L++ +NY +L NG                       + I    D  L     F  T +A K + I ++E   +  +VA++L LGN+ F      +   Q S    ++ Q    L+G   T+   + L  RI      G  Y  ++ A  +E A  A +ALAKA Y R+F  +V  IN+A+    ++ A+++GILDIAGFE FE NSFEQ CINY NEKLQQ FN  +   EQ  Y++EG+  + I F +D Q CI+L+EK  S  GI+ +LDEE   PK  ++ F   +FQ    H         K    + L+D   F I H+AG V Y  +E++ KN D L+D++ TLL  S+   + +++ K+V +       SG+   P   K   G+    F +V   ++ QL  LM  LRN+N NF+RCI PN    A   E   +L QL+C+G+   + + +QG+P+RI F +    Y+ + P+ +    +D +  C L+ K++ L  + ++ G +KVFFR G +A  ++
Sbjct:   29 LVWVPSERLGFEPGSVKEEHGDECVVELADSGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLP-IYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKTKKDQGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLTGAGDKLRKELLLENYNNYRFLSNGN----------------------VTIPGQQDKDL-----FNETMDAFKIMSIPEEEQIGMLKVVASVLQLGNMSF---KKERHTDQASMPDNTAAQKVSHLMGMNVTDFTRAILSPRIKV----GRDY--VQKAQTQEQAEFAVEALAKATYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIELIEKPASPPGILALLDEECWFPKATDKSFVEKVFQEQGTH--------PKFFKPKKLKDDADFSIFHYAGKVDYKADEWLMKNMDPLNDNVTTLLNQSTDKFVSELW-KDVDRIVGLDKVSGMSEMPGAFKTRKGM----FRTVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACVLMIKSLELDPNLYRIGQSKVFFRAGVLAHLEE 769          
BLAST of Myosin vs. Ensembl Medaka
Match: myh9b (myosin heavy chain 9 [Source:NCBI gene;Acc:101164562])

HSP 1 Score: 426.402 bits (1095), Expect = 1.618e-124
Identity = 283/798 (35.46%), Postives = 432/798 (54.14%), Query Frame = 2
Query:   29 VVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQKTITAEYDQTFPVEEEE-RNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARA------------GPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAES-LCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAI--PFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKF-VDNQDCIDLVEKKGS--GIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLK-------SGVMTSP-ILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLAN--LDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQ 2335
            +VW P    G+  G+V +   +   V+L +S K +    D    +   +   V+D   L  LN  ++L+N+K RY+   IYTY     + INPY  +P ++S+E +  YKGK    +PPH+YAI D AYR M  ++ +QSI+ +GESGAGKTE TK ++QYL     +              G +E+++ ++NP+LEAFGN+KT++N+NSSR+GKF+ I+FD N  + G  +  YLLEKSR  +Q+  ER +HIFY +  G   K R++  L++ +NY +L NG                       + I    D  L     F  T +A K + I ++E   +  +VA++L LGN+ F      +   Q S    ++ Q    L+G   T+   + L  RI      G  Y  ++ A  +E A  A +ALAKA Y R+F  +V  IN+A+    ++ A+++GILDIAGFE FE NSFEQ CINY NEKLQQ FN  +   EQ  Y++EG+  + I F +D Q CI+L+EK  S  GI+ +LDEE   PK  ++ F   +FQ    H         K    + L+D   F I H+AG V Y  +E++ KN D L+D++ TLL  S+   + +++ K+V +       SG+   P   K   G+    F +V   ++ QL  LM  LRN+N NF+RCI PN    A   E   +L QL+C+G+   + + +QG+P+RI F +    Y+ + P+ +    +D +  C L+ K++ L  + ++ G +KVFFR G +A  ++
Sbjct:   29 LVWVPSERLGFEPGSVKEEHGDECVVELADSGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVVINPYKNLP-IYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKTKKDQSSSILSHGELEKQLLQANPILEAFGNAKTIKNDNSSRFGKFIRINFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLTGAGDKLRKELLLENYNNYRFLSNGN----------------------VTIPGQQDKDL-----FNETMDAFKIMSIPEEEQIGMLKVVASVLQLGNMSF---KKERHTDQASMPDNTAAQKVSHLMGMNVTDFTRAILSPRIKV----GRDY--VQKAQTQEQAEFAVEALAKATYERMFRWLVMRINKALDKTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIEWSFIDFGLDLQPCIELIEKPASPPGILALLDEECWFPKATDKSFVEKVFQEQGTH--------PKFFKPKKLKDDADFSIFHYAGKVDYKADEWLMKNMDPLNDNVTTLLNQSTDKFVSELW-KDVDRIVGLDKVSGMSEMPGAFKTRKGM----FRTVGQLYKEQLSKLMATLRNTNPNFVRCIIPNHEKKAGKLEPHLVLDQLRCNGVLEGIRICRQGFPNRIVFQEFRQRYEILTPNAIPKGFMDGKQACVLMIKSLELDPNLYRIGQSKVFFRAGVLAHLEE 776          
BLAST of Myosin vs. Ensembl Medaka
Match: myo7ab (myosin VIIAb [Source:ZFIN;Acc:ZDB-GENE-091110-4])

HSP 1 Score: 410.994 bits (1055), Expect = 8.164e-123
Identity = 262/705 (37.16%), Postives = 381/705 (54.04%), Query Frame = 2
Query:  242 IRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAI---PFKESA---NYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQ---LPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMT---SPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKIL----PSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFR 2308
            IRY ++ IYTY  +IL+A+NPY  +P +++ + I  Y  K IG +PPH++AIAD  Y +M+ N  +Q  I+SGESGAGKTE+TK ILQ+L    G  +  IEQ++ E+ P+LEAFGN+KT+RN+NSSR+GK+++IHF+    + G  +  YLLEKSR+C+Q+ +ERNYH+FY M  GM+ + + K  L    +Y+YL  G     CT+        D +               ND++++++  +AMK L  T+ E  EI  ++AAILH+GN+ F E  T              L +   L+  +P ++   L  R     G+     ++   L      + RDA  K IY RLF  IV  IN AI   P  ES+     +G+LDI GFE F  NSFEQ CIN+ NE LQQFF   V   EQ  Y  E +    I+F DNQD +D++  K   II ++DEESK PK  +   TM L++ N  H +L    +P K+  +          F I+HFAG V Y +  F+EKN D+LH  +  L+ +S    + Q+F  +V   GV T   SP L              +++F+  L +LM  L      F+RCIKPN       F+    + QL+ SGM   + + + GYP R  F +  + Y+ ++    PS+L   D R  C+ +  A   K  D++ G TK+F +
Sbjct:   92 IRYNEHVIYTYTGSILVAVNPYQLLP-IYTADHIRLYTNKKIGEMPPHIFAIADNCYFNMQRNNKDQCCIISGESGAGKTESTKLILQFLAAISGQHSW-IEQQVLEATPILEAFGNAKTIRNDNSSRFGKYIDIHFNKRGAIEGAKIEQYLLEKSRVCRQAPDERNYHVFYCMLKGMAPEMKAKLGLGLATDYSYLTMGN----CTE-------CDGR---------------NDLREYSSILSAMKVLMFTETEIWEISKLLAAILHMGNLRF-EARTYDNLDACVVVRSPDLVTAASLMEVEPKDVMVCLTTRTLITRGE-----SVTTPLSMNQGLDVRDAFVKGIYGRLFVWIVDKINAAIYRPPSCESSLIRRSMGLLDIFGFENFFVNSFEQLCINFANENLQQFFVRHVFKLEQKEYNLEDISWQHIEFTDNQDALDMIANKPMNIISLIDEESKFPKGTDA--TM-LYKLNSQH-KLNCNYIPPKNSYETQ--------FGIQHFAGVVHYESRGFLEKNRDSLHTDIIQLVHSSRNKFIKQIFQADV-AMGVETRKRSPTL--------------SSQFKRSLEMLMRTLSVCQPFFVRCIKPNELKKPMLFDRELCIRQLRYSGMMETIRIRRAGYPIRYSFAEFVDRYRVLMPGIKPSHLQE-DLRGTCQQILTARLGKHEDWQIGKTKIFLK 734          
BLAST of Myosin vs. Planmine SMEST
Match: SMESG000047361.1 (SMESG000047361.1)

HSP 1 Score: 2068.12 bits (5357), Expect = 0.000e+0
Identity = 1087/1091 (99.63%), Postives = 1091/1091 (100.00%), Query Frame = 2
Query:   20 MNEVVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQKTITAEYDQTFPVEEEERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNXXXXXXXXXXXXXXTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMXXXXXXXXXXXXXXXXXXRIKLEMEATXXXXXXXXXXXQAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSKPVEISNNQKTNNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKK 3292
            MNEVVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQKTITAEYDQTFPVEEEERNVDDNCSLMFLNNPNLLNNIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTSQGGCQISSSSQSSLQSCCRLLGFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNKIKWR+QQIIKIQKTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSEL+VDINSLQKEVETEKINSEKEKLRL+QEEMRIMKEKTEKEQLLLKQAEEEKRIKLEMEATRKKEEEKLKRLQAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSKPVEISNNQKTNNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKE+K
Sbjct:    1 MNEVVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQKTITAEYDQTFPVEEEERNVDDNCSLMFLNNPNLLNNIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTSQGGCQISSSSQSSLQSCCRLLGFKPTELAESLCNRITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKAQFGVLEVIKLKNKIKWRQQQIIKIQKTLRMWIVRKKFCQKIKSMKKLRNLNILLEKLTLIAAQLKKSDKGVKMIAANKQKFSKIQSQIRITPSNKMAGVIQIIDSFQSELSVDINSLQKEVETEKINSEKEKLRLVQEEMRIMKEKTEKEQLLLKQAEEEKRIKLEMEATRKKEEEKLKRLQAVPKSLIVKEHEETESYIQELSKEQERRDKELALRIAEGDSTILEELSKPVEISNNQKTNNDVTQYTYDELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKERK 1091          
BLAST of Myosin vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 407.527 bits (1046), Expect = 3.673e-118
Identity = 260/804 (32.34%), Postives = 426/804 (52.99%), Query Frame = 2
Query:   29 VVWAPEPIEGYVKGNVI--DIGSNTITVKLLNSQKTITAEYDQTFPVEEEERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARA--------------GPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTAL-------RIALKREDARNAR---------DALAKAIYSRLFDEIVAFINRAI--PFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKF-VDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMF--PKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPS--NLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMA 2323
            ++W P+ I GYV   ++   +   T+ ++    QK +  ++ Q     +  ++ +D  +L +LN  ++L+NIK RYF   IYTY     + +NPY  +P +++ E I  YKG+     PPH+YAIAD AYR+M  ++ +QSI+ +GESGAGKTE TK ++QYL     +                G +E+++ ++NP+LEAFGN+KT+RN+NSSR+GKF+ I+FD++  +AG  +  YLLEK+R+ +Q+S ER++HIFY++ +  S+  +    L     Y +L NG                               S +++V+ F  T  A+K +GITD+E   IF ++++++ +GN+EF++                               +A+ + + +      G Q T +       RI + RE    A+         +A++KA+Y R+F  +V  INR +    ++  N++GILDIAGFE FE NSFEQ CINY NEKLQQ FN  +   EQ  Y KEG+    I F +D Q  IDL+E K  GI+ +LDEE   PK  ++ F   L +T   H +L    K + +++ D      F + H+AG V Y  E+++EKN D L++++  LL+ S+V  +  ++   +  +      +   + G    K    +V+   +  L+ L+  L N+N +F+RCI PN        E   +L QL+C+G+   + + +QGYP+RI F +    Y+ + P   N   +D +   + L  A+ + ++ +K G +K+FF+ G +A
Sbjct:   37 LIWIPDDINGYVVAQIVKESVEECTVQIQETGKQKVVLKDHIQKMNPPKFSKS-EDMANLTYLNEASVLSNIKERYFSGLIYTYSGLFCVVLNPYKRLP-IYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFHGELEKQLLQANPILEAFGNAKTIRNDNSSRFGKFIRINFDSSGFIAGANIETYLLEKARVIRQASEERSFHIFYQLLSTKSEM-KNTLLLGEMSGYRFLCNGAASI---------------------------SGIDEVQAFNETIEALKIMGITDEEQECIFRVISSVMLMGNMEFKQ------------------DRNSDQATLPDNSVAQKIAHLL------GLQVTDMTKAFLKPRIKVGRETVSKAQTKEQAEFSVEAISKAMYERMFKWLVTRINRTLDKDKRQGTNFIGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKEGISWEYIDFGLDLQPTIDLIE-KSMGILSLLDEECFFPKATDKSFVEKLLKTQEKHPKLT---KGEFRSNVD------FSVEHYAGRVDYVAEKWLEKNMDPLNENVVQLLQKSNVPFVQSIWKDAENFVTLSATANQETQFGSRTRKGMMRTVSQLHKESLVKLLSVLNNTNPHFVRCIIPNHEKRPAKIESKLVLDQLKCNGVLEGIRICRQGYPNRILFQEFKQRYQILCPQTVNQGFMDGKAAAEQLLNALEVDKNLYKIGQSKIFFKAGVVA 776          
BLAST of Myosin vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 407.527 bits (1046), Expect = 3.778e-118
Identity = 260/804 (32.34%), Postives = 426/804 (52.99%), Query Frame = 2
Query:   29 VVWAPEPIEGYVKGNVI--DIGSNTITVKLLNSQKTITAEYDQTFPVEEEERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARA--------------GPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTAL-------RIALKREDARNAR---------DALAKAIYSRLFDEIVAFINRAI--PFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKF-VDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMF--PKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPS--NLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMA 2323
            ++W P+ I GYV   ++   +   T+ ++    QK +  ++ Q     +  ++ +D  +L +LN  ++L+NIK RYF   IYTY     + +NPY  +P +++ E I  YKG+     PPH+YAIAD AYR+M  ++ +QSI+ +GESGAGKTE TK ++QYL     +                G +E+++ ++NP+LEAFGN+KT+RN+NSSR+GKF+ I+FD++  +AG  +  YLLEK+R+ +Q+S ER++HIFY++ +  S+  +    L     Y +L NG                               S +++V+ F  T  A+K +GITD+E   IF ++++++ +GN+EF++                               +A+ + + +      G Q T +       RI + RE    A+         +A++KA+Y R+F  +V  INR +    ++  N++GILDIAGFE FE NSFEQ CINY NEKLQQ FN  +   EQ  Y KEG+    I F +D Q  IDL+E K  GI+ +LDEE   PK  ++ F   L +T   H +L    K + +++ D      F + H+AG V Y  E+++EKN D L++++  LL+ S+V  +  ++   +  +      +   + G    K    +V+   +  L+ L+  L N+N +F+RCI PN        E   +L QL+C+G+   + + +QGYP+RI F +    Y+ + P   N   +D +   + L  A+ + ++ +K G +K+FF+ G +A
Sbjct:   37 LIWIPDDINGYVVAQIVKESVEECTVQIQETGKQKVVLKDHIQKMNPPKFSKS-EDMANLTYLNEASVLSNIKERYFSGLIYTYSGLFCVVLNPYKRLP-IYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFHGELEKQLLQANPILEAFGNAKTIRNDNSSRFGKFIRINFDSSGFIAGANIETYLLEKARVIRQASEERSFHIFYQLLSTKSEM-KNTLLLGEMSGYRFLCNGAASI---------------------------SGIDEVQAFNETIEALKIMGITDEEQECIFRVISSVMLMGNMEFKQ------------------DRNSDQATLPDNSVAQKIAHLL------GLQVTDMTKAFLKPRIKVGRETVSKAQTKEQAEFSVEAISKAMYERMFKWLVTRINRTLDKDKRQGTNFIGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKEGISWEYIDFGLDLQPTIDLIE-KSMGILSLLDEECFFPKATDKSFVEKLLKTQEKHPKLT---KGEFRSNVD------FSVEHYAGRVDYVAEKWLEKNMDPLNENVVQLLQKSNVPFVQSIWKDAENFVTLSATANQETQFGSRTRKGMMRTVSQLHKESLVKLLSVLNNTNPHFVRCIIPNHEKRPAKIESKLVLDQLKCNGVLEGIRICRQGYPNRILFQEFKQRYQILCPQTVNQGFMDGKAAAEQLLNALEVDKNLYKIGQSKIFFKAGVVA 776          
BLAST of Myosin vs. Planmine SMEST
Match: SMESG000049494.1 (SMESG000049494.1)

HSP 1 Score: 407.527 bits (1046), Expect = 4.119e-118
Identity = 260/804 (32.34%), Postives = 426/804 (52.99%), Query Frame = 2
Query:   29 VVWAPEPIEGYVKGNVI--DIGSNTITVKLLNSQKTITAEYDQTFPVEEEERNVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTECYGARA--------------GPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCNRITNAAGQGAQYTAL-------RIALKREDARNAR---------DALAKAIYSRLFDEIVAFINRAI--PFKESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKF-VDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMF--PKEVLKSGVMTSPILKKGHGIGKLSFVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPS--NLANLDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMA 2323
            ++W P+ I GYV   ++   +   T+ ++    QK +  ++ Q     +  ++ +D  +L +LN  ++L+NIK RYF   IYTY     + +NPY  +P +++ E I  YKG+     PPH+YAIAD AYR+M  ++ +QSI+ +GESGAGKTE TK ++QYL     +                G +E+++ ++NP+LEAFGN+KT+RN+NSSR+GKF+ I+FD++  +AG  +  YLLEK+R+ +Q+S ER++HIFY++ +  S+  +    L     Y +L NG                               S +++V+ F  T  A+K +GITD+E   IF ++++++ +GN+EF++                               +A+ + + +      G Q T +       RI + RE    A+         +A++KA+Y R+F  +V  INR +    ++  N++GILDIAGFE FE NSFEQ CINY NEKLQQ FN  +   EQ  Y KEG+    I F +D Q  IDL+E K  GI+ +LDEE   PK  ++ F   L +T   H +L    K + +++ D      F + H+AG V Y  E+++EKN D L++++  LL+ S+V  +  ++   +  +      +   + G    K    +V+   +  L+ L+  L N+N +F+RCI PN        E   +L QL+C+G+   + + +QGYP+RI F +    Y+ + P   N   +D +   + L  A+ + ++ +K G +K+FF+ G +A
Sbjct:   37 LIWIPDDINGYVVAQIVKESVEECTVQIQETGKQKVVLKDHIQKMNPPKFSKS-EDMANLTYLNEASVLSNIKERYFSGLIYTYSGLFCVVLNPYKRLP-IYNDEIIEWYKGRKRHERPPHIYAIADTAYRNMLQDREDQSILCTGESGAGKTENTKKVIQYLASVAASMKNQKLSASNAIAQFHGELEKQLLQANPILEAFGNAKTIRNDNSSRFGKFIRINFDSSGFIAGANIETYLLEKARVIRQASEERSFHIFYQLLSTKSEM-KNTLLLGEMSGYRFLCNGAASI---------------------------SGIDEVQAFNETIEALKIMGITDEEQECIFRVISSVMLMGNMEFKQ------------------DRNSDQATLPDNSVAQKIAHLL------GLQVTDMTKAFLKPRIKVGRETVSKAQTKEQAEFSVEAISKAMYERMFKWLVTRINRTLDKDKRQGTNFIGILDIAGFEIFEVNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKEGISWEYIDFGLDLQPTIDLIE-KSMGILSLLDEECFFPKATDKSFVEKLLKTQEKHPKLT---KGEFRSNVD------FSVEHYAGRVDYVAEKWLEKNMDPLNENVVQLLQKSNVPFVQSIWKDAENFVTLSATANQETQFGSRTRKGMMRTVSQLHKESLVKLLSVLNNTNPHFVRCIIPNHEKRPAKIESKLVLDQLKCNGVLEGIRICRQGYPNRILFQEFKQRYQILCPQTVNQGFMDGKAAAEQLLNALEVDKNLYKIGQSKIFFKAGVVA 776          
BLAST of Myosin vs. Planmine SMEST
Match: SMESG000062420.1 (SMESG000062420.1)

HSP 1 Score: 407.142 bits (1045), Expect = 4.484e-118
Identity = 264/807 (32.71%), Postives = 429/807 (53.16%), Query Frame = 2
Query:   29 VVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQKTITAEYDQTFPVEEEER-------NVDDNCSLMFXXXXXXXXXIKIRYFQNNIYTYVANILIAINPYSEIPKLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESGAGKTETTKYILQYLTE--------------------CYGARAGPIEQRINESNPLLEAFGNSKTVRNNNSSRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCAGMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKIGNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFEEVNTXXXXXXXXXXXXXXXXXXXXXXXFKPTELAESLCN---RITNAAGQGAQYTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPF-KESANYVGILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGLTKIKF-VDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPNHFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHDSLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLS----FVSVATKFRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTVVLDLMQQGYPSRIKFIDLYNIYKKILPSNLAN--LDQRLFCKLLFKAVGLKESDFKFGMTKVFFRPGKMAEFDQ 2335
            +VW P+  EG++ G++I+   +  TVKL N  KT+        P+E  ++         +D   L +LN  ++L N+K RYF + IYTY     + +NPY  +P +++   I  YKG+     PPH+YA+ D AYR+M  +K NQSI+ +GESGAGKTE TK ++QYL                       +    G +E ++ ++NP+LEAFGN+KT++N+NSSR+GKF+ I+FD +  ++   +  YLLEK+R+ +Q++NER +H+FY++  G   + +++  L++   Y  L NG                       + + + ++ Q+     F  T  A+  +GI+  E   IF ++AA+LH+GNIEF++  +     Q +    +  Q    LLG   TE+ ++L     +I       AQ         +E A  + +A++K+ Y R+F  +V  INR+I   ++  N++GILDIAGFE FE NSFEQ CINY NEKLQQ FN  +   EQ  Y KE +    I F +D Q  I+L+E K  GI+ +LDEE   PK   + F   L +    H         KLKA  D R    F + H+AG V Y  + ++ KN D L++++ +LL+ S+ + +  ++       G+ T+   +   G  K +    F +V   ++  L  LMD L N+N NF+RCI PN    +   +   ++ QL+C+G+   + + +QG+P+RI F +    Y  + P+ +    +D R   +L+   + +  S+++ G +K+FF+ G +A  ++
Sbjct:   33 LVWIPDDNEGFISGSLIEEKGDEATVKLENG-KTMK------LPIENVQKVNPPKFFKSEDMADLTYLNEASVLYNLKDRYFSDLIYTYSGLFCVVVNPYKRLP-IYTNNVIEWYKGRKRHERPPHIYAVTDVAYRNMLQDKENQSILCTGESGAGKTENTKKVIQYLASVATSLKNQKTTASNALSQFYAHDVNIGELETQLLQANPVLEAFGNAKTIKNDNSSRFGKFIRINFDTSGFISSANIETYLLEKARVIRQAANERCFHVFYQLLLGADDRLKKELILENVSTYKLLSNG----------------------MIAVPDYDEKQM-----FKDTVEALDIMGISKDEQESIFRVIAAVLHMGNIEFKQERS---SDQAALPDNTVAQKVAHLLGLPVTEMTKALLKPKLKIGREVVAKAQT--------KEQAEFSVEAISKSTYERMFRWLVMRINRSIDRNRQKTNFIGILDIAGFEIFEINSFEQLCINYTNEKLQQLFNHTMFVLEQEEYRKENIKWEFIDFGLDLQPTIELIE-KPMGILSLLDEECFFPKATTKTFVEKLIKNQSTH--------PKLKAT-DFRAKADFGVIHYAGKVDYVADNWLVKNMDPLNENVVSLLQESNESFVQTIWKDAENIIGLSTTTAQESAFGGAKTTRKGMFRTVGQLYKESLTKLMDVLNNTNPNFVRCIIPNHEKKSGKIDSKLVIDQLKCNGVLEGIRICRQGFPNRILFQEFKQRYGILTPNVILKGFMDGRKATELMLGELDIDASNYRIGQSKIFFKAGVLARLEE 783          
The following BLAST results are available for this feature:
BLAST of Myosin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYO60.000e+050.08myosin VI [Source:HGNC Symbol;Acc:HGNC:7605][more]
MYO60.000e+049.88myosin VI [Source:HGNC Symbol;Acc:HGNC:7605][more]
MYO60.000e+049.88myosin VI [Source:HGNC Symbol;Acc:HGNC:7605][more]
MYO60.000e+048.98myosin VI [Source:HGNC Symbol;Acc:HGNC:7605][more]
MYO60.000e+049.14myosin VI [Source:HGNC Symbol;Acc:HGNC:7605][more]
back to top
BLAST of Myosin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spe-150.000e+044.81pep chromosome:WBcel235:I:1446497:1465358:1 gene:W... [more]
hum-80.000e+042.76Heavy chain, Unconventional Myosin [Source:UniPro... [more]
hum-80.000e+042.44Heavy chain, Unconventional Myosin [Source:UniPro... [more]
hum-82.823e-2249.65Heavy chain, Unconventional Myosin [Source:UniPro... [more]
nmy-19.234e-12632.19Non-muscle MYosin [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
back to top
BLAST of Myosin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
jar0.000e+046.58gene:FBgn0011225 transcript:FBtr0345266[more]
jar0.000e+046.27gene:FBgn0011225 transcript:FBtr0334872[more]
jar0.000e+046.27gene:FBgn0011225 transcript:FBtr0084636[more]
jar0.000e+046.27gene:FBgn0011225 transcript:FBtr0301371[more]
jar0.000e+046.27gene:FBgn0011225 transcript:FBtr0301367[more]
back to top
BLAST of Myosin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo6b0.000e+048.88myosin VIb [Source:ZFIN;Acc:ZDB-GENE-030318-3][more]
myo6a0.000e+049.84myosin VIa [Source:ZFIN;Acc:ZDB-GENE-040819-2][more]
myo6a0.000e+049.84myosin VIa [Source:ZFIN;Acc:ZDB-GENE-040819-2][more]
myo6b0.000e+048.49myosin VIb [Source:ZFIN;Acc:ZDB-GENE-030318-3][more]
myo6b0.000e+048.76myosin VIb [Source:ZFIN;Acc:ZDB-GENE-030318-3][more]
back to top
BLAST of Myosin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYO60.000e+048.32myosin VI [Source:NCBI gene;Acc:493193][more]
MYO60.000e+056.30myosin VI [Source:NCBI gene;Acc:493193][more]
MYO60.000e+056.30myosin VI [Source:NCBI gene;Acc:493193][more]
MYO65.279e-4456.30myosin VI [Source:NCBI gene;Acc:493193][more]
MYO62.792e-4356.30myosin VI [Source:NCBI gene;Acc:493193][more]
back to top
BLAST of Myosin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myo60.000e+049.68myosin VI [Source:MGI Symbol;Acc:MGI:104785][more]
Myo60.000e+049.24myosin VI [Source:MGI Symbol;Acc:MGI:104785][more]
Myo60.000e+049.40myosin VI [Source:MGI Symbol;Acc:MGI:104785][more]
Myo60.000e+048.86myosin VI [Source:MGI Symbol;Acc:MGI:104785][more]
Myo60.000e+048.59myosin VI [Source:MGI Symbol;Acc:MGI:104785][more]
back to top
BLAST of Myosin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q29122|MYO6_PIG0.000e+049.80Unconventional myosin-VI OS=Sus scrofa OX=9823 GN=... [more]
sp|E1BPK6|MYO6_BOVIN0.000e+048.71Unconventional myosin-VI OS=Bos taurus OX=9913 GN=... [more]
sp|Q9I8D1|MYO6_CHICK0.000e+049.13Unconventional myosin-VI OS=Gallus gallus OX=9031 ... [more]
sp|Q9UM54|MYO6_HUMAN0.000e+048.79Unconventional myosin-VI OS=Homo sapiens OX=9606 G... [more]
sp|Q64331|MYO6_MOUSE0.000e+046.71Unconventional myosin-VI OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of Myosin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EZ740.000e+051.17Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267EY540.000e+051.25Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A433TKJ20.000e+052.16Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A023PNK00.000e+051.65Myosin OS=Platynereis dumerilii OX=6359 PE=2 SV=1[more]
K1Q1S30.000e+052.90Myosin-VI OS=Crassostrea gigas OX=29159 GN=CGI_100... [more]
back to top
BLAST of Myosin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo6a0.000e+049.16myosin VIa [Source:ZFIN;Acc:ZDB-GENE-040819-2][more]
myo6b0.000e+048.43myosin VIb [Source:ZFIN;Acc:ZDB-GENE-030318-3][more]
myh9a2.017e-13334.67myosin, heavy chain 9a, non-muscle [Source:ZFIN;Ac... [more]
myo5c4.547e-12535.59myosin VC [Source:ZFIN;Acc:ZDB-GENE-131127-196][more]
myo5aa1.390e-12333.76myosin VAa [Source:ZFIN;Acc:ZDB-GENE-041027-2][more]
back to top
BLAST of Myosin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh106.018e-13334.03myosin, heavy chain 10, non-muscle [Source:ZFIN;Ac... [more]
myo10l11.922e-12534.59myosin X, like 1 [Source:ZFIN;Acc:ZDB-GENE-080425-... [more]
ENSPMAT00000000498.11.727e-12336.24pep scaffold:Pmarinus_7.0:GL479744:368:24152:-1 ge... [more]
ENSPMAT00000005411.11.340e-11633.04pep scaffold:Pmarinus_7.0:GL476612:1285:44967:1 ge... [more]
ENSPMAT00000001434.11.922e-11434.17pep scaffold:Pmarinus_7.0:GL493165:42961:106906:1 ... [more]
back to top
BLAST of Myosin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MYO27.903e-12533.49Type V myosin motor involved in actin-based transp... [more]
MYO41.911e-11534.35Type V myosin motor involved in actin-based transp... [more]
MYO11.331e-11233.73Type II myosin heavy chain; required for wild-type... [more]
MYO51.060e-10032.21One of two type I myosin motors; contains proline-... [more]
MYO37.311e-10032.35One of two type I myosins; localizes to actin cort... [more]
back to top
BLAST of Myosin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360370.000e+046.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418192.847e-13035.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455632.801e-12235.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495152.071e-11434.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319244.994e-11134.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Myosin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo6b0.000e+048.70unconventional myosin-VI [Source:NCBI gene;Acc:101... [more]
myo6a6.181e-3755.02myosin VI [Source:NCBI gene;Acc:101164769][more]
myh9b1.465e-12535.78myosin heavy chain 9 [Source:NCBI gene;Acc:1011645... [more]
myh9b1.618e-12435.46myosin heavy chain 9 [Source:NCBI gene;Acc:1011645... [more]
myo7ab8.164e-12337.16myosin VIIAb [Source:ZFIN;Acc:ZDB-GENE-091110-4][more]
back to top
BLAST of Myosin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047361.10.000e+099.63SMESG000047361.1[more]
SMESG000049494.13.673e-11832.34SMESG000049494.1[more]
SMESG000049494.13.778e-11832.34SMESG000049494.1[more]
SMESG000049494.14.119e-11832.34SMESG000049494.1[more]
SMESG000062420.14.484e-11832.71SMESG000062420.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30014199 ID=SMED30014199|Name=Myosin|organism=Schmidtea mediterranea sexual|type=transcript|length=3873bp
TATATAAATCTTATATGAAATGAATGAAGTTGTATGGGCACCAGAACCAA
TAGAAGGTTATGTTAAAGGGAATGTAATTGATATTGGATCAAATACAATT
ACTGTTAAGTTGCTAAATTCTCAAAAGACCATAACGGCTGAATATGATCA
AACGTTTCCAGTTGAAGAAGAAGAAAGAAATGTTGATGATAACTGTTCAC
TGATGTTCTTGAACAACCCTAATTTATTGAACAACATCAAAATAAGATAT
TTCCAAAATAATATTTATACATACGTTGCAAATATCTTGATTGCCATAAA
TCCGTATTCTGAAATTCCGAAACTGTTTTCAAAGGAAACTATTTTAAAAT
ATAAAGGTAAATCTATCGGAACACTTCCGCCCCATGTTTACGCGATTGCT
GATCAAGCATATAGGGATATGAAGATTAACAAAGTAAATCAGTCGATTAT
CGTCAGTGGAGAATCTGGCGCTGGTAAAACTGAAACAACTAAATATATTC
TTCAATACCTTACCGAATGTTATGGAGCTCGAGCGGGGCCAATTGAACAG
AGAATAAATGAATCCAATCCCTTACTGGAAGCATTCGGTAATTCGAAGAC
CGTGCGCAATAATAACAGCTCAAGATATGGGAAATTCGTTGAAATTCATT
TCGACAACAATTCAATCGTTGCTGGAGGATTCGTTTCACATTATCTGTTG
GAAAAGTCAAGAATTTGCAAGCAATCAAGCAACGAGCGTAATTATCACAT
ATTTTATCGAATGTGCGCTGGAATGTCGCAAAAAGAAAGAGAAAAATACG
ATTTAAAATCTCCGGACAATTACAATTATTTAAAAAATGGAACTACGCGA
TACTTTTGTACAAAAAATGAAATTTCAAAATTGTCAACAGATAGTAAATC
AGCTGAATTTCTTAAAATTGGAAATCTCAATGACTCTCAGTTGAATGATG
TCAAAGACTTTACTACAACTTTCAATGCGATGAAAAGTTTGGGAATTACT
GATAAAGAAAACACTGAAATATTTGGAATCGTCGCAGCTATTTTACATTT
GGGAAACATTGAATTTGAGGAAGTAAATACCTCTCAAGGAGGCTGTCAAA
TCTCATCAAGCAGCCAGTCGTCTTTGCAGTCATGCTGCCGATTATTGGGT
TTCAAACCTACAGAATTGGCAGAATCTCTTTGCAACAGAATTACCAATGC
AGCTGGTCAGGGTGCTCAATATACAGCATTACGGATAGCATTGAAACGGG
AAGATGCACGAAATGCCAGAGATGCATTAGCCAAGGCAATTTACTCAAGA
TTATTCGACGAAATAGTTGCGTTTATAAACCGAGCAATACCCTTTAAAGA
ATCTGCTAATTACGTTGGTATTCTAGATATTGCCGGGTTTGAATATTTTG
AGAAAAATAGTTTTGAGCAGTTTTGTATCAATTATTGTAATGAAAAGTTA
CAACAATTTTTCAATGAGCGAGTACTCAATGAAGAACAAATTCTTTATGA
AAAGGAAGGTCTTGGTCTTACAAAAATCAAATTCGTCGACAATCAAGATT
GTATAGATCTTGTTGAAAAGAAAGGTTCCGGGATTATTGACATTCTAGAT
GAGGAAAGCAAATTGCCAAAGCCCAATAATGAACATTTCACGATGGCTTT
ATTTCAGACTAATCCTAACCATTTTCGCCTACAACTACCACGGAAATCCA
AATTAAAAGCTCATCGAGATTTGAGGGACTGTGAAGGTTTTTTGATTCGT
CATTTTGCTGGAGCAGTATGTTATCACACAGAAGAGTTTATAGAAAAAAA
TAATGACGCCCTTCATGATTCTCTTAAAACTCTACTTGAAACGAGTTCTG
TTACTTTAATGTGTCAAATGTTTCCGAAAGAAGTTTTAAAGAGTGGAGTT
ATGACTTCACCAATACTGAAGAAAGGTCATGGAATTGGTAAACTCTCATT
TGTAAGTGTGGCTACTAAATTTCGATCACAGCTTATTGTTCTAATGGATA
ACCTGAGGAATTCGAACACTAATTTTATTCGTTGTATTAAACCGAATGTT
TCAATGGTGGCGAAATCATTCGAAGGAGGAAGCATACTTAGTCAACTTCA
GTGTTCAGGAATGACGGTTGTATTGGATCTGATGCAGCAAGGCTATCCTA
GTCGCATCAAGTTCATCGACCTATACAACATTTACAAAAAGATATTACCC
TCAAATTTAGCCAATTTAGACCAAAGATTGTTTTGTAAACTTCTTTTCAA
AGCAGTTGGATTAAAAGAATCTGATTTCAAATTTGGAATGACAAAGGTCT
TTTTCCGACCCGGAAAAATGGCTGAATTTGATCAGCTGATTCGATCAGAT
CCTGAAAATGTTAAAGGAATGGTTGCCAAAGTTAGAAAATGGCTCATTAA
GTATCGTTGGAGAAAAGCTCAATTCGGGGTTTTGGAAGTGATAAAATTGA
AAAATAAAATAAAATGGCGTCGGCAACAAATCATAAAGATTCAAAAAACT
CTTCGTATGTGGATAGTGAGAAAGAAATTCTGTCAAAAAATTAAGTCCAT
GAAAAAATTAAGAAATTTGAATATATTGCTTGAAAAATTAACTTTAATTG
CTGCACAACTAAAAAAATCAGACAAAGGTGTAAAAATGATTGCTGCAAAT
AAGCAAAAGTTTTCGAAAATTCAATCTCAAATTAGAATCACTCCATCAAA
TAAAATGGCTGGAGTTATACAAATAATTGATAGCTTTCAATCAGAGCTTA
CTGTTGATATAAATTCTTTGCAAAAAGAAGTCGAAACGGAAAAAATAAAT
TCTGAAAAAGAAAAGCTTAGATTAATCCAAGAAGAAATGCGAATAATGAA
AGAGAAAACTGAGAAAGAACAGTTACTATTAAAACAAGCGGAAGAGGAAA
AGCGTATTAAATTAGAAATGGAAGCTACAAGGAAAAAGGAAGAAGAAAAG
TTGAAAAGATTACAAGCAGTTCCAAAGTCTTTAATCGTTAAGGAGCATGA
AGAAACGGAATCTTATATCCAAGAACTTTCTAAAGAACAAGAACGACGAG
ATAAAGAACTGGCGCTCAGAATAGCTGAAGGCGACAGTACAATACTTGAA
GAATTATCAAAACCAGTTGAGATTTCTAATAATCAAAAAACAAATAATGA
TGTTACTCAATATACATATGATGAGTTACGTAGAGTTATCAATTCATCTT
GCGACCTTAAGTTAATTGAAGCTTGCCAAACTGAATTTCATCGTCGAGTA
AATGCTTATAACAATTGGAAATCTAAACAAAAAGAAAAGAAAAATATTAC
AACAACTTCTACTAAAGATAGTTTTTCTGAAAGTCAAGTTCAACTGCAAC
CGGTGAAAAATCCGGAGCCCAAAAATGAAATTTCACAAATTACTGTTCAA
AGATATTTTTCTTTGCCATTTACAACTGTAAGCGGAAAATCCACACAGGG
AACTTGGCTGGCTCATTTTGATGGGGAATATATAGCTCGGCAAATTGAAA
TTCATGACAAAAAAACATCTTTTTTGCTTGTTGCTGGAGTGGATGATCTT
GGTATGTGTTCTTTACCGCTTTCCACAACTGGTCTCATCGCGAGAAAAGG
AGCAGAAATTACTGAAACGAAATTTGAAGAATTGTGGAGAAATTTAGGTG
GAATCGAAATTCTGCAAAGATTGAACAATCAAATTTCATCTAATTATTTA
AAATCTAAATTCCTCAAGAAATTATAGTTAAAACTTTAGTGATTTTCATT
GTCTTATTCTTGGTTATTTTTCTTTTTAATAGTTCTTTGCACTTTTCTTA
TAACTGAATTTTTATATAAACTCGAATAATTTCAGTTTCTGTAAATTGTG
CCTTTGATTATTTTATCCAATTG
back to top

protein sequence of SMED30014199-orf-1

>SMED30014199-orf-1 ID=SMED30014199-orf-1|Name=SMED30014199-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1236bp
MNEVVWAPEPIEGYVKGNVIDIGSNTITVKLLNSQKTITAEYDQTFPVEE
EERNVDDNCSLMFLNNPNLLNNIKIRYFQNNIYTYVANILIAINPYSEIP
KLFSKETILKYKGKSIGTLPPHVYAIADQAYRDMKINKVNQSIIVSGESG
AGKTETTKYILQYLTECYGARAGPIEQRINESNPLLEAFGNSKTVRNNNS
SRYGKFVEIHFDNNSIVAGGFVSHYLLEKSRICKQSSNERNYHIFYRMCA
GMSQKEREKYDLKSPDNYNYLKNGTTRYFCTKNEISKLSTDSKSAEFLKI
GNLNDSQLNDVKDFTTTFNAMKSLGITDKENTEIFGIVAAILHLGNIEFE
EVNTSQGGCQISSSSQSSLQSCCRLLGFKPTELAESLCNRITNAAGQGAQ
YTALRIALKREDARNARDALAKAIYSRLFDEIVAFINRAIPFKESANYVG
ILDIAGFEYFEKNSFEQFCINYCNEKLQQFFNERVLNEEQILYEKEGLGL
TKIKFVDNQDCIDLVEKKGSGIIDILDEESKLPKPNNEHFTMALFQTNPN
HFRLQLPRKSKLKAHRDLRDCEGFLIRHFAGAVCYHTEEFIEKNNDALHD
SLKTLLETSSVTLMCQMFPKEVLKSGVMTSPILKKGHGIGKLSFVSVATK
FRSQLIVLMDNLRNSNTNFIRCIKPNVSMVAKSFEGGSILSQLQCSGMTV
VLDLMQQGYPSRIKFIDLYNIYKKILPSNLANLDQRLFCKLLFKAVGLKE
SDFKFGMTKVFFRPGKMAEFDQLIRSDPENVKGMVAKVRKWLIKYRWRKA
QFGVLEVIKLKNKIKWRRQQIIKIQKTLRMWIVRKKFCQKIKSMKKLRNL
NILLEKLTLIAAQLKKSDKGVKMIAANKQKFSKIQSQIRITPSNKMAGVI
QIIDSFQSELTVDINSLQKEVETEKINSEKEKLRLIQEEMRIMKEKTEKE
QLLLKQAEEEKRIKLEMEATRKKEEEKLKRLQAVPKSLIVKEHEETESYI
QELSKEQERRDKELALRIAEGDSTILEELSKPVEISNNQKTNNDVTQYTY
DELRRVINSSCDLKLIEACQTEFHRRVNAYNNWKSKQKEKKNITTTSTKD
SFSESQVQLQPVKNPEPKNEISQITVQRYFSLPFTTVSGKSTQGTWLAHF
DGEYIARQIEIHDKKTSFLLVAGVDDLGMCSLPLSTTGLIARKGAEITET
KFEELWRNLGGIEILQRLNNQISSNYLKSKFLKKL*
back to top
Aliases
The feature 'Myosin' has the following synonyms
Synonym
myoVI
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0051015actin filament binding
GO:0003774motor activity
GO:0005524ATP binding
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0003779actin binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR001609Myosin_head_motor_dom
IPR004009Myosin_N
IPR027417P-loop_NTPase
IPR032412Myosin-VI_CBD
IPR000048IQ_motif_EF-hand-BS
Vocabulary: cellular component
TermDefinition
GO:0016459myosin complex